localhost:5432:postgres:password:md532e12f215ba27cb750c9e093ce4b5127 localhost:5432:postgres:postgres:md53175bce1d3201d16594cebf9d7eb3f9d localhost:5432:postgres:login:md5d5745f9425eceb269f9fe01d0bef06ff PGlite is the best!PGlite is the best!asmdylink.0 *``````envcheck_encoding_conversion_argsenv latin2micenv mic2latinenvlatin2mic_with_tableenvmic2latin_with_tableenv local2localenv __memory_baseenvmemory+**__wasm_call_ctors Pg_magic_funcpg_finfo_koi8r_to_micpg_finfo_mic_to_koi8r pg_finfo_iso_to_mic pg_finfo_mic_to_iso pg_finfo_win1251_to_mic pg_finfo_mic_to_win1251 pg_finfo_win866_to_micpg_finfo_mic_to_win866pg_finfo_koi8r_to_win1251pg_finfo_win1251_to_koi8rpg_finfo_koi8r_to_win866pg_finfo_win866_to_koi8rpg_finfo_win866_to_win1251pg_finfo_win1251_to_win866pg_finfo_iso_to_koi8rpg_finfo_koi8r_to_isopg_finfo_iso_to_win1251pg_finfo_win1251_to_isopg_finfo_iso_to_win866pg_finfo_win866_to_iso koi8r_to_mic mic_to_koi8r iso_to_mic mic_to_isowin1251_to_mic mic_to_win1251! win866_to_mic" mic_to_win866#koi8r_to_win1251$win1251_to_koi8r%koi8r_to_win866&win866_to_koi8r'win866_to_win1251(win1251_to_win866) iso_to_koi8r* koi8r_to_iso+iso_to_win1251,win1251_to_iso- iso_to_win866. win866_to_iso/ * # #A8j #A?<89@89CF?E89I89J;9K89S89T;9U89V89X89Y;9Z\9[^9];9_89`;9e89f;9g>?h89j89nF?p89s89t\9uw9v\9y;9z8989\9w9;98989^9;9;989;9;9\9;9HGNOPQRrqx}OPQ~  #Aj#Aj6#Aȳj#6#A̳j#Aj6#Aгj#Aj6#AԳj#Aj6#Aܳj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#Aj6#Aj#A j6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĴj#Aj6#Aȴj#Aj6#A̴j#Aj6#AԴj#Aj6#Aشj#Aj6#Aܴj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#Aj6#Aj#A!j6#Aj#A"j6#Aj#A#j6#Aj#Aj6#Aj#A$j6#Aj#A%j6#Aj#A&j6#Aĵj#Aj6#A̵j#A'j6#Aеj#A(j6#AԵj#A)j6#Aصj#Aj6#Aj#A*j6#Aj#A+j6#Aj#A,j6#Aj#Aj6#Aj#A-j6#Aj#A.j6#Aj#A/j6#Aj#Aj6#Aj#A0j6#Aj#A1j6#Aj#A2j6#Aj#Aj6#Aj#A3j6#Aj#A4j6#Aj#A5j6#Aj#Aj6#Aj#A6j6#Aj#A7j6#Aj#A8j6#Aj#Aj6#AĶj#A9j6#Aȶj#A:j6#A̶j#A;j6#Aжj#Aj6#Aضj#Aj6#Aj#Aj6#Aj#A?j6#Aj#A@k6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aķj#Aj6#Aȷj#Aj6#Aзj#Aj6#AԷj#Aj6#Aطj#Aj6#Aܷj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȸj#Aj6#A̸j#Aj6#Aиj#Aj6#AԸj#Aj6#Aܸj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĹj#Aj6#Aȹj#Aj6#A̹j#Aj6#AԹj#Aj6#Aعj#Aj6#Aܹj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĺj#Aj6#A̺j#Aj6#Aкj#Aj6#AԺj#Aj6#Aغj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#A j6#Aj#Aj6#Aj#Aj6#AȻj#Aj6#Aܻj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԼj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̽j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aľj#Aj6#Aؾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aпj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЀj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȁj#Aj6#A܁j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԂj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ãj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȄj#Aj6#A܄j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԅj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ăj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aćj#Aj6#A؇j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЈj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȉj#Aj6#A܉j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԊj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̋j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AČj#Aj6#A،j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЍj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȎj#Aj6#A܎j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԏj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̐j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ađj#Aj6#Aؑj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AВj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȓj#Aj6#Aܓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԔj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̕j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĖj#Aj6#Aؖj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЗj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȘj#Aj6#Aܘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԙj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̚j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aěj#Aj6#A؛j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AМj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȝj#Aj6#Aܝj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԞj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̟j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĠj#Aj6#Aؠj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AСj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȢj#Aj6#Aܢj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԣj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̤j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĥj#Aj6#Aإj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЦj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȧj#Aj6#Aܧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԨj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̩j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĪj#Aj6#Aتj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЫj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȬj#Aj6#Aܬj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԭj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̮j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aįj#Aj6#Aدj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aаj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȱj#Aj6#Aܱj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԲj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̳j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĴj#Aj6#Aشj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aеj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȶj#Aj6#Aܶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԷj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̸j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĹj#Aj6#Aعj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aкj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȻj#Aj6#Aܻj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԼj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̽j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aľj#Aj6#Aؾj#Aj6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aпj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A!j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A"j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A#j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A$j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A%j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A&j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A'j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A(j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A)j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A*j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A+j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#Aj6#Aj#A,j6#Aj#Aj6#Aj#A,j6#Aj#A,j6#Aj#Aj6#Aj#A,j6#Aj#A,j6#Aj#Aj6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A,j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#Aj#A-j6#AȀj#A-j6#Aj#A.j6#Aj#A.j6#Aj#A.j6#Aj#A.j6#Aj#A.j6#Áj#A.j6#Aj#A.j6#Aj#A.j6#Aj#A.j6#Aj#A.j6#Aj#A/j6#AĂj#A/j6#A؂j#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#AЃj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#AȄj#A/j6#A܄j#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aԅj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A/j6#Aj#A0j6#Ăj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aćj#A0j6#A؇j#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#AԈj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aĉj#A0j6#A؉j#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#AЊj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aj#A0j6#Aȋj#A1j6#A܋j#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#AԌj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#A̍j#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#AĎj#A1j6#A؎j#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aj#A1j6#Aԏj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#A̐j#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Ađj#A2j6#Aؑj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#AВj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aȓj#A2j6#Aܓj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#Aj#A2j6#AԔj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aԕj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#AԖj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aėj#A3j6#Aؗj#A3j6#Aj#A3j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#AԘj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#AЙj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#AȚj#A4j6#Aܚj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Ațj#A4j6#Aܛj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#AȜj#A4j6#Aܜj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aȝj#A4j6#Aܝj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#A4j6#Aj#Aj6#Aj#A4j6#AԞj#A4j6#Aj#A4j6#Aj#A4j6#Aj#Aj6#Aj#A4j6#Aj#A5j6#Aj#Aj6#Aj#A5j6#Ağj#Aj6#A̟j#A5j6#A؟j#Aj6#Aj#A5j6#Aj#Aj6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#AȠj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aȡj#A5j6#Aܡj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#AԢj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Ạj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#Aj#A5j6#AĤj#A6j6#Aؤj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#AХj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#AȦj#A6j6#Aܦj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aj#A6j6#Aԧj#A6j6#Aj#A6j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Ąj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aĩj#A7j6#Aةj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#Aj#A7j6#AЪj#A7j6#Aj#A7j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aԫj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#A̬j#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aĭj#A8j6#Aحj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#AԮj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A8j6#Aj#A9j6#A̯j#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aİj#A9j6#Aذj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aбj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#AȲj#A9j6#Aܲj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#AԳj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#Aj#A9j6#AĴj#A9j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aȵj#A:j6#Aܵj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#AԶj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#A̷j#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A:j6#Aĸj#A:j6#Aظj#A:j6#Aj#A:j6#Aj#A:j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aйj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#AȺj#A;j6#Aܺj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#AԻj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#A̼j#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#Aj#A;j6#AȽj#A;j6#Aܽj#A;j6#Aj#A;j6#Aj#A;j6#Aj#Aj6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A>j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A?j6#Aj#A@k6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԀj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Áj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĂj#Aj6#A؂j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЃj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȄj#Aj6#A܄j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԅj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԆj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ȧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Äj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĉj#Aj6#A؉j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЊj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȋj#Aj6#A܋j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԌj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̍j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĎj#Aj6#A؎j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЏj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȐj#Aj6#Aܐj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԑj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̒j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aēj#Aj6#Aؓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AДj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȕj#Aj6#Aܕj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԖj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̗j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĘj#Aj6#Aؘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЙj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȚj#Aj6#Aܚj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ațj#Aj6#Aܛj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԜj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̝j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĞj#Aj6#A؞j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AПj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȠj#Aj6#Aܠj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̡j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȢj#Aj6#Aܢj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ạj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĤj#Aj6#Aؤj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĥj#Aj6#Aإj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЦj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȧj#Aj6#Aܧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĨj#Aj6#Aبj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЩj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȪj#Aj6#Aܪj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԫj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̬j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĭj#Aj6#Aحj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЮj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȯj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̰j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԱj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̲j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aijj#Aj6#Aسj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aдj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȵj#Aj6#Aܵj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̷j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȸj#Aj6#Aܸj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԹj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̺j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĻj#Aj6#Aػj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aмj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȽj#Aj6#Aܽj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԿj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȀj#Aj6#A܀j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԁj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Âj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aăj#Aj6#A؃j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЄj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȅj#Aj6#A܅j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԆj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ȧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĈj#Aj6#A؈j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЉj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȊj#Aj6#A܊j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԋj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ǎj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ačj#Aj6#A؍j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЎj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȏj#Aj6#A܏j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԐj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ȃj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĒj#Aj6#Aؒj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԔj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̕j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̖j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aėj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̙j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĚj#Aj6#Aؚj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԛj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĜj#Aj6#A؜j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȝj#Aj6#Aܝj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԞj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̟j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĠj#Aj6#Aؠj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AСj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȢj#Aj6#Aܢj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԣj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̤j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĥj#Aj6#Aإj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȦj#Aj6#Aܦj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ąj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĩj#Aj6#Aةj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЪj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȫj#Aj6#Aܫj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԬj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̭j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĮj#Aj6#Aخj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЯj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȰj#Aj6#Aܰj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aıj#Aj6#Aرj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aвj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȳj#Aj6#Aܳj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԴj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aеj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȶj#Aj6#Aܶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԷj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̸j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĹj#Aj6#Aعj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aкj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȻj#Aj6#Aܻj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԼj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̽j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aľj#Aj6#Aؾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aпj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЀj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȁj#Aj6#A܁j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԂj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ãj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȄj#Aj6#A܄j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԅj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ăj#Aj6#Aj#AĀj6#Aj#Àj6#Aj#AЀj6#Aj#AӀj6#Aj#Aրj6#Aćj#Aۀj6#A؇j#Aހj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЈj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȉj#Aj6#A܉j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԊj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̋j#Aj6#Aj#AƁj6#Aj#Aʁj6#Aj#A΁j6#Aj#AՁj6#Aj#A܁j6#AČj#Aj6#A،j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЍj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȎj#Aj6#A܎j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԏj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĂj6#Aj#AȂj6#Aj#Âj6#A̐j#AЂj6#Aj#AՂj6#Aj#A؂j6#Aj#Aڂj6#Aj#A݂j6#Aj#Aj6#Ađj#Aj6#Aؑj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AВj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȓj#Aj6#Aܓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŃj6#Aj#AɃj6#AԔj#Aуj6#Aj#Aۃj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̕j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĖj#Aj6#Aؖj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЗj#Aj6#Aj#Aj6#Aj#ADŽj6#Aj#A˄j6#Aj#Aфj6#Aj#A؄j6#AȘj#Aj6#Aܘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԙj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̚j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aěj#Aj6#A؛j#Aj6#Aj#Aj6#Aj#AŅj6#Aj#Aʅj6#Aj#Aͅj6#Aj#A҅j6#AМj#Aڅj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȝj#Aj6#Aܝj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԞj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̟j#Aj6#Aj#Aj6#Aj#Aj6#Aj#A†j6#Aj#Adžj6#Aj#AɆj6#AĠj#Ăj6#Aؠj#Aφj6#Aj#Aӆj6#Aj#A׆j6#Aj#A܆j6#Aj#Aj6#Aj#Aj6#AСj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȢj#Aj6#Aܢj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԣj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̤j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÇj6#Aj#Aȇj6#Aĥj#Ȧj6#Aإj#Aχj6#Aj#A҇j6#Aj#Aևj6#Aj#Aهj6#Aj#Aއj6#Aj#Aj6#AЦj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȧj#Aj6#Aܧj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԨj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̩j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĪj#Aj6#Aتj#Aˆj6#Aj#ALjj6#Aj#A͈j6#Aj#Aшj6#Aj#Aֈj6#Aj#Aۈj6#AЫj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȬj#Aj6#Aܬj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԭj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̮j#Aj6#Aj#AÉj6#Aj#Aɉj6#Aj#Aˉj6#Aj#AΉj6#Aj#AӉj6#Aįj#A؉j6#Aدj#A܉j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aаj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȱj#Aj6#Aܱj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԲj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĊj6#Aj#AȊj6#Aj#A͊j6#A̳j#AҊj6#Aj#A׊j6#Aj#A݊j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĴj#Aj6#Aشj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aеj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȶj#Aj6#Aܶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԷj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aŋj6#Aj#Aɋj6#Aj#A΋j6#A̸j#Aҋj6#Aj#A؋j6#Aj#Aދj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĹj#Aj6#Aعj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aкj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȻj#Aj6#Aܻj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Anjj6#AԼj#AΌj6#Aj#AҌj6#Aj#A֌j6#Aj#Aیj6#Aj#Aj6#Aj#Aj6#A̽j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aľj#Aj6#Aؾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aпj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aōj6#Aj#Aˍj6#Aj#AЍj6#Aj#AՍj6#Aj#Aٍj6#Aj#Aߍj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aǎj6#Aj#Aώj6#Aj#Aӎj6#Aj#A؎j6#Aj#Aێj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aďj6#Aj#Aɏj6#Aj#AΏj6#Aj#Aӏj6#Aj#Aڏj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĐj6#Aj#Aǐj6#Aj#Aʐj6#Aj#A͐j6#Aj#Aѐj6#Aj#AՐj6#Aj#Aڐj6#Aj#Aސj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÑj6#Aj#Aőj6#Aj#AǑj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A’j6#Aj#AĒj6#Aj#Aɒj6#Aj#AВj6#Aj#AԒj6#Aj#Aْj6#Aj#Aݒj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÓj6#Aj#Aœj6#Aj#AǓj6#Aj#Aɓj6#Aj#A˓j6#Aj#A͓j6#Aj#Aϓj6#Aj#Aѓj6#Aj#Aӓj6#Aj#AՓj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÔj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aǔj6#Aj#AȔj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A•j6#Aj#A̕j6#Aj#Aѕj6#Aj#Aוj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŖj6#Aj#Aǖj6#Aj#Aɖj6#Aj#A˖j6#Aj#A͖j6#Aj#Aϖj6#Aj#Aіj6#Aj#AӖj6#Aj#AՖj6#Aj#Aזj6#Aj#Aٖj6#Aj#Aۖj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aŗj6#Aj#A˗j6#Aj#AЗj6#Aj#A֗j6#Aj#Aݗj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A˜j6#Aj#AĘj6#Aj#AȘj6#Aj#A̘j6#Aj#AИj6#Aj#AԘj6#Aj#Aטj6#Aj#Aژj6#Aj#Aݘj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A™j6#Aj#Aƙj6#Aj#A̙j6#Aj#AΙj6#Aj#Aљj6#Aj#Aڙj6#Aj#Aݙj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Ašj6#Aj#AŚj6#Aj#Aƚj6#Aj#Aɚj6#Aj#Aj6#Aj#A̚j6#Aj#Aj6#Aj#AКj6#Aj#AӚj6#Aj#Aj6#Aj#Aךj6#Aj#Aښj6#Aj#Aj6#Aj#Aޚj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aěj6#Aj#Ațj6#Aj#A˛j6#Aj#Aϛj6#Aj#Aқj6#Aj#A֛j6#Aj#Aڛj6#Aj#Aޛj6#Aj#Aj6#Aj#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȀ j#Aj6#A j#Aj6#A j#AĜj6#A j#Aǜj6#A j#Aj6#A j#Aj6#Á j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĂ j#Aj6#A؂ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЃ j#Aj6#A j#Aj6#A j#AÝj6#A j#Aȝj6#A j#A͝j6#A j#Aӝj6#AȄ j#A؝j6#A܄ j#Aݝj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԅ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ă j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ać j#Aj6#A؇ j#AÞj6#A j#Aƞj6#A j#Aʞj6#A j#A͞j6#A j#AОj6#A j#AԞj6#AԈ j#A؞j6#A j#A۞j6#A j#Aݞj6#A j#Aߞj6#A j#Aj6#Aĉ j#Aj6#A؉ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЊ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȋ j#Aj6#A܋ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԌ j#Aj6#A j#AƟj6#A j#Aȟj6#A j#A͟j6#A j#Aӟj6#A j#Aٟj6#A̍ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĎ j#Aj6#A؎ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԏ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̐ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AĠj6#Ađ j#AǠj6#Aؑ j#A̠j6#A j#AРj6#A j#A֠j6#A j#Aݠj6#A j#Aj6#A j#Aj6#AВ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȓ j#Aj6#Aܓ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԔ j#Aj6#A j#Aj6#A j#A¡j6#A j#Aáj6#A j#Aȡj6#A j#A͡j6#Aԕ j#AСj6#A j#Aӡj6#A j#A֡j6#A j#A١j6#A j#Aݡj6#A j#Aj6#AԖ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aė j#Aj6#Aؗ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԘ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЙ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aâj6#A j#AǢj6#AȚ j#Aˢj6#Aܚ j#A͢j6#A j#AѢj6#A j#Aբj6#A j#Aעj6#Aț j#Aߢj6#Aܛ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȜ j#Aj6#Aܜ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԝ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̞ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ağ j#Aj6#A؟ j#Aj6#A j#Aj6#A j#Aãj6#A j#Aţj6#A j#Aǣj6#A j#Aɣj6#AР j#Aˣj6#A j#Aͣj6#A j#Aϣj6#A j#Aѣj6#A j#Aӣj6#A j#Aգj6#Aȡ j#Aףj6#Aܡ j#A٣j6#A j#Aۣj6#A j#Aݣj6#A j#Aߣj6#A j#Aj6#A j#Aj6#AԢ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԣ j#Aj6#A j#AФj6#A j#A֤j6#A j#Aj6#A j#Aj6#A j#Aj6#A̤ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AХj6#A j#Aj6#Aĥ j#Aj6#Aإ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AҦj6#AЦ j#Aڦj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȧ j#Aj6#Aܧ j#Aj6#A j#Aj6#A j#Aʧj6#A j#Aj6#A j#Aj6#A j#Aj6#AԨ j#Aj6#A j#Aj6#A j#Aj6#A j#A¨j6#A j#AΨj6#A j#Aܨj6#A̩ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĪ j#Aj6#Aت j#Aj6#A j#AƩj6#A j#A̩j6#A j#Aةj6#A j#Aj6#A j#Aj6#AЫ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЬ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aªj6#Aȭ j#A̪j6#Aܭ j#AҪj6#A j#Aتj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԮ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̯ j#Aj6#A j#Aīj6#A j#AЫj6#A j#Aثj6#A j#Aj6#A j#Aj6#Aİ j#Aj6#Aذ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԱ j#Aj6#A j#A¬j6#A j#AЬj6#A j#Aܬj6#A j#Aެj6#A j#Aj6#Aв j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȳ j#Aj6#Aܳ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĴ j#A­j6#Aش j#Aĭj6#A j#AЭj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aе j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A®j6#A j#Aήj6#Aȶ j#AҮj6#Aܶ j#Aخj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԷ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̸ j#Aj6#A j#Aj6#A j#AƯj6#A j#Aʯj6#A j#Aүj6#A j#Aj6#AĹ j#Aj6#Aع j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԺ j#Aj6#A j#Aj6#A j#Aj6#A j#Aʰj6#A j#Aְj6#A j#Aްj6#A̻ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aļ j#Aj6#Aؼ j#Aj6#A j#Aj6#A j#Aj6#A j#AƱj6#A j#Aαj6#A j#Aֱj6#AԽ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̾ j#Aj6#A j#Aj6#A j#Aj6#A j#A²j6#A j#A̲j6#A j#AԲj6#Aȿ j#Aֲj6#Aܿ j#Aܲj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aijj6#A j#Aȳj6#A j#A̳j6#A j#Aҳj6#A j#Aسj6#A j#A޳j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AƵj6#A j#Aеj6#A j#Aڵj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aȶj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aзj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AƸj6#A j#Aθj6#A j#Aָj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A̹j6#A j#Aҹj6#A j#Aܹj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aƺj6#A j#Aʺj6#A j#Aкj6#A j#Aغj6#A j#A޺j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AĻj6#A j#A̻j6#A j#Aֻj6#A j#A޻j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aļj6#A j#A̼j6#A j#Aּj6#A j#A޼j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AȽj6#A j#Aҽj6#A j#Aֽj6#A j#Aܽj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A¾j6#A j#Aʾj6#A j#Aξj6#A j#Aؾj6#A j#A޾j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aȿj6#A j#Aοj6#A j#Aֿj6#A j#Aܿj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#À j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aā j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĂ j#Aj6#A؂ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aă j#Aj6#A؃ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЄ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aą j#Aj6#A؅ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԆ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԇ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȈ j#Aj6#A܈ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԉ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Å j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aċ j#Aj6#A؋ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЌ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȍ j#Aj6#A܍ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̎ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȏ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̐ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ađ j#Aj6#Aؑ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AВ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȓ j#Aj6#Aܓ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԔ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̕ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĖ j#Aj6#Aؖ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЗ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȘ j#Aj6#Aܘ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̙ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĚ j#Aj6#Aؚ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aț j#Aj6#Aܛ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȜ j#Aj6#Aܜ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĝ j#Aj6#A؝ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĞ j#Aj6#A؞ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AП j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȠ j#Aj6#Aܠ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԡ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̢ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aģ j#Aj6#Aأ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AФ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȥ j#Aj6#Aܥ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԦ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̧ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĨ j#Aj6#Aب j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЩ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȪ j#Aj6#Aܪ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԫ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̬ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĭ j#Aj6#Aح j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЮ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȯ j#Aj6#Aԯ j#Aj6#Aܯ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A԰ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̱ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AIJ j#Aj6#Aز j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aг j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȴ j#Aj6#Aܴ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԵ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĶ j#Aj6#A̶ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aķ j#Aj6#Aط j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aи j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȹ j#Aj6#Aܹ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̺ j#Aj6#AԺ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̻ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aļ j#Aj6#Aؼ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aн j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȾ j#Aj6#Aܾ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԿ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĀ j#Aj6#A؀ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЁ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȂ j#Aj6#A܂ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԃ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ā j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aą j#Aj6#A؅ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AІ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȇ j#Aj6#A܇ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԈ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ả j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĊ j#Aj6#A؊ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЋ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȌ j#Aj6#A܌ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A؍ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԎ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ȁ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȐ j#Aj6#Aܐ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԑ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̒ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aē j#Aj6#Aؓ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AД j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȕ j#Aj6#Aܕ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԖ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̗ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĘ j#Aj6#Aؘ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЙ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȚ j#Aj6#Aܚ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԛ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̜ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĝ j#Aj6#A؝ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AО j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȟ j#Aj6#Aܟ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԠ j#AÀj6#A j#Aŀj6#A j#AȀj6#A j#Aʀj6#A j#Àj6#A j#AЀj6#A̡ j#Aрj6#A j#AӀj6#A j#A׀j6#A j#Aۀj6#A j#A݀j6#A j#Aހj6#AĢ j#Aj6#Aآ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AУ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȤ j#Aj6#Aܤ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԥ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̦ j#AŁj6#A j#Aȁj6#A j#Aʁj6#A j#Áj6#A j#AЁj6#A j#Aԁj6#Aħ j#Aׁj6#Aا j#Aفj6#A j#A܁j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AШ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȩ j#Aj6#Aܩ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԪ j#Aj6#A j#Aj6#A j#Aj6#A j#AÂj6#A j#Âj6#A j#Aςj6#A̫ j#A҂j6#A j#Aւj6#A j#A؂j6#A j#Aۂj6#A j#A݂j6#A j#Aj6#AĬ j#Aj6#Aج j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЭ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȮ j#Aj6#Aܮ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԯ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A԰ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̱ j#Aj6#A j#Aăj6#A j#Aǃj6#A j#Aʃj6#A j#A΃j6#A j#AЃj6#AIJ j#AӃj6#Aز j#Aփj6#A j#Aۃj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aг j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȴ j#Aj6#Aܴ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԵ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̶ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aķ j#Aj6#Aط j#AĄj6#A j#AƄj6#A j#AɄj6#A j#Ä́j6#A j#Aτj6#A j#A҄j6#Aи j#Aׄj6#A j#Aڄj6#A j#A݄j6#A j#A߄j6#A j#Aj6#A j#Aj6#Aȹ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԺ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̻ j#AЅj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aļ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aˆj6#A j#AΆj6#A̽ j#Aцj6#A j#AԆj6#A j#A݆j6#A j#Aj6#A j#Aj6#A j#Aj6#AȾ j#Aj6#Aܾ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԿ j#Aj6#A j#Aɇj6#A j#A҇j6#A j#A؇j6#A j#Aއj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AĈj6#A j#AЈj6#A j#Aֈj6#A j#A߈j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aʼnj6#A j#Aщj6#A j#Aډj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AɊj6#A j#AՊj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#ANjj6#A j#AӋj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AΌj6#A j#Aڌj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A̍j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AŽj6#A j#AȎj6#A j#Aˎj6#A j#AΎj6#A j#AЎj6#A j#Aӎj6#A j#A֎j6#A j#Aَj6#A j#Aێj6#A j#Aݎj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AŐj6#A j#A̐j6#A j#Aאj6#A j#Aܐj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A’j6#A j#AȒj6#A j#AΒj6#A j#AҒj6#A j#A֒j6#A j#Aݒj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A“j6#A j#Aēj6#A j#Aȓj6#A j#A̓j6#A j#Aѓj6#A j#Aӓj6#A j#Aדj6#A j#Aٓj6#A j#Aܓj6#A j#Aߓj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AÔj6#A j#AŔj6#A j#Aɔj6#A j#A͔j6#A j#Aєj6#A j#A֔j6#A j#A۔j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aĕj6#A j#Aȕj6#A j#A̕j6#A j#AЕj6#A j#AՕj6#A j#Aڕj6#A j#Aߕj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AŖj6#A j#A̖j6#A j#AЖj6#A j#AԖj6#A j#Aؖj6#A j#Aߖj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aėj6#A j#Aɗj6#A j#AΗj6#A j#Aӗj6#A j#Aؗj6#A j#Aݗj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AØj6#A j#AŘj6#A j#Aʘj6#A j#A͘j6#A j#AИj6#A j#A՘j6#A j#Aؘj6#A j#Aۘj6#A j#Aߘj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A›j6#A j#Aƛj6#A j#Aʛj6#A j#A͛j6#A j#AЛj6#A j#Aқj6#A j#A՛j6#A j#Aڛj6#A j#Aߛj6#A j#Aj6#AĀ j#Aj6#A؀ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЁ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȂ j#Aj6#A܂ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԃ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AĜj6#A j#A˜j6#Ā j#AϜj6#A j#AӜj6#A j#A֜j6#A j#Aڜj6#A j#Aܜj6#A j#Aޜj6#Aą j#Aj6#A؅ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AІ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȇ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȈ j#Aj6#A܈ j#Aj6#A j#Aj6#A j#Aj6#A j#Aęj6#A j#A˙j6#A j#Aҙj6#Aԉ j#Aۙj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Å j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aċ j#Aj6#A؋ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AÚj6#A j#A̚j6#AЌ j#AӚj6#A j#Aܚj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȍ j#Aj6#A܍ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԎ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԏ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̐ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aĝj6#A j#Aǝj6#Ađ j#A˝j6#Aؑ j#AНj6#A j#A֝j6#A j#Aٝj6#A j#A۝j6#A j#Aޝj6#A j#Aj6#AВ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȓ j#Aj6#Aܓ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԔ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̕ j#Aj6#A j#AÞj6#A j#Aʞj6#A j#AҞj6#A j#A۞j6#A j#Aj6#AĖ j#Aj6#Aؖ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЗ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȘ j#Aj6#Aܘ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AƟj6#A j#A̟j6#Aԙ j#Aӟj6#A j#A۟j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̚ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aě j#Aj6#A؛ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AМ j#Aj6#A j#Aj6#A j#Aj6#A j#AƠj6#A j#Aʠj6#A j#AΠj6#Aȝ j#AӠj6#A j#Aؠj6#A j#A٠j6#A j#Aڠj6#A j#Aܠj6#A j#Aݠj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AП j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԠ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aâj6#Aԡ j#AŢj6#A j#Aɢj6#A j#AϢj6#A j#AӢj6#A j#Aj6#A j#Ašj6#A̢ j#Aˡj6#A j#Aϡj6#A j#Aӡj6#A j#Aסj6#A j#Aۡj6#A j#Aߡj6#Aģ j#Aj6#Aأ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AФ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȥ j#Aj6#Aܥ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aۢj6#AȦ j#Aߢj6#Aܦ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԧ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ą j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĩ j#Aj6#Aة j#Aj6#A j#Aǣj6#A j#Aͣj6#A j#Aӣj6#A j#Aۣj6#A j#Aj6#AЪ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȫ j#Aj6#Aܫ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԬ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԭ j#Aj6#A j#Aj6#A j#Aj6#A j#AŤj6#A j#Aɤj6#A j#Aˤj6#A̮ j#Aͤj6#A j#AϤj6#A j#AӤj6#A j#Aפj6#A j#A٤j6#A j#Aݤj6#Aį j#Aj6#Aد j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aа j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȱ j#Aj6#Aܱ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԲ j#Aj6#A j#Aj6#A j#Aj6#A j#Aåj6#A j#Aťj6#A j#A˥j6#AԳ j#A٥j6#A j#Aߥj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̴ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĵ j#Aj6#Aص j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aж j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȷ j#Aj6#Aܷ j#Aj6#A j#Aj6#A j#A¦j6#A j#AĦj6#A j#AƦj6#A j#AȦj6#AԸ j#Aʦj6#A j#A̦j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԹ j#Aj6#A j#Aj6#A j#Aªj6#A j#AǪj6#A j#A̪j6#A j#AѪj6#A̺ j#Aժj6#A j#A٪j6#A j#Aݪj6#A j#Aj6#A j#Aj6#A j#Aj6#AĻ j#Aj6#Aػ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aм j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȽ j#Aj6#Aܽ j#Aj6#A j#Aj6#A j#Aūj6#A j#A˫j6#A j#Aѫj6#A j#A׫j6#AԾ j#Aݫj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̿ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AĬj6#A j#AǬj6#A j#Aʬj6#A j#Aͬj6#A j#AѬj6#A j#Aլj6#A j#A٬j6#A j#Aݬj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aíj6#A j#Aǭj6#A j#A˭j6#A j#AЭj6#A j#Aխj6#A j#A٭j6#A j#Aޭj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AƮj6#A j#Aˮj6#A j#AѮj6#A j#A׮j6#A j#Aܮj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Adzj6#A j#Aϳj6#A j#Aֳj6#A j#Aܳj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AŴj6#A j#Aʴj6#A j#Aдj6#A j#Aմj6#A j#Aٴj6#A j#A޴j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aµj6#A j#Aǵj6#A j#A͵j6#A j#Aӵj6#A j#Aٵj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AǶj6#A j#AͶj6#A j#AӶj6#A j#Aֶj6#A j#Aٶj6#A j#Aݶj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AǷj6#A j#Aͷj6#A j#Aӷj6#A j#Aٷj6#A j#A߷j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aøj6#A j#AǸj6#A j#A̸j6#A j#Aθj6#A j#AѸj6#A j#Aոj6#A j#Aظj6#A j#Aݸj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aùj6#A j#Aƹj6#A j#Aɹj6#A j#Aιj6#A j#AԹj6#A j#Aعj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aƺj6#A j#Aͺj6#A j#AԺj6#A j#Aۺj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#AŻj6#A j#A˻j6#A j#Aѻj6#A j#Aػj6#A j#Aݻj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#A¼j6#A j#Aȼj6#A j#Aμj6#A j#AԼj6#A j#Aټj6#A j#A޼j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aǽj6#A j#A˽j6#A j#Aнj6#A j#Aսj6#A j#Aڽj6#A j#A߽j6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Ažj6#A j#A˾j6#A j#AҾj6#A j#Aھj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aʿj6#A j#Aӿj6#A j#Aۿj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԀ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Á j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĂ j#Aj6#A؂ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЃ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȄ j#Aj6#A܄ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԅ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ă j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ać j#Aj6#A؇ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЈ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȉ j#Aj6#A܉ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԊ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̋ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AČ j#Aj6#A، j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЍ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȎ j#Aj6#A܎ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԏ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̐ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Ađ j#Aj6#Aؑ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AВ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȓ j#Aj6#Aܓ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԔ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̕ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĖ j#Aj6#Aؖ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЗ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȘ j#Aj6#Aܘ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԙ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̚ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aě j#Aj6#A؛ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AМ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȝ j#Aj6#Aܝ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԞ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̟ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĠ j#Aj6#Aؠ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AС j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȢ j#Aj6#Aܢ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԣ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̤ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aĥ j#Aj6#Aإ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЦ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȧ j#Aj6#Aܧ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԨ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̩ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĪ j#Aj6#Aت j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AЫ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȬ j#Aj6#Aܬ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aԭ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̮ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aį j#Aj6#Aد j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aа j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȱ j#Aj6#Aܱ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԲ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̳ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĴ j#Aj6#Aش j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aе j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aȶ j#Aj6#Aܶ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԷ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̸ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AĹ j#Aj6#Aع j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aк j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AȻ j#Aj6#Aܻ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#AԼ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A̽ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aľ j#Aj6#Aؾ j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aп j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#A j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЀj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȁj#Aj6#A܁j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԂj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Ãj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĄj#Aj6#A؄j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЅj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȆj#Aj6#A܆j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԇj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Äj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĉj#Aj6#A؉j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЊj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȋj#Aj6#A܋j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԌj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̍j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĎj#Aj6#A؎j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЏj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȐj#Aj6#Aܐj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԑj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̒j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aēj#Aj6#Aؓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AДj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȕj#Aj6#Aܕj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԖj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̗j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĘj#Aj6#Aؘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЙj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȚj#Aj6#Aܚj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԛj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̜j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĝj#Aj6#A؝j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AОj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȟj#Aj6#Aܟj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԠj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̡j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĢj#Aj6#Aآj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AУj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȤj#Aj6#Aܤj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԥj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̦j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aħj#Aj6#Aاj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AШj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȩj#Aj6#Aܩj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԪj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̫j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĬj#Aj6#Aجj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЭj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȮj#Aj6#Aܮj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԯj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̰j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aıj#Aj6#Aرj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aвj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȳj#Aj6#Aܳj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԴj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̵j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĶj#Aj6#Aضj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aзj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȸj#Aj6#Aܸj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԹj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̺j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĻj#Aj6#Aػj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aмj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȽj#Aj6#Aܽj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̿j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aƀj6#Aj#Àj6#Aj#AՀj6#Aj#A܀j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aǁj6#Aj#Aˁj6#Aj#AЁj6#Aj#Aցj6#Aj#Aځj6#Aj#A߁j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A‚j6#Aj#Aǂj6#Aj#Âj6#Aj#Aтj6#Aj#Aׂj6#Aj#A݂j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aǃj6#Aj#A̓j6#Aj#AӃj6#Aj#Aكj6#Aj#Aۃj6#Aj#Aރj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Àj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĄj6#Aāj#AɄj6#A؁j#A΄j6#Aj#A҄j6#Aj#Aքj6#Aj#Aڄj6#Aj#Aބj6#Aj#Aj6#AЂj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȃj#Aj6#A܃j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԄj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̅j#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÅj6#Aj#Aƅj6#Aj#AɅj6#AĆj#A΅j6#A؆j#AӅj6#Aj#Aׅj6#Aj#A܅j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AЇj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȈj#Aj6#A܈j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĆj6#Aԉj#AȆj6#Aj#AІj6#Aj#A؆j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Åj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȋj#Aj6#A܋j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԌj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̍j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÇj6#Aj#AŇj6#AĎj#Aɇj6#A؎j#Aʇj6#Aj#A͇j6#Aj#AЇj6#Aj#AӇj6#Aj#Aԇj6#Aďj#Aj6#A؏j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AАj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԑj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĈj6#A̒j#Aƈj6#Aj#AȈj6#Aj#Aʈj6#Aj#A͈j6#Aj#AЈj6#Aj#Aj6#Aȓj#Aj6#Aܓj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԔj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̕j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĖj#Aj6#Aؖj#Aj6#Aj#AƉj6#Aj#Aɉj6#Aj#A͉j6#Aj#Aщj6#Aj#A׉j6#AЗj#A݉j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȘj#Aj6#Aܘj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԙj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŠj6#AԚj#AƊj6#Aj#AȊj6#Aj#Aʊj6#Aj#Åj6#Aj#AΊj6#Aj#AҊj6#A̛j#A֊j6#Aj#Aڊj6#Aj#A܊j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̜j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aĝj#Aj6#A؝j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AОj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȟj#Aj6#Aܟj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԠj#Aj6#Aj#AËj6#Aj#ANjj6#Aj#Aˋj6#Aj#AЋj6#Aj#Aԋj6#A̡j#Aڋj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĢj#Aj6#Aآj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AУj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȤj#Aj6#Aܤj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aԥj#AŌj6#Aj#Aˌj6#Aj#A͌j6#Aj#Aьj6#Aj#A֌j6#Aj#Aیj6#A̦j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aħj#Aj6#Aاj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AШj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Ačj6#Aȩj#Aˍj6#Aܩj#AӍj6#Aj#Aٍj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԪj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̫j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĬj#Aj6#Aجj#Aj6#Aj#Aj6#Aj#AĎj6#Aj#Aǎj6#Aj#AȎj6#Aj#AɎj6#AЭj#Aʎj6#Aj#A̎j6#Aj#AΎj6#Aj#AЎj6#Aj#AҎj6#AȮj#Aَj6#Aܮj#Aێj6#Aj#Aݎj6#Aj#Aߎj6#Aj#Aj6#Aj#Aj6#Aȯj#Aj6#Aܯj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A԰j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̱j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aďj6#Aj#AƏj6#AIJj#Aˏj6#Aزj#A͏j6#Aj#AΏj6#Aj#AЏj6#Aj#AՏj6#Aj#Aڏj6#Aj#Aߏj6#Aгj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȴj#Aj6#Aܴj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̵j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aȶj#Aj6#Aܶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̷j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̸j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̹j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A’j6#Aj#AŒj6#A̺j#AȒj6#Aj#A˒j6#Aj#AΒj6#Aj#Aђj6#Aj#AԒj6#Aj#Aגj6#A̻j#Aڒj6#Aj#Aݒj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̼j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̽j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȾj#Aj6#Aܾj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AԿj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AÓj6#Aj#AƓj6#Aj#Aɓj6#Aj#A̓j6#Aj#Aϓj6#Aj#Aғj6#Aj#AՓj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĔj6#Aj#Aǔj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A–j6#Aj#A˖j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aҗj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĚj6#Aj#Aǚj6#Aj#Aʚj6#Aj#A͚j6#Aj#AКj6#Aj#AӚj6#Aj#A֚j6#Aj#Aٚj6#Aj#Aܚj6#Aj#Aߚj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aěj6#Aj#AǛj6#Aj#Aʛj6#Aj#AЛj6#Aj#Aj6#Aj#Aj6#Aj#Aȟj6#Aj#A˟j6#Aj#AΟj6#Aj#Aџj6#Aj#Aԟj6#Aj#Aןj6#Aj#Aڟj6#Aj#Aݟj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŠj6#Aj#AѠj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĢj6#Aj#AȢj6#Aj#A̢j6#Aj#AТj6#Aj#AӢj6#Aj#A֢j6#Aj#A٢j6#Aj#Aܢj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A£j6#Aj#Aģj6#Aj#Aǣj6#Aj#Aʣj6#Aj#Aͣj6#Aj#AУj6#Aj#Aԣj6#Aj#Aأj6#Aj#Aڣj6#Aj#Aܣj6#Aj#Aߣj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aڤj6#Aj#Aݤj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AΥj6#Aj#Aҥj6#Aj#A֥j6#Aj#Aڥj6#Aj#Aܥj6#Aj#Aޥj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A¦j6#Aj#Aʦj6#Aj#AЦj6#Aj#Aܦj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aʧj6#Aj#Aҧj6#Aj#Aڧj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AШj6#Aj#AԨj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AǬj6#Aj#Aͬj6#Aj#AӬj6#Aj#Aլj6#Aj#A߬j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aíj6#Aj#A˭j6#Aj#Aխj6#Aj#A߭j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŮj6#Aj#AϮj6#Aj#Aٮj6#Aj#A߮j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aïj6#Aj#Aϯj6#Aj#Aݯj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aǰj6#Aj#A˰j6#Aj#AѰj6#Aj#Aװj6#Aj#A߰j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Añj6#Aj#A˱j6#Aj#Aձj6#Aj#A߱j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŲj6#Aj#AͲj6#Aj#Aղj6#Aj#A۲j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AĀj#Aj6 @A "  "6 E @ E  At"6 E A! AL @ ! At" (j 6 ( j(E  Aj" G @  At"6 E     ("@ AJA!@ ( Atj(! Aj" G (   ( ("@ ! A a @ ("@ AJA!@ ( Atj(! Aj" G (   ( ("@ !  # #A8j #AjAAA) ("6 (( J 3"AH  ("6  ( L ( jAk-AG Ak"6 6 (( N 3"AH  (! (  ("6  ! 6@  ( L ( jAk-AG Ak"6 6@ #A?jAAA) (( (J 3"AH  (! ( "6 !@@ 6@@@  N @ ( j-Ak  #AjA/"E  ("6@@@ Ak (!  A#A?j2"AN   A#A?j2"AN   6  N  Aj6 (! (!  6A!   (! ( ("6@  ("Aj"H ( 6 6 #A?jAAA*AH #A?jAAA("AH ( j"6 ( 6 ("Aj"( ("N  6 6 ("6@@  (("H 6 6 @  L ( jAk-"AqAG A tAqE #AjA0"E 6 ("6@@@ Ak 3"AN   (! #A?jAAA)@ (  kj"6  ( L  ( jAk-AG  Ak6 #A?jAAA+  3"AN   A#A?j2"AN   6 ("6 ( !@  (("H 6 6 @  Ak"H@ ( j-AF  6  #AjA0E@ 6  6 (6 (" L Ak"6 6 3"AH  ( ! ("6@  (("H 6 6 @@ Ak" L ( j-"AqAG A tAq  6  #AjA 0E@ 6  6 (6 3"AH  ( ! 6A!   (A6 ("6@@  (F ( j-AG Aj"6 6 A#Aj2"AH  (A6 6 !@@ #AjAAA(! (!@@  ("6  F ( j-AF  6  N  Aj"6  6 Aj6 A#Aj2"AH  (A6 (!  6 ( 6 ( (6 (!@ #AjAAA*"AH ( j6 #AjAAA("AH ( j"6 ( 6 #AjAAA*"AH ( j6 #AjAAA("AH ( ( j6 6 ("6 6@  L ( jAk-AG #AjA0"E (6@@@ Ak A#Aj2"AN   A#Aj2"AN   3"AH  ("6 6@ Ak" ( L @ ( j-Ak #AjA0"E ("6@@ Ak (( J  A#Aj2"AN   (! #AjAAA+AH (  kj6 3"AH  (!@ ("Ak" ( L ( j-"AqAG A tA qE #AjA 0"E   k ("j"6@@ Ak  A#Aj4! 6 AN   6  ( L  Ak"6 6 3"AN    ((G A #AjAAA+ A #AjAAA)  #AjAAA+E E (  kj"6  A#Aj4! 6 AH  ("6 6@  ( L ( jAk-A rAG Ak"6 6 #AjAAA+"AH ( k6 A#Aj2"AH  ("6 6@ ( AkN ( jAk-"AqAG A tA1qE #AjA0"E ("6 (( J @@@@@@@@@@@@@ Ak  A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (6A! ("6@ ( AkN ( jAk-"AqAG A tA qE #AjA0"E ("6 (( J @@@@ Ak A#Aj2"AN   A#Aj2"AN   3"AH  A! "AH (6A! ("6@ Ak" ( L ( j-"AqAG A tAqE #AjA0"E ("6 (( J @@@ Ak 3"AN    ( L  ( jAk-AkAqAK  Ak6 3"AH  A! "AH (6A! " ("6@  ( L ( jAk-AG Ak"6 6  ("(L@ ( N  (!@ #AjAAA+ #AjAAA) #AjAAA+E   (  kj6 A 3" AN! "AH (6 W"AH ( "6@ ((E @ (" ("  J!@@ 6  G@ ( j-AF   F  Aj"6  6 Aj6 A#Aj2"AN  6A!   ("6@  ( "L (" jAk-AG Ak"6 6 (( N  L  jAk-AG Ak6A 3" AN!   ("!@@@ 6@@@  ("N @ ( j-Ak #AjA/"E@ (!  ("6@@@ Ak (!  A#Aj2"AN   A#Aj2"AN   6  N  Aj6 (!  6 ( 6 ( 6 ( (6 (!@@ #AjAAA( (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA( #AjAAA("AH ( j  6 #AjAAA*  (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA(  (" (N  Aj ! ( 6 6@ #AjAAA*"AH ( j6 #AjAAA("AH ( j"6 ( 6 #AjAAA*"AH ( j6 #AjAAA("AH ( ( j6 6 ("6 6@@@ Ak L ( jAk-"AqAG A tA2qE #AjA-0"E ("6@@@@@@@@@ Ak  (( J  3"AN (( J  A#Aj2"AN  (( J  A#Aj2"AN  (( J  A#Aj2"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AjA0"E  ("6 (( J  3"AH  AG  (6 A#Aj-E  ("6 (( J  3"AN   (( J  3"AH  ("6 ( AkN @ ( jAk-Ak #AjA0E  ("6 (( J  3"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AjA0E  ("6 (( J  3"AN   (( J  3"AH  (6 A#Aj-E  ("6 (( J  3"AN   (( J  ( L ( jAk-AG Ak6 A#Aj2"AN   ("6@ ((" L@ 6 ( ! 6 #AjA0  6 (! 6 6 #AjA0E  ("6 (( J  3"AN   (6 3"AH  6 ("6 6  ( "L ( j"Ak-AG Ak"6 6  N Ak-AG (( N 3"AH  ("6 6@ #AjA0"E ("6@@ Ak (( J  3"AH  ("6  ( "L @@ ( j"Ak"-AG Ak"6 6  L Ak-AF  6 -AG  Ak"6 6  L  Ak-AG  6 (( J  3"AN   A#Aj2"AH  ( "6 (! !@@ 6@@@  Aj"J@ ( j-AF  6  #AjA/"E  ("6@@@ Ak A#Aj2"AN   A#Aj2"AN   (!  N  Aj6 (! (!  6A!   ( ("6 ( 6 ( (6 (!@@ #AjAAA( (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA( #AjAAA("AH ( j  6 #AjAAA*  (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA(  (" (N  Aj ! ( 6 6@ #AjAAA*"AH ( j6 #AjAAA("AH ( j"6 ( 6 #AjAAA*"AH ( j6 #AjAAA("AH ( ( j6 6 ("6 6@@ Ak" L ( j-"AqAG A tA"qE #AjA 0E ("6 Ak" ( L @ ( j-Ak #AjA 0"E (" ((H @@@@@@@ Ak 6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   3"AN    ( L ( jAk-AG Ak6 3"AH  ("6 6@@ ( AkN ( jAk-"AqAG A tA3qE #AjA.0"E ("6@@@@@@@@@ Ak  (( J  3"AN (( J  3"AH (6 A#Aj-E  ("6 (( J  3"AN  (( J  A#Aj2"AN   (( J  A#Aj2"AN   (( J  A#Aj2"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AІjA0"E  ("6 (( J  3"AH  AG  (6 A#Aj-E  ("6 (( J  3"AN   (( J  3"AH  ("6 ( AkN  ( jAk-AG  #AjA0E  ("6 (( J  3"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AjA0E  ("6 (( J  3"AN   (( J 3"AH  (6 A#Aj-E  ("6 (( J  3"AN   ("6@  (("H 6 ( ! 6 #AjA 0E@ 6  6 ("6  N ( jAk-AG Ak6@A 3"Au q AN"AvA  AH"E  A  ("6  (("H 6 ( ! 6 #AjA0"E@ 6  6 ("6@@ Ak @  N ( j"Ak-AG Ak"6  N   Ak-AF! 6 6 3"AN   3"AH  ("6 6@ #AjA0"E ("6@@ Ak (( J  3"AN   (( J 3"AH  ("6  ( "L ( j"Ak-AG Ak"6 6  N Ak-AG (( N 3"AH  ( "6 (! !@@ 6@@@@  N ( j-"AqAG A tAĠ q  6  #AjA/"E  ("6@@@@@@ Ak A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (!  N  Aj6 (! (!  6A!   (! ( ("6@ ("Aj" J ( 6 6 #AjAAA*AH #AjAAA("AH ( j"6 ( 6 ("Aj"( ("N  6 6 ("6@@  (("H 6 6 @  L ( jAk-"AqAG A tAqE #AjA%0"E 6 (6@@ Ak 3"AN   #AjAAA)  3"AN   6 ("6 ( ! ("(" L@ 6 @ Ak" L ( j-"AqAG A tAqE #AjA0! (! E 6  ( L Ak"6 6 3"AH  (! 6 (! 6 (" L@ 6 6 @ Ak" L ( j-"AqAG A tAqE #AjA0"E (6@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  6 6A!   (! ( (6 (!@@@ #AjAAA( #AjAAA(AH @ ("Aj" ("N ( j-"AqAG A tA0qE #AjA/@ (!  (!  J  6 #AjAAA*  #AjAAA*"AH  ( j! ( 6 6 ("6 6@@ Ak" L ( j-AG #AjA0E ("6 (( J Ak" ( L ( j-"AqAG A tA2qE (! #AjA0E (  kj6 3"AH A!@ (" ( "L Ak"6 Ak6  H 6A 3" AN! "AH  ("6 6@ #AjA,0E ("6 (( J 3"AH  ("6  ( L @ ( jAk-Ak  #AjA0"E ("6 (( J @@ Ak A#Aj2"AN   A#Aj2"AH  ("6 6@ Ak" ( L @ ( j-Ak #AjA0"E ("6 (( J @@ Ak A#Aj2"AN   A#Aj2"AH  ("6 6@ ( AkN ( jAk-AG #AjA0"E ("6 (( J @@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  ("6 6@  ( L @ ( jAk-Ak  #AjA0E ("6 (( J Ak" ( L ( j-"AqAG A tA2qE (! #AjA0E (  kj6 3"AH  (" ( "L Ak"6 Ak6  J 6 3"AH  ("6 6@  ( L ( jAk-ArAG #AбjA 0"E ("6 (( J @@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  (6A! (6@ #AjA0"E ("6 (( J @@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  A! AH (6A! ("6@  ( L ( jAk-"AqAG A tAqE #AjA*0"E ("6 (( J @@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  A! "AH (6A! ("6@  ( L ( jAk-AG #AjA0"E ("6 (( J @@@@ Ak A#Aj2"AN   A#Aj2"AN   3"AH  A! AH ( 6A!  AA  ("!@ #AjAAA(! (!@@@@@@  ("6@  F ( j-AG Aj"6 6 #AjAAA(E  (! 6  F@ !  ( j-AG Aj"6 6 #AjAAA(E  (!  L  Aj"6  A#Aj2"AH   6 ( 6 ( 6 ( (6 (!@@ #AjAAA( (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA( #AjAAA("AH ( j  6 #AjAAA*  (!@ #AjAAA* #AjAAA*"AH ( j  6 #AjAAA(  (" (N  Aj ! ( 6 6@ #AjAAA*"AH ( j6 #AjAAA("AH ( j"6 ( 6 #AjAAA*"AH ( j6 #AjAAA("AH ( ( j6 6 ("6 6@ Ak" L ( j-"AqAG A tAqE #AjA0"E ("6 (( J @@@@@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (! A#Aj-  (  kj6 A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (6 (A6 ("6  (k!@ #AjA.0"E @ ("6 (( J @@@@@@@ Ak A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (A6 ( j"6 6 #AjA.0" ( j"6 6 #AjA>0! (!@ E ("6 ( J @@@@ Ak 3"AN    ( L  ( jAk-AG  Ak"6 6 A#Aj2"AN   A#Aj2"AH  (A6 (! ("6@ (  ("H 6 ( ! 6 @ #AjA0"E ("6@@ Ak (! #AjAAA+@ (  kj"6  ( L  ( jAk-AG  Ak6 3"AN   3"AH  6 ("6 6@ #AjA0E ("6 (( J 3"AH  ( "6 (! !@@ 6@@@  N @ ( j-Ak  #AjA/"E  ("6@@@ Ak (!  A#Aj2"AN   A#Aj2"AN   6  N  Aj6 (! (!  6A!  A#Aj2"AN   6 AA  (!@@ (" ("  J!@@@ 6  G@ ( j-AF   F  Aj"6  6 Aj6 A#Aj2"AN   6 ( 6 ( 6 (!A!@ #AjAAA*"AH ( j"6 ( 6 #AjAAA("AH ( j6 #AjAAA*"AH ( j6 #AjAAA("AH ( ( j6 6 ("6  (("H 6 6 @@  L ( jAk-"AqAG A tA qE #AjA 0"E@ ( !  ("6@@ Ak  ( "L @ ( jAk-Ak Ak6 3"AN   3"AN   ("6 6@@ Ak" L @ ( j-Ak #AjA0  (! 6   (6 3"AH  (! ( ! 6@@@   Ak" ( L   ( j-"AqAG  A tAΊqE  #AjA0  (  k"k6A! ("6@  ( L ( jAk-"AqAG A tAqE #AjA.0"E ("6@@@ Ak  ( L @ ( jAk-Ak Ak6 3"AN   3"AH  A! Av"A  (6 3"AH  ("6  ( L  ( jAk-"AqAG A tAqE  #AjA0"E  ("6@@ Ak  ( L @ ( jAk-Ak Ak6 3"AN   3"AN   ( k6A! ("6@  ( L ( jAk-"AqAG A tAΊqE #AjA$0E (6A 3" AN! "E    AH! Av!   ("6 6  ( " N   ( jAk-AG  Ak"6 6 3"AH  ( ! (! ( ! 6@ Ak L @ ( jAk-Ak #AjA0E ("6 (( J 3"AH  (  kj"6 6@  ( L ( jAk-"AqAG A tAqE #AjA0"E ("6@@@ Ak 3"AH  ("6  ( "L  ( j"Ak-AG  Ak"6 6  N  Ak-AG  Ak6 3"AN    ( L  ( jAk-AG  Ak6 3"AN   3"AH  6 6 A!  ( (A6 (A6 (A6 ("6@ Aj" (N ( j-"AG AGq #AjA/"E (6A!@@@ Ak A! (6AJ   A! (6AH  A! (A6 (A6 (A6 6 !@@@ 6@ #AjA/"@ (6@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak3  !"#$%&'()*+,-./0124 3"AN 3 6 A#Aj2"AN 2 5 A#Aj2"AN 1 4 A#Aj2"AN 0 3 A#Aj2"AN / 2 A#Aj2"AN . 1 A#Aj2"AN - 0 A#Aj2"AN , / A#Aj2"AN + . A#Aj2"AN * - A#Aj2"AN ) , A#Aj2"AN ( + A#Aj2"AN ' * A#Aj2"AN & ) A#Aj2"AN % ( A#Aj2"AN $ ' A#Aj2"AN # & A#Aj2"AN " % A#Aj2"AN ! $ A#Aj2"AN # A#Aj2"AN  " A#Aj2"AN  ! A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   6 (  (A""AH  6 (!  6 (6@@@@@@@ ((E ("6 (!A! #AjA 0"@@@ (6@@@@ Ak (6AH  3"AN   (6AH  3"AN  (6AH  3"AH ("6 Ak! (! #AjA 0"  AJ!  k" ("j6 E@ a"  AH  !@ AvA   ( j"6 6@ Ak" ( L ( j-AG #AГjA0"E (6@@ Ak (6AH  3"AN (6AH 3"AN ( j"6 (  ( A#AN  (! 6 6@ ( AkN ( jAk-"AG AGq #AjA0E (6 (6AH 3"  AH! AN   (6 a"E AN  !A  ("6 ((E  6@@@ Ak" ( L ( j-AG #AjA0E (6 (6AH 3"  AH! AN  Av!  ("6@@@ ((@ !  6 #AДjA 0"E@ !  (6@@@@ Ak (6AH@ !  3"AN   (6AH@ !  3"AN   (6AH@ !  3"AH (! (! b"  AH  !@ Av"A  (  k"k6 c"  AH  ! Av"A "E  AG  ( k6 d"  AH  ! Av"A "E  AG  ( k"6 (  ( A#"AN  ("6 6@ Ak" ( L ( j-AG #AjA0E (6 (6AH 3"AH"@   ! Av!  (! (! b"  AH  ! Av"A "E @ AG (  k"k6 c"  AH  ! Av"A "E  AG ( k6 d"E  AN  Av! ! E  ("6 ((  b"  AH  ! Av"A "E  AG@ !  ( 6 c"  (! 6  AN  Av!   !  ! AN     ("6@ Ak" ( L ( j-AG #AjA0E (6 (6AH 3"  AH! AN  Av  ! ("6 6 Ak" ( L  ( j-AG  #AjA0E  (6 A#Aj2"AN   A ! !   ( "6 6@@ Aj" (N ( j-"AqAG A tAqE #AjA/"E (6@@@@ Ak (6AH  A#Aj2"AN   (6AH  A#Aj2"AN   (6AH  A#Aj2"AN   (6AH A#Aj2"AN   6 ("6@@ Aj" (N @ ( j-Ak #AjA/E (6 (6AH (! A#Aj, 6 3"AH  (!  6 6@@ Aj" (N ( j-"AG AGq #AjA/"E (6@@ Ak (6AH  3"AN   (6AH 3"AN   6@ ("(@A! ("6@ Aj" (N ( j-"AG AGq #AjA/"E (6@@@@ Ak (6AH  3"AN   (6AH  A#Aj2"AN   (6AH  A#Aj2"AH  A! "Av"A" "E  A"G@   AH  !  (! 6 (E A! (6@ #AjA/"E (6@@@@@ Ak (6AH  A#Aj2"AN   (6AH  A#Aj2"AN   (6AH  A#Aj2"AN   (6AH  A#Aj2"AH  A! @ E@ 6  AH  A! ("6@ Aj" (N ( j-AG #AjA/E (6 (6AH (A6 (A6A A#Aj2" AN! "AN  Av!   6 ("6 6@ Ak" L ( j-"AqAG A tAqE #AЛjA0E (6 A#Aj2"AH  6 !@@ 6 (!@@ Aj" ("N  j-"AqAG A tAqE #AjA/"  (! (! 6   A""AH  6 (!  (6@@@@ Ak A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (!  6A!   (6@ #AjA 0"E (6@@@@@ Ak (6AH  3"AN   (6AH  3"AN   (6AH  3"AN   (6AH  3"AH  A!  I (6@ #AjA0E (6 (6AH A 3" AN!  l ("6@ ( AkN ( jAk-AG #AjA0E (6 (6AH A 3" AN!  k ("6@ Ak" ( L ( j-AG #AjA0E (6 (6AH A 3" AN!   ( ("6 ( 6 (!A!@ #AjA A A&"AH ( j"6 ( 6 #AjA A A$"AH ( j6 #AjA A A&"AH ( j6 #AjA A A$"AH ( ( j6 6 ("6@  (("H 6 6 @ #AjA90E ("6 (( J 3"AH  ("6 6 #AjA0@ (6 3"AH  ("6 6 #AjA0@ (6 3"AH  ("6 6 #AjA(0@ (6 3"AH  6 6 A!   ( ("6 ( 6 ( (6 (!@@@@ #AjAAA$ (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$ #AjAAA$"AN  6 #AjAAA&  (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$  ( ( (A""AN   ( j! ( 6 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@  Ak"N@ !  !@ ( j-"AqAG A tA!qE  #AjA0"E  ("6@@@@@@ Ak (( J  3"AN   (( J  3"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  ("6 (! Ak" ( J  k ("j"6 6@  ( L @ ( jAk-"AqAG A tA!qE  #AjA0"E  ("6@@@@@@@@@@@ Ak  (( J 3"AN (( J 3"AN  A#Aj2"AN  (( J  3"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  ("6 (!  ( J (  kj"6 6@ Ak" ( L ( j-"AqAG A tAqE #AjA0"E ("6@@ Ak (( J  3"AN   A#Aj2"AH  ( 6A!   ( ("6 ( 6 (!@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@ Ak" L ( j-"AqAG A tAqE #AjA'0E ("6 (( J 3"AH  ("6 6@@ #AjA0"E ("6@@@@@ Ak (( J  3"AN   (( J  3"AN   (( J  A#Aj2"AN   (( J  A#Aj2"AN   (( J A#Aj2"AN   ("6 6 #AjA0"E ("6@@ Ak (( J  3"AN   (( J 3"AH  ("6 6@ #AjA0"E ("6@@ Ak (( J  3"AN   (( J A#Aj2"AH  ( "6 (! !@@ 6@@@@ Aj" N ( j-"AqAG A tA沤q  6  #AjA /"E  ("6@@@@@@@ Ak A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (! (  A""AH  6 (! (!  6A!   (! ( ("6@ ( (" A""AH ( 6 6 #AБjAAA&AH #AБjAAA$"AH ( j"6 ( 6 ("Aj"( ("N  6 6 ("6@@  (("H 6 6 @  L ( jAk-"AqAG A tAqE #AjA 0"E 6 (6@@ Ak 3"AN   #AjAAA%  3"AN   6 (6 i"AH ("6 6@ A#Aj-E (6 A#Aj-E 3"AH  ("6@  (("H 6 ( ! 6 @ Ak" L ( j-"AqAG A tAqE #AjA0"E 6 (6@@ Ak 3"AH  i"AN   A#Aj2"AN   6 ("6@  (("H 6 ( ! 6 #AjAAA%@ 6  (6 ((5! ( 6 ("(E@A 6 (.E 3"AH  ( 6A!  A (" (("H  (! 6 ( ! 6 @@  Ak"N ( j-Ak 6 A #AjA0E@ 6 A 6 (6 (  kj"6A (  A#"AH  6 6A 3"Au q AN  ("!@@@ 6@@@@ Aj" ("N ( j-"AqAG A tAԢq  6  #AjA /"E  ("6@@@@@@ Ak A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (! (  A""AH  6 (!  6 6   (F   ( j-AG  Aj"6 6 A#Aj2"AH  ( !@@ #AjAAA$@ (! (!  ("6 (! (" F@ !  @@  j-AF@ Aj"6 6 #AjAAA$E  (! (! 6  F@ !   j-AG  Aj"6 6 A#A“j2"AN   A#Aj2"AH  6  6   A""AN@ 6  6 ( ("6 ( 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 (Aj"(AL@ A6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@  L ( jAk-"AqAG A tA!qE #AjA0"E ("6@@@ Ak  ((H@A!  A#Aדj2"AH A!  k"AvA   ((H@A!  A! #AjAAA' 3"AH  ("6   AH@  (! ( ! l"AH  k" (j"6 6@@@@@ A#Aj-E ("6 (( J ( H@ ( jAk-AF  3"AH  (6 A#Aj-E (6 k"  AH"  ! AvA  (" j"6     (! (! 6@@ Ak" ( L ( j-"AqAG A tAqE #AjA0"E ("6@@@@@ Ak (( J  3"AH ("6 (!@ A#Aj-E ("6 (( J ( H@ ( jAk-AF  3"AN  (  kj6 m"AN  (( J  ( H@ ( jAk-AF  3"AN   (( J  3"AH  l"AvA  (( J  3"AN   ("( J (E 3"AH  (  kj6  AH"E       "AH   #AjAAA' ("Ak" ( L ( j-"AqAG A tAqE (! #AjA0E #AjAAA' (  kj"6 6 (  ( A#"AH 6 6 3"AH  ( "6 !@@ 6@@@  ("N @ ( j-Ak #AjA/"E  ("6@@@ Ak (!  A#AŔj2"AN   A#AƔj2"AN   6 (  A""AH  6 (!  6A!  v@ (" ((H (! #AjAAA'  k" (j6 A#Aj- ( j6 3"AH m!   (A6 ("6@  ( L ( jAk-AG Ak"6 6 (( N (! #AjAAA' (  kj6 3"AH (A6 m!  @ ("Ak" ( L ( j-"AqAG A tAqE (! #AjA0E (  kj"6 6 (  ( A#"AH 6 6A 3"Au q AN!   ("6@@@ Aj" ("N ( j-"AqAG A tAqE #AjA/! (! E ("6  J @@@@@@@@@@@ Ak  A#Aɔj2"AN A#A̔j2"AN A#Aϔj2"AN A#AҔj2"AN  A#AՔj2"AN   A#Aؔj2"AN   A#A۔j2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   6  (  A"" AH"6  6 (A6 ("6@  ("F ( j-A'F@ Aj"6 6 3"AH  (! 6 6  F ( j-AG Aj"6 6 A#Aƕj2"AH  (A6 6 !@@@@ #AǕjAAA$@ (! (!  ("6 (! (" F@ !   j-AF  6   A""AH  6  6 Aj6 A#A˕j2"AH  (A6 (!  6 ( ("6 ( 6@@@ ("Aj" (N ( j-"AqAG A tAqE #AjA/E (!  6 #AǕjAAA&"AH  ( j6 #AǕjAAA$"AH  ( j"6 ( 6 #AǕjAAA&"AH ( j6 #AǕjAAA$"AH ( ( j6 6 ("6 6@  L ( jAk-"AG A'Gq #AjA0E@ ("6  (6 3"AH  (! 6@  ( L @ ( jAk-Ak #AjA0"E ("6@@@ Ak A#Aܕj2"AN   (! (  ( A#"AN@ 6 A#Aޕj2"AN   (  kj6 A#Aߕj2"AN   (  ( A#"AH 6 #AǕjAAA'"AH ( k6 3"AH  ("6 6@@ ( " AkN @ ( jAk-Ak #AjA0! ( ! E ("6  L  ("6 6@ Ak" L ( j-"AqAG A tAqE #AjA0"E ("6@@ Ak (( J  A#Aj2"AN   (! #AǕjAAA'AH (  kj6 3"AH  (!@ ("Ak" ( L ( j-"AqAG A tA qE #AjA 0"E   k ("j"6@@ Ak  A#Aj4! 6 AN   6 (  ( A#"AH  6 6 3"AN    ((G oE (  kj"6  A#Aj4! 6 AH  (6A! ("6@  ( L ( jAk-A rAG Ak"6 6 #AǕjAAA' ( ( L A A#Aj2"Au q AN! "AH  (6A! ("6@ Ak" ( L ( j-"AqAG A tA1qE #AjA0"E ("6 (( J @@@@@@@@@@@@@@@@ Ak  A#Aj2"AN   A#Aj2"AN  A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN    ( L  ( jAk-AG  Ak6 A#Aj2"AN   A#Aj2"AN   #AjAAA%  3"AH  A! "AH  (6A! ("6@ ( AkN ( jAk-"AqAG A tA qE #AjA 0"E ("6 ("( J @@@@@@@ Ak A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   3"AN   ( J  3"AH  A! AH  (6A! ("6@ Ak" ( L ( j-"AqAG A tAqE #AjA0"E ("6 (( J @@@ Ak 3"AN    ( L  ( jAk-AkAqAK  Ak6 3"AH  A! "AH  (6A! ("6@  ( L @ ( jAk-Ak #AjA0"E ("6@@@ Ak  ("(H@ ( J  (! o  (  kj6 3"AN   (( J   ( L  ( jAk-AG  Ak6 3"AH  A! "AH  ( ! 6@ ((E @ (!@@ 6 (! (" G@  j-AF    A""AH  6  6 Aj6 A#Aj2"AN  6 A!   (! (!@ #AݖjAAA' #AǕjAAA% #AǕjAAA' A (  kj6@ #AǕjAAA' #AǕjAAA% ( ( L!   (! ( ("6 ( 6@ #AjAAA&AH #AjAAA$"AH ( j"6 ( 6 #AjAAA&AH #AjAAA$"AH ( ( j6 6 (A6 ("6 ("6@@  (("H 6 6 #AjA 0"E@ 6  6 ("6@@@ Ak #AjAAA%E   (( J  3"AH  ("6@  (("H 6 ( ! 6 #AjA 0"E@ 6  6 ("6@@@@@@ Ak  H@ ( jAk-AF  3"AN   3"AH  (6 A#Aԙj-E  (6 A#Aיj2"AN   3"AN   Ak" L  ( j-AG  #AjA0E  3"AN   Ak L  ( jAk-AG  #AjA0E  3"AN   Ak L ( jAk-AG #AjA0E 3"AH  ("6@  (("H 6 ( ! 6 #AjA0"E@ 6  6 ("6@@@@@@@@@ Ak  N  ( jAk-AG  Ak6   N  ( jAk-AG  Ak6   N  ( jAk-AG  Ak6   N  ( jAk-AG  Ak6  A#Aj-   A#Aj-   ( k!@ #AjA0 ( k6 A#Aj- ( k6  ( k"6 (  ( A#"AH@ ( k6  6 6  #AjAAA%  #AjAAA%  3"AH  (A6 ("6@  (("H 6 ( ! 6 #AjA0"E@ 6  6 ("6 AF@ (! A#Aj-  (  kj6 3"AH  ("6 ("(!@@ (@  H  6 ( ! 6  L  ( jAk-AkAqAK  #A jA0E  6 (6 3"AN    H  6 ( ! 6  L ( jAk-AG Ak"6 6 #AjAAA% (Ak6 3"AH  6 (" (("H  6 6 Ak L ( jAk-AG #A jA0"E 6 ("6 AF@ (! A#Aj-  (  kj6 3"AN   6 ("6@  (("H ( ! 6 @ #AjA0E ("6 6 (  ( A#"AH 6 6 3"AH  ("6 6@ #AjAAA% (6 #AjAAA% 3"AH  ("6 6@  ( "L ( j"Ak-AG Ak"6 6  N @ Ak-Ak Ak6 3"AH  ( ! (! 6 6@  L ( j"Ak-AG Ak"6 6  N Ak-AG Ak6 3"AH  (! 6 6 #AjAAA%AH (6 #AjAAA% (6 ((5! ( 6 (("E@A .E 3"AH  ( 6A!   #AjA0AG L@ (" ( L ( jAk-AG Ak6 #AjAAA%E!  " ("!@ Aj! Aj!@@@@@@@@ #AjAAA$ ("6  ("F ( j-AF@ Aj"6 6 #AjAAA$E  (! 6  F ( j-AF@ Aj"6 6 #AjAAA$E  (! 6  F ( j-AG Aj"6 6 A#Aj2"AN   6 6 A#Aj,@ (6 A#Aj2"AN   6 6 A#Aj,@ (6 A#Aj2"AN   6 6 (!@ (" F@ !   j-AG 6 6 #AjAAA$E  (! (! 6@  F  j-AG 6 6  F  j-AG 6 6 A#Aj2"AN   6   A""AH  6  A#Aj2"AH   6 ( ("6 ( 6 ( (6 (!@@@ #AjAAA$ #AjAAA$ ( ( (A""AN  6 (!@ Aj" ("N  j-"AqAG A tAqE #A jA/@ (!  (! (! 6   A""AH  6 #AjAAA&"AH  ( j! ( 6 6A!@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@@@@@ #A jA+0"E ("6@@@@@@@@@@@@@@@ Ak  (( J  3"AN   (( J  3"AH  (6 A#Aʜj-E  ("6  ((N@ 3"AN   A#A̜j2"AN   (( J A#AϜj2"AN   (( J A#AҜj2"AN   (( J A#AӜj2"AN  (( J 3"AH  (6 #A jA0"E ("6@@@@ Ak (( J  3"AH  (6 A#A֜j-E  ("6 (( J  3"AN    ("(N@ 3"AN   ( J  A#A؜j2"AN   (( J 3"AN  (( J A#Aۜj2"AN  (( J 3"AH  ("6 Ak" ( L ( j-"AqAG A tAqE #A jA0"E ("6@@@ Ak  ((N@ 3"AN   A#Aܜj2"AN   ((N@ 3"AN  A#Aߜj2"AN  (( J 3"AN  (( J  3"AH  (6 A#Aj-E ("6 (( J 3"AH  (6 A#Aj-E ("6  ((N@ 3"AN  A#Aj2"AN  A#Aj2"AN  (( J  A#Aj2"AN    ("(N@ 3"AN   ( J  A#Aj2"AN  (( J  #AjAAA'  3"AN  (( J  A#Aj2  (( J  A#Aj2  (! #AjAAA%  (( (J  (  kj6 3 !A! Au qA AH"!   ("6 ( ! ("(" L@ 6 6 A!@@  L ( jAk-"AqAG A tA qE #A jA#0E ("6@  ( L ( jAk-AG Ak6  #AjAAA' A! 3"AH  6 !   AH  !@ Av"A  ( ! (! (! 6  ("H  6 6 #A jA&0"E  ("6@@@@ Ak (( J  3"AN  3"AN  3"AH  ("6  ( L ( jAk-AG Ak"6 6 3"AH  6    ("6 6@  ( L ( jAk-AG Ak"6 6 A#Aj2"AN   A#Aj-E  (6 A#Aj2"AN   6 (! 6 6@  L ( jAk-AG Ak"6 6@ A#Aj- (Ak6 #AjAAA'E ("6  (Ak6 3"AH  (!  (("H 6 ( ! 6 @  L ( jAk-"AqAG A tAqE #A jA0"E ("6@@@ Ak (( J   ( L  ( jAk-AkAqAK  Ak6 3"AN   A#Aj2"AN   3"AH  6 ("6@ ( AkN ( jAk-"AqAG A tAqE #A jA0E ("6 6 (  ( A#"AH 6 6 3"AH  (6A!@ "Ak! #AjAAA'E @ AJ ("6 (! A#Aj-E@ (  kj6 A#Aj-E  (6 A#Aj2"AH  ( "6 (! !@@ 6@@@@  N ( j-"AqAG A tAq  6  #A jA/"E  ("6@@@@@@@ Ak A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   3"AN   (! (  A""AH  6 (! (!  6A!  A#Aj2"AN   A#Aj2"AN   6  ("!@@ 6 A#Aj,@ (6 A#Aj2"AH  (!  6@ (  (A""AH@ !  6  @ 6 #AjAAA$! (!@@  ("6@  F ( j-AG Aj"6 6 #AjAAA$E@ A#Aj2"AH   (! 6  F@ !  ( j-AG Aj"6 6 #AjAAA$E  (! 6 (  A""AN  6 ( ("6 ( 6@ ( (" (A""AH ( 6 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 ("Aj"( ("H@  6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@  L ( jAk-"AqAG A tA1qE #A jA0"E ("6 (( J @@@ Ak 3"AN   3"AH  ("6  ( L  ( jAk-AG  Ak"6 6 A#Aj-E  3"AN   #AjAAA% 3"AH  ("6 6@ Ak" ( L ( j-"AqAG A tAqE #A jA0"E ("6 (( J @@ Ak 3"AN   #AjAAA% ( ( ( A#"AH 6 3"AH  ("6 6@ Ak" ( L ( j-"AqAG A tAqE #A jA0"E ("6 (( J @@@@ Ak 3"AH  (6 A#Aj-E  ("6 ( H@ ( jAk-AF  (( J  3"AN   ( H@ ( jAk-AF  3"AN   3"AH  ("6 (! A#Aj-E@ (  kj6 A#Aj-E  ("6 (( J  3"AN   3"AH  ("6 Ak" ( L ( j-AkAqAK (! #A jA0E ("6  ((H@ (  kj6  3"AH  ( "6 6@ #A jA/"E @ ("6@@@@@@ Ak A#Aۢj2"AN  A#Aܢj2"AN   A#Aݢj2"AN   A#Aޢj2"AN   (  (A""AH  6 (6 #A jA/" 6A!  A#Aj2"AN  I (6 ("6 6@@ #A jA.0"E @ ("6@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (  ( A#"AH  6 (6 #A jA.0" (6A! (6AH (A6 ("6 (! #AУ jA(0"@ (6@@@@@@@@@@@@ Ak  A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A #Aj2"AN   A #Aj2"AH  (A6  k" (j"6 6@ #A jA0E (6 3"AH  (A6 ("6 6 #A jA0"E ( ( J @@ Ak A#Aj2"AN   A#Aj2"AH  ( j"6 6@ #A jA0E (6 3"AH  (A6 ("6 6 #A jA0E ( ( J A#Aj2"AH  ( j"6 6@ #A jA0E (6 3"AH  (A6 (! (!@ A#Aj-E ( ( J A#Aj2"AN   (  kj"6 6 6 #A jA 0"E ( ( J @@ Ak A#Aj2"AN   A#Aj2"AH  ( j6 (6A #A jA0E  (6@ 3"AH (A6 ("6 6A ( AkN A ( jAk-"AqAG AA tAxqE A #Aк jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6 (6A #Aн jA 0E  (6@ 3"AH (A6 ("6 6A #A jA(0"E A! ( ( J @@@ Ak A#Aj2"AN   A#Aj2"AH  A!  "AH ( j6 (6A #A jA0E  (6@ 3"AH (A6 ("6 6 (!@@ ( " AkN ( jAk-AG #A jA0! ( ! E ( J A!@@ Ak A#Aj2"AH   A#Aj2"AH   (  kj"6 6A! A k L @ ( jAk-Ak #A jA 0"E (6A!@@@@@@@@@@ Ak  A #Aj2"AH A#Aʴj2"AH  A #AҴj2"AH   A#Aܴj2"AH   A #Aj2"AH   A #Aj2"AH   A#Aj2"AH   A#Aj2"AH   A #Aj2"AH   A #Aj2"AN  !  "AH ( j6A! " ("6@ ( A kN @ ( jAk-Ak  #A jA0E  (6 3"AH (A6  ("6  6A Ak" ( L A!@ ( j-Ak A #A jA0E  ( ( J A A#Aj2" AN!  "AH ( j6 " (6A #A jA0E  (6@ 3"AH (A6 ("6 6 (!@@@ #A jA.0"E ( ( J A!@ Ak A#Aj2"AH    (  kj"6  6  6 A#Aj-E@A!  A#Aj2"AH A  A#Aj2"AN  !  "AH ( j6A! " ("6@ ( AkN ( jAk-"AqAG A tAzqE #A jA0E (6 3"AH (A6 ("6 6 (! #A jA0! ( !@ E ( J A A#Aj2" AN   (  kj"6  6  6A! Ak" L @ ( j-Ak  #A jA0E A A#Aj2" AN!  "AH ( j6 (6A #A jA0E  (6@ 3"AH (A6 ("6 6A #A jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6A! ("6@ ( AkN ( jAk-"AG AGq #A jA0E (6 3"AH (! (!A! #A jA 0 (  kj"6  A#AҼj4! 6A  AN! "AH ( j6A! " ("6@ ( AkN ( jAk-"AG AGq #A jA0E (6 3"AH ("6 6A ( AkN @ ( jAk-"AF AF A  A! #A jA0E A A#Aj2" AN!  "AH ( j6A! ("6@ ( A kN ( jAk-"AG AGq #A jA0E (6 3"AH ("6 6A! #A jA0E A A#Aj2" AN! "AH ( j6A! ("6@ ( AkN ( jAk-"AG AGq #A jA0E (6 3"AH (A6 ("6 6A #A jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6 (6A #A jA0E  (6@ 3"AH (A6 ("6 6A! #AjAAA% A A#Aj2" AN!  "AH ( j6 " (6A #A jA0E  (6@ 3"AH (A6 ("6 6 (!@ #AjAAA%@ (  kj"6 6  A#Aj2"AH  (!  6A! #A jA$0E ( ( J A A#Aj2" AN!  "AH ( j6 "(! (!@@ A #Aj-E ( ( J A#Aj2"AH    k" (j"6  6@ ( A kN ( jAk-AG #A jA0E  (6 3"AH  (A6  ( j"6  6A A#Aj-E   (6 3"AH (A6  ("6  6A #A jA 0E A! ( ( J A A#Aj2" AN!  "AH ( j6 " ("6 (!@@ ( A kN ( jAk-AG #A jA 0E (6 3"AH  (A6 ("6 6 ( AkN @ ( jAk-Ak #A jA0E ( ( J A#Aj2"AH   (  kj"6  6A A#Aj-E   (6 3"AH (A6  ("6  6 (!@ #AjAAA%@  (  kj"6  6  A#Aj2"AH  (!  6A! #A jA0E ( ( J A A#Aj2" AN!  "AH ( j6 " ("6 (!@@ ( A kN ( jAk-AG #A jA0E (6 3"AH  (A6  (  kj"6  6A A#Aj-E   (6 3"AH (A6  ("6  6 (!@@@ #AjAAA%E@ A#Aj2"AN    (  k"k"6  6  6 #A jA0E  A#Aj2"AH  (!   ( k"6  6  6A! #A jA0E ( ( J A A#Aj2" AN!  "AH ( j6A! " ("6@ ( A kN ( jAk-AG #A jA0E (6 3"AH (A6 ("6 6 (!@ A#Aj-E ( ( J A A#Aj2" AN   (  kj"6  6  6A A#Aj-E A A#Aj2" AN!  "AH ( j6A! ("6@ ( A kN ( jAk-AG #A jA0E (6 3"AH (A6 ("6 6A A#Aj-E A! ( ( J A A #Aj2" AN!  "AH ( j6 " ("6 (!@@ A #Aj-E (6 3"AH  (A6 ("6 6 Ak" ( L @ ( j-Ak #A jA0E ( ( J A#Aj2"AH   (  kj"6  6A A#Aj-E   (6 3"AH (A6  ("6  6A #A jA 0E A! ( ( J A A#Aj2" AN!  "AH ( j6 " ("6 (!@ #A jA0@ (6 3"AH  (A6  (  kj"6  6A #A jA0E   (6 3"AH (A6  ("6  6 (! #A jA0@A A#Aj2" AN   (  kj"6  6  6A! Ak" ( L ( j-AG #A jA0E ( ( J A A#Aj2" AN!  "AH ( j6 " (6A #A jA0E  (6@ 3"AH (A6 ("6 6 (! #A jA 0@A A#Aj2" AN   (  kj"6  6  6A! #A jA0E ( ( J A A#Aj2" AN!  "AH ( j6 (6A #A jA0E  (6@ 3"AH (A6 ("6 6A Ak" ( L A ( j-AG A #A jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6 " (6A #A jA0E  (6@ 3"AH (A6 ("6 6 (! A#Aj-@A A#Aj2" AN    k" (j"6  6  6A!@@@ #A jA 0 A#Aj2"AH    ( j"6  6  6A! #A jA,0E ( ( J A#Aj2"AN  !  "AH ( j6A! ("6@ ( AkN ( jAk-AG #A jA0E (6 3"AH (A6 ("6 6A #A jA 0E A! ( ( J A A#Aj2" AN!  "AH ( j6A! ("6@ ( AkN ( jAk-AG #A jA0E (6 3"AH (A6 ("6 6A #A jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6A! ("6@ ( AkN ( jAk-AG #A jA0E (6 3"AH (A6 ("6 6A #A jA0E A! ( ( J A A#Aj2" AN!  "AH ( j6 " ("6 (!@ #A jA0@ (6 A#Aj2"AH   (  kj"6A! ((E  6 #A jA0E  (6A 3" AN! "AH ( j6A! " ("6@ ( AkN @ ( jAk-Ak #AЫ jA0E  (6A 3" AN! "AH ( 6A!  q@ ( ( (A""AH 6 ("6 6 #A jA0E (6 3"AH ( 6A!  AA  #AjAAA%E  (! ( (6 (!@@@ #AjAAA$ #AjAAA$AH (!@ ("Aj" ("N  j-"AqAG A tA0qE #A jA/@ (!  (! (! 6   A""AN  6 #AjAAA&  #AjAAA&"AH  ( j! ( 6 6 ("6 6@@ Ak" L ( j-AG #A jA0E ("6 (( J Ak" ( L ( j-"AqAG A tA2qE (! #A jA0E (  kj6 3"AH A ( ( ( A#"AH  6 6A (  ( A#"AH  6 6A 3"Au q AN "AH  ("6 6@ #A jA,0E ("6 (( J 3"AH  ("6 Ak" ( L @ ( j-Ak  #A jA0"E ("6 (( J @@ Ak A#Aj2"AN   A#Aj2"AH  ("6 6@ ( AkN @ ( jAk-Ak #A jA0"E ("6 (( J @@ Ak A#Aj2"AN   A#Aj2"AH  ("6 6@ ( AkN ( jAk-AG #A jA0"E ("6 (( J @@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  ("6 6@ Ak" ( L @ ( j-Ak  #A jA0E ("6 (( J Ak" ( L ( j-"AqAG A tA2qE (! #A jA0E (  kj6 3"AH  ( ( ( A#"AH 6 6 (  ( A#"AH 6 6 3"AH  ("6 6@ Ak" ( L ( j-"AG AGq #A jA 0"E ("6 (( J @@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  (6A! (6@ #A jA0"E ("6 (( J @@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  A! AH (6A! ("6@  ( L ( jAk-"AqAG A tAqE #A jA*0"E ("6 (( J @@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  A! "AH (6A! ("6@  ( L ( jAk-AG #A jA0"E ("6 (( J @@@@ Ak A#Aj2"AN   A#Aj2"AN   3"AH  A! AH ( 6A!   (A6 (! #AjAAA&"AN@@ ( j6 (Aj" (Aj6 #AjAAA&"AN 6@ ("(AH A6 ("6 ("6 6A!@ Ak L @ ( jAk-Ak #A jA0E (6 3"AH  (Aj" (Ak6A! ("6 ((AH@A 6@ Ak" ( L ( j-"AG AGq #A jA0E (6 3"AH  (Aj" (Ak6 ( "6A! ((AH (! 6@@ Aj" N @ ( j-Ak #A jA /"E (6@@@@@@@@ Ak 3"AH A  3"AH A ! ( 6  (A6 A#Aj2"AN   (A6 A#Aj2"AH  (Aj" (Ak6  (A6 (Aj" (Ak6 (! #AjAAA$! 6 E@ A#Aj2"AN   3"AN   (A6 (Aj" (Ak6 (! #AjAAA$! 6 E@ A#Aj2"AN   3"AH  ((AH  ("6 (6 {"E  AH  6 ((AH @ |"AvA  AN    AH   6 |"AH  6 ((AH 6 (6@ {"AvA   A  AN 6A!  { ("6@  ( L @ ( jAk-Ak #A jA0E (6 3"AH (Aj" (Ak6A!   ("6@ Aj" (N ( j-AG #A jA/"E (6A!@@@@ Ak 3"AH  (A6 Aj  A#Aj2"AH  Aj  3"AH  (A6 Aj  A#Aj2"AH  (A6 Aj (Aj" (Ak6A!   #AjAAA$E - #AjAAA&  A#Aj,AG  ("6@@ #A jA/"E (6@@@@@@@@@@ Ak  3"AN A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  6 ( ("6 ( 6 ( (6 (!@ #AjAAA&"AH ( j"6 ( 6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@ #A jA0"E ("6@@ Ak (( J  3"AN   (( J 3"AH  ("6 6@ #A jA0"E ("6@@@@@@ Ak (( J  3"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  ("6 6@ ( AkN ( jAk-"AqAG A tAqE #A jA 0"E ("6@@ Ak (( J  3"AN   (( J 3"AH  ( 6A!   ("6@@ #A jA/"E @ ("6@@@@@@@@ Ak A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (  (A""AH  6 (6 #A jA/" !@@@ 6 #AjAAA$! (!@@@  ("6@  F ( j-AG Aj"6 6 #AjAAA$E  (! 6  F@ !  ( j-AG Aj"6 6 #AjAAA$E  (! 6 (  A""AN  6 ( ("6 ( 6 ( (6 (!@@@@ #AjAAA$ (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$ #AjAAA$"AN  6 #AjAAA&  (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$  ( ( (A""AN   ( j! ( 6 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@ Ak" L ( j-"AqAG A tAqE #A jA%0E ("6 Ak" ( L @ ( j-Ak #A jA0"E (( (J @@ Ak 3"AN   A#Aj2"AH  ("6 6 #A jA30"E@ (!  ("6@@@@@@@@@ Ak  ("( J 3"AN ("( J 3"AH (6 A#Aj-E ("6 (( J 3"AN ("( J  A#Aj2"AN ("( J  A#Aj2"AN ("( J  A#Aj2"AN  ("( J  3"AN   ("( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #A jA0"E  ("6 (( J  3"AH  AG  (6 A#Aj-E  ("6 (( J  3"AN   ("( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #A jA0E  ("6 (( J  3"AN   ("( J  3"AH  (6 A#Aj-E  ("6 (( J  3"AH  (6 A#Aj-E  ("6 (( J  3"AH   A#Aj2"AN   A#Aj2"AN   ("6  ("H 6 ( ! 6 #A jA0@ (6 3"AH  6 ("6 6@ #AjAAA% ("6 (( J 3"AH  ("6  ( L ( jAk-AG Ak"6 6 (( N 3"AH  (! (  ("6  ! 6@  ( L ( jAk-AG Ak"6 6@ #AjAAA% (( (J 3"AH  (! ( "6 !@@ 6@@@  N @ ( j-Ak  #A jA/"E  ("6@@@ Ak (!  A#Aj2"AN   A#Aj2"AN   6 (  A""AH  6 (! (!  6A!   ( ("6@  ("F (" j-AG 6AN  ( ( (A"" AH  6 @ #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@ Ak L ( jAk-"AqAG A tAqE #A jA 0"E (6@@@@@@@@ Ak A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  ("6@  (("H 6 ( ! 6 #A jA0E@ 6  6 ("6 (( J 3"AH  (6 "AH (6@@ (" (("N@ 6 ( ! 6 #A jA>0  6 (6 "AH  ("6 6@ Ak" ( L ( j-AG #A jA0E (6 A#Aj2"AH  ( 6A!  6 (6 3"AN   ("6@ Ak" ( L ( j-"AG AGq #AЯ jA0"E (6@@@ Ak A#Aj2"AN   A#Aj2"AH  A!   (6 ("6 6@@ #A jA0"E ("6A!@@ Ak 3"AN   (! A#Aj- (  k"k6 A#Aj- ( k6 3"AH  (6@ ("6 ( k!@ ( AkN ( jAk-"AqAG A tAqE #A jA0E (6 ( k"6 6 ( AkN ( jAk-"AqAG A tAqE #A jA0"E ("6@@ Ak (!@ A#Aj- (  k"k6 A#Aj- ( k6 A#Aj- ( k6 A#Aj-E  3"AN   A #A†j-E 3"AH  ( k"6 6 #A jA0@ (6 3"  AH"! AN   ( 6A!   (! ( ("6@ ( (" A""AH ( 6 6 #AjAAA&AH #AjAAA$"AH ( j"6 ( 6 ("Aj"( ("N  6 6 ("6@@  (("H 6 6 @  L ( jAk-"AqAG A tAqE #A jA0"E 6 ("6@@@ Ak 3"AN   (! #AjAAA%@ (  kj"6  ( L  ( jAk-AG  Ak6 #AjAAA'  3"AN   A#Aj2"AN   6 ("6@  (("H 6 ( ! 6 @ Ak" L ( j-AG #A jA0E 6 (6 ("6 (  A#"AH  6 6 3"AN   6 ("6 ( !@  (("H 6 6 @@ Ak" L ( j-"AqAG A tAq  6  #A jA 0E@ 6  6 (6 3"AH  ( ! 6A!   (A6 ("6@@  (F ( j-AG Aj"6 6 A#Aj2"AH  (A6 6 !@@@@ #AjAAA$@ (! (!  ("6 (! (" F@ !   j-AF  6   A""AH  6  6 Aj6 A#Aj2"AH  (A6 (!  6 ( ("6 ( 6 (!@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@  L ( jAk-AG #A jA0"E (6@@@ Ak A#Aj2"AN   A#Aj2"AN   3"AH  ("6 6@ Ak" ( L @ ( j-Ak #A jA0"E ("6@@ Ak (( J  A#Aj2"AN   (! #AjAAA'AH (  kj6 3"AH  (!@ ("Ak" ( L ( j-"AqAG A tA qE #A jA 0"E   k ("j"6@@ Ak  A#Aj4! 6 AN   6 (  ( A#"AH  6 6 3"AN    ((G A #AjAAA' A #AjAAA%  #AjAAA'E E (  kj"6  A#Aj4! 6 AH  ("6 6@  ( L ( jAk-A rAG Ak"6 6 #AjAAA'"AH ( k6 A#Aj2"AH  ("6 6@ ( AkN ( jAk-"AqAG A tA1qE #A jA0"E ("6 (( J @@@@@@@@@@@@@ Ak  A#AÏj2"AN A#AǏj2"AN A#Aˏj2"AN A#AϏj2"AN A#Aӏj2"AN  A#A֏j2"AN   A#A׏j2"AN   A#Aڏj2"AN   A#Aݏj2"AN   A#Aߏj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (6A! ("6@ ( AkN ( jAk-"AqAG A tA qE #A jA0"E ("6 (( J @@@@ Ak A#AӐj2"AN   A#AՐj2"AN   3"AH  A! "AH (6A! ("6@ Ak" ( L ( j-"AqAG A tAqE #A jA0"E ("6 (( J @@@ Ak 3"AN    ( L  ( jAk-AkAqAK  Ak6 3"AH  A! "AH (6A! " ("6@  ( L ( jAk-AG Ak"6 6  ("(L@ ( N  (!@ #AjAAA' #AjAAA% #AjAAA'E   (  kj6 A 3" AN! "AH (6 W"AH ( "6@ ((E @ (!@@ 6 (! (" G@  j-AF    A""AH  6  6 Aj6 A#Aj2"AN  6A!   ("!@@@ 6@@@ Aj" ("N @ ( j-Ak #A jA/"E  ("6@@@ Ak (!  A#Aj2"AN   A#Aj2"AN   6 (  A""AH  6 (!  6 ( ("6 ( 6 ( (6 (!@@@@ #AjAAA$ (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$ #AjAAA$"AN  6 #AjAAA&  (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$  ( ( (A""AN   ( j! ( 6 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@@ Ak L ( jAk-"AqAG A tA2qE #A jA-0"E ("6@@@@@@@@@ Ak  (( J  3"AN (( J  A#Aԑj2"AN  (( J  A#Aבj2"AN  (( J  A#Aؑj2"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #A jA0"E  ("6 (( J  3"AH  AG  (6 A#Aܑj-E  ("6 (( J  3"AN   (( J  3"AH  ("6 ( AkN @ ( jAk-Ak #A jA0E  ("6 (( J  3"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #A jA0E  ("6 (( J  3"AN   (( J  3"AH  (6 A#Aޑj-E  ("6 (( J  3"AN   (( J  ( L ( jAk-AG Ak6 A#Aj2"AN   ("6@ ((" L@ 6 ( ! 6 #A jA0  6 (! 6 6 #A jA0E  ("6 (( J  3"AN   (6 3"AH  6 ("6 6  ( "L ( j"Ak-AG Ak"6 6  N Ak-AG (( N 3"AH  ("6 6@ #A jA0"E ("6@@ Ak (( J  3"AH  ("6  ( "L @@ ( j"Ak"-AG Ak"6 6  L Ak-AF  6 -AG  Ak"6 6  L  Ak-AG  6 (( J  3"AN   A#Aj2"AH  ( "6 (! !@@ 6@@@  Aj"J@ ( j-AF  6  #A jA/"E  ("6@@@ Ak A#Aj2"AN   A#Aj2"AN   (! (  A""AH  6 (! (!  6A!   ("!@ #AjAAA$! (!@@@@@@  ("6@  F ( j-AG Aj"6 6 #AjAAA$E  (! 6  F@ !  ( j-AG Aj"6 6 #AjAAA$E  (! 6 (  A""AH  6  A#Aj2"AH   6 ( ("6 ( 6 ( (6 (!@@@@ #AjAAA$ (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$ #AjAAA$"AN  6 #AjAAA&  (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$  ( ( (A""AN   ( j! ( 6 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@ Ak" L ( j-"AqAG A tAqE #A jA0"E ("6 (( J @@@@@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   (! A#Aj-  (  kj6 A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (6 (A6 ("6  (k!@ #A jA.0"E @ ("6 (( J @@@@@@@ Ak A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  (A6 ( j"6 6 #A jA.0" ( j"6 6@ #A jA>0"E ("6 (( J @@@@ Ak 3"AN   A#Aj-E  (6 A#Aj2"AN   A#Aj2"AH  (A6 ("6@ ("(  ("H 6 ( ! 6 @ #A jA0"E ("6@@ Ak (! #AjAAA'@ (  kj"6  ( L  ( jAk-AG  Ak6 3"AN   3"AH  6 ("6 6@ #A jA0E ("6 (( J 3"AH  ( "6 (! !@@ 6@@@  N @ ( j-Ak  #AО jA/"E  ("6@@@ Ak (!  A#Aߠj2"AN   A#Aj2"AN   6 (  A""AH  6 (! (!  6A!  A#Aj2"AN   6  (!@@@ ("6 A#Aj,E@@ 6 (  (A""AH  6 6 A#Aj,E (6 6 A#Aj2"AN   6 ( ("6 ( 6 (!A!@ #AjAAA&"AH ( j"6 ( 6 #AjAAA$"AH ( j6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6  (("H 6 6 @@ #A jA 0"E ("6@@ Ak (! A#Aj-E@ (  kj6 A#Aj-E  3"AN   3"AN   ("6 6@@ ( AkN @ ( jAk-Ak #AР jA0  (! 6   (6 3"AH  (! ( ! 6 #A jA0@ (6 3"AH  (6 #A jA0"E  ("6@@ Ak (! A#Aj-E@ (  kj6 A#Aj-E  3"AN   3"AN   (  k"k6A! (6@ #A jA.0"E ("6@@@ Ak (! A#Aעj-E@ (  kj6 A#A٢j-E  3"AN   3"AH  A! @@ "Av"A  ( k6 (6A #AЭ jA$0E  (6A 3" AN "E    AH! Av!   ("6 6 A#Aj-E@ ("6   (6 3"AH  (! ( ! 6@ ( AkN @ ( jAk-Ak  #A jA0E ("6 (( J 3"AH  (  kj"6 6@ #Aг jA0"E (6@@@ Ak 3"AH  (6 A#Aӥj-E  (6 A#Aեj-E  3"AN   A#Aץj-E  3"AN   3"AH  6 6 A!  H ("!@@ 6@ #A jA/" @@ 6 (  (A""AH 6 6 #A jA/"E   !@ 6@ #AЦjAAA$ (6 A#Aj,E (6 #AЦjAAA$ A#Aj2"AN   6 (  (A""AN !@ 6@ #AЦjAAA$ (6 A#Aj,E (6 #AЦjAAA$ A#Aj2"AN   6 (  (A""AN !@ 6 6 A#Aj,@ (6 A#Aj2"AN   6 (  (A""AN 6 (A6 (! #AjAAA&AN@ (A6 6 ( (6 (!@ #AjAAA&"AH ( j"6 ( 6 ((AJ #AjAAA$"AH ( ( j6 !@@ 6 (!@  ("F  j-AG Aj"6 AL@ #AjAAA$"AH  ( j"6 ("( kAH   6    A""AN  6 ("6 6@ Ak L ( jAk-"AqAG A tAqE #A jA0"E (6@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak[  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ A#Aj2"AN Z \ A#Aj2"AN Y [ A#Aj2"AN X Z A#Aj2"AN W Y A#Aj2"AN V X A#Aj2"AN U W ((E T A#Aj2"AN T V A#Aj2"AN S U A#Aj2"AN R T A#Aj2"AN Q S A#Aj2"AN P R A#Açj2"AN O Q A#Aǧj2"AN N P A#A˧j2"AN M O A#Aϧj2"AN L N A#Aӧj2"AN K M A#Aקj2"AN J L A#Aۧj2"AN I K A#Aߧj2"AN H J A#Aj2"AN G I A#Aj2"AN F H A#Aj2"AN E G A#Aj2"AN D F A#Aj2"AN C E A#Aj2"AN B D A#Aj2"AN A C A#Aj2"AN @ B A#Aj2"AN ? A A#Aj2"AN > @ A#Aj2"AN = ? ((E < A#Aj2"AN < > A#Aj2"AN ; = A#Aj2"AN : < A#Aj2"AN 9 ; A#Aj2"AN 8 : A#Aj2"AN 7 9 A#Aj2"AN 6 8 A#Aj2"AN 5 7 A#Aj2"AN 4 6 A#Aèj2"AN 3 5 A#AǨj2"AN 2 4 A#A˨j2"AN 1 3 A#AϨj2"AN 0 2 A#Aըj2"AN / 1 A#Aۨj2"AN . 0 A#Aj2"AN - / A#Aj2"AN , . A#Aj2"AN + - A#Aj2"AN * , A#Aj2"AN ) + A#Aj2"AN ( * ((E ' A#Aj2"AN ' ) A#Aj2"AN & ( A#Aj2"AN % ' ((E $ A#Aj2"AN $ & A#Aj2"AN # % ((E " A#Aj2"AN " $ A#Aj2"AN ! # A#Aj2"AN " A#Aj2"AN  ! A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   ((E  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aĩj2"AN   A#Aɩj2"AN   A#Aϩj2"AN   A#Aԩj2"AN   ((E  A#Aةj2"AN   A#Aܩj2"AN   A#Aߩj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN  A#Aj2"AN  A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   ((E A#Aj2"AH  ("6 6@@ #A jA0"E ("6 ("( J @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aïj2"AN   A#Aįj2"AN   A#Aǯj2"AH   A#Aʯj2"AH   A#Aͯj2"AH   A#Aѯj2"AH   A#Aӯj2"AH   A#A֯j2"AH   A#Aׯj2"AH   A#Aۯj2"AH   A#Aޯj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH   A#Aj2"AH  ~ A#Aj2"AH  } A#Aj2"AH ~ | A#Aj2"AH } { A#Aj2"AH | z A#Aj2"AH { y A#Aj2"AH z x A#Aj2"AH y w A#Aj2"AH x v A#Aj2"AH w u A#Aj2"AH v t A#Aj2"AH u s A#Aj2"AH t r A#Aj2"AH s q A#Aj2"AH r p A#Aj2"AH q o A#Aj2"AH p n A#Aj2"AH o m A#Aðj2"AH n l A#AŰj2"AH m k A#Aǰj2"AH l j A#A˰j2"AH k i A#Aϰj2"AH j h A#AӰj2"AH i g A#Aװj2"AH h f A#A۰j2"AH g e A#A߰j2"AH f d A#Aj2"AH e c A#Aj2"AH d b A#Aj2"AH c a A#Aj2"AH b ` A#Aj2"AH a _ A#Aj2"AH ` ^ A#Aj2"AH _ ] A#Aj2"AH ^ \ A#Aj2"AH ] [ A#Aj2"AH \ Z A#Aj2"AH [ Y A#Aj2"AH Z X A#Aj2"AH Y W A#Aj2"AH X V A#Aj2"AH W U A#Aj2"AH V T A#Aj2"AH U S A#Aj2"AH T R A#Aj2"AH S Q A#Aj2"AH R P A#Aj2"AH Q O A#Aj2"AH P N A#Aj2"AH O M A#Aj2"AH N L A#Aj2"AH M K A#Aj2"AH L J A#Aj2"AH K I A#Aj2"AH J H A#Aj2"AH I G A#Aj2"AH H F A#Aj2"AH G E A#Aj2"AH F D A#A±j2"AH E C A#Aűj2"AH D B A#Aȱj2"AH C A A#Aʱj2"AH B @ A#Aͱj2"AH A ? A#Aѱj2"AH @ > A#Aӱj2"AH ? = A#AԱj2"AH > < A#Aֱj2"AH = ; A#A۱j2"AH < : A#Aj2"AH ; 9 A#Aj2"AH : 8 A#Aj2"AH 9 7 A#Aj2"AH 8 6 A#Aj2"AH 7 5 A#Aj2"AH 6 4 A#Aj2"AH 5 3 A#Aj2"AH 4 2 A#Aj2"AH 3 1 A#Aj2"AH 2 0 A#Aj2"AH 1 / A#Aj2"AH 0 . A#Aj2"AH / - (E + A#Aj2"AH . , (E * A#Aj2"AH - + (E ) A#Aj2"AH , * (E ( A#Aj2"AH + ) (E ' A#Aj2"AH * ( (E & A#Aj2"AH ) ' (E % A#Aj2"AH ( & (E $ A#Aj2"AH ' % (E # A#Aj2"AH & $ (E " A#Aj2"AH % # (E ! A#Aj2"! AH $ " (E A#Aj2"! AH # ! (E  A#Aj2"! AH " (E  A#Aj2"! AH !  (E  A#Aj2"! AH  (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#AIJj2"! AH   (E  A#AȲj2"! AH   (E  A#A̲j2"! AH   (E  A#Aвj2"! AH   (E  A#AӲj2"! AH   (E  A#Aֲj2"! AH   (E  A#Aٲj2"! AH   (E  A#Aܲj2"! AH   (E  A#A߲j2"! AH   (E  A#Aj2"! AH   (E A#Aj2"! AH   (E A#Aj2"! AH  (E A#Aj2"! AH  (E A#Aj2"! AH (E A#Aj2"! AH (E  A#Aj2"! AH (E  A#Aj2"! AH  (E  A#Aj2"! AH  (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E  A#Aj2"! AH   (E A#Aj2"! AH   ("6 6  ( L ( jAk-"AqAG A tAqE #AjA0E ("6 (( J AA2"! AH  ( 6A!  (6@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN  A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN A#Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  6    ( ("6 ( 6 ( (6 (!@@@@ #AjAAA$ (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$ #AjAAA$"AN  6 #AjAAA&  (! #AjAAA&E@ #AjAAA&"AN  6 #AjAAA$  ( ( (A""AN   ( j! ( 6 6@ #AjAAA&"AH ( j6 #AjAAA$"AH ( j"6 ( 6 #AjAAA&"AH ( j6 #AjAAA$"AH ( ( j6 6 ("6 6@@ Ak" L ( j-"AqAG A tA"qE #AjA 0E ("6 Ak" ( L @ ( j-Ak #AБjA 0"E (" ((H @@@@@@@ Ak 6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   6 A#Aj2"AN   3"AN    ( L ( jAk-AG Ak6 3"AH  ("6 6@@ ( AkN ( jAk-"AqAG A tA3qE #AjA.0"E ("6@@@@@@@@@ Ak  (( J  3"AN (( J  3"AH (6 A#Aӈj-E  ("6 (( J  3"AN  (( J  A#AՈj2"AN   (( J  A#A؈j2"AN   (( J  A#Aوj2"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AКjA0"E  ("6 (( J  3"AH  AG  (6 A#A݈j-E  ("6 (( J  3"AN   (( J  3"AH  ("6 ( AkN  ( jAk-AG  #AjA0E  ("6 (( J  3"AN   (( J  3"AH  ("6 Ak" ( L  ( j-"AqAG A tAqE  #AjA0E  ("6 (( J  3"AN   (( J 3"AH  (6 A#A߈j-E  ("6 (( J  3"AN   ("6@  (("H 6 ( ! 6 #AjA 0E@ 6  6 ("6  N ( jAk-AG Ak6@A 3"Au q AN"AvA  AH"E  A  ("6  (("H 6 ( ! 6 #AjA0"E@ 6  6 ("6@@ Ak @  N ( j"Ak-AG Ak"6  N   Ak-AF! 6 6 3"AN   3"AH  ("6 6@ #AjA0"E ("6@@ Ak (( J  3"AN   (( J 3"AH  ("6  ( "L ( j"Ak-AG Ak"6 6  N Ak-AG (( N 3"AH  ( "6 (! !@@ 6@@@@ Aj" N ( j-"AqAG A tAĠ q  6  #AjA/"E  ("6@@@@@@ Ak A#AԎj2"AN  A#AՎj2"AN   A#A֎j2"AN   A#A׎j2"AN   A#A؎j2"AN   (! (  A""AH  6 (! (!  6A!   (! ( ("6@ ( (" A""AH ( 6 6 #AjAAA&AH #AjAAA$"AH ( j"6 ( 6 ("Aj"( ("N  6 6 ("6@@  (("H 6 6 @  L ( jAk-"AqAG A tAqE #AjA%0"E 6 (6@@ Ak 3"AN   #AjAAA%  3"AN   6 ("6 ( ! ("(" L@ 6 @ Ak" L ( j-"AqAG A tAqE #AjA0E ("6 6 (  ( A#"AH 6 6 3"AH  6 (! (! 6 (" L@ 6 6 @ Ak" L ( j-"AqAG A tAqE #AjA0"E (6@@@ Ak 3"AN   A#Aj2"AN   A#Aj2"AH  6 6A!  ) (A6 (!@ "AH 6A! (6AH ("6@ A#Aj,E #AjA /E A#Aj,E (6 3"AH  "AH  6 (A6 ("6@ Aj" (N ( j-"AqAG A tAqE #AjA/E #AjA /E A#Aj,E (6 3"AH  (A6 "AH  6@ (6AH (A6 (6 ("6 6 #AjA0@ (6 A#Aj2"AH  (A6 ( 6@@@ "Av"A  A!   AH  ! AF E AH  6 (A6@ (6AH (6 ("6 6 A #Aʔj-E (6 A#AӔj2"AH  (A6 ( 6 "AH  6A! (A6@ (6AH (6 ("6 6@@@ A #A֔j- (6 A#Aj- (6 A #Aj- (6 A#Aj- (6 A #Aj- (6 A #Aj- (6 A#Aj- (6 A #Aj- (6 A #Aj- (6 A #Aȕj- (6 A#Aѕj- (6@ A #Aj-E (! (! #AjA0 (  kj6  (6 A#Aj- (6 A #Aj-E  (6 A#Aj2"AN   ("6 6 #AjA 0E  (6 3"AH  (A6 ( "6@@@@@ "Av"A  6  A!   AH  ! AF E AH  A! "AH 6A! (A6 (A6@ (6AH (6 ("6 6@ A#Aj-@ (6 3"AN   ("6 6@@ A #Aj-E@ (6 A#Aj-E  (! (! #AjA0  k  (6 A#Aj-E  (! (! #AjA0E  A#Aj-E   k !  (j"6 6 A#Aj2"AN   ("6 6@ A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6@@ A #Aj-E (! (! A#Aj-  k  (6 A#AĘj-  (6 A#Aj-  (6 A #Aj-  (6 (6AN@ A #Aj-  (6 A #Aj-  (6 A #Aj-  (6 A #Aj-  (6 A#Aj-E  (! (! #AjA0   k !  (j6  (6 A #Aj- ("6 6@@ A #Aj- (6 A #AÙj- (6 A #Aϙj- (6 A #Aۙj- (6 A #Aj- (6 A #Aj- (6 A#Aj-E  (! (! #AjA0  (  kj6 (6 3"AN   ("6 6 A#Aj-E  (6 A#Aj2"AH   (6 A#Aj2"AH  (6 (A6 (A6 (6 A #Aj-@ (6 A#Aj2"AH  ( "6@@@@@ "Av"A  6  A!   AH  ! AF E AH  A! "AH 6 (A6 (6 ("6 6@@@ A#Aj-E (! (! #AjA0 (  kj"6 6 A#Aj2"AN   ("6 6 A#Aj-@ (6 A#Aj2"AN   ("6 6 A#Aj-@ (6 A#Aj2"AN   ("6 6A A #Aj-E  (6 3"AH  A! (A6 ( 6  "AH 6A!@ (6AH (A6 ("6 ("6 6 Ak L ( jAk-AG #AjA0E (6 3"AH A! (A6 ( 6 "AH 6A! (A6@ (Aj"(E (!@ A6@ (6AH ("6 ("6 6 @@@@ Ak L @ ( jAk-Ak  #AjA0  (! 6 6@@ A #A֛j- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6@ A #Aj-E ("!@ ( ("AkN ( jAk-"AqAG A tAqE #AjA 0  (!  k j6  (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A#AȜj- (6 A#A˜j- (6 A#AΜj- (6 A#Aќj- (6 A#AԜj- (6 A #Aלj- (6 A #Aj- (6 A #Aj- (6@ A#Aj-E (! (! #AjA0 (  kj6  (6 A#Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A#Aɝj- (6 A#Aϝj-E  (6 3"AN   ("6 6@@@ A #A՝j-E (! (! A#Aޝj- (  kj6  (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A#Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #Aj- (6 A #AǞj- (6 A #AӞj- (6 A #Aܞj- (6 A #Aj- (6 A #Aj- (6 A #Aj-E  (6 A#Aj2"AN   ("6 6 A#Aj-E@ (6 A#Aj-E  (! (! A#Aj-! (" E    kj"6 6 3"AH   (6 3"AH  (A6 ( "6 6@ ( AkN ( jAk-"AG AGq #AjA0E (6 3"AH  (A6 ( 6@@@ "Av"A  A!   AH  ! AF E AH  6 (Aj"( A! "AH 6A!  @ (6AH ("6 ("6 6@@@ Ak L ( jAk-"AG AGq #AjA0  (! 6 6@ A#Aj-E (! (! #AjA0E (  kj"6 6 3"AN   ("6 6@ A #Aj-E@ (6 A #AÐj-E  (6 A#Aϐj2"AN   ("6 6 A #AՐj-@ (6 A#Aj2"AN   ("6 6 A #Aj-@ (6 A#Aj2"AN   ("6 6 A #Aj-@ (6 A#Aj2"AN   ("6@@@ ((E 6 A #Aj-! (! E (! A#Aj-! (! E  ! 6 6 A #Aj-E@ (6 A#Aj-E  (6 A#Aj2"AN     kj"6 6 A#Aj2"AH  (6  ("6 6@ A#Aj-E #AjA0E A#Aj-E #AjA0E (6 3"AN   ("6 6 A #Aj-@ (6 A#Aʑj2"AN   ("6 6@ A#A͑j-E #AjA0E (6 3"AN   ("6 6@ A#AБj-E ("!@@ ( ("AkN ( jAk-"AqAG A tAqE #AjA0  (!  k j6 #AjA0E  A#Aӑj-E (6 A#A֑j2"AN   ("6 6 #AjA0@ (6 3"AN   ("6 6@ A#Aّj-E (! (! #AjA0 (  kj"6 6 3"AN   ("6 6@ A#Aߑj-E (! (! A#Aj- (  kj"6 6 A#Aj2"AN   ("6 6 A#Aj-@ (6 3"AN   ("6 6 A#Aj-E  ( (k! #AjA0E@ ( k6 A#Aj-E  ( k"6 6 3"AN  Au q (6 3"AH  ( 6A!   (! A#"Aؓj, 6 6@@ A Aޓj,@ (6 A#Aj2"AH   6 A#"Aj, 6 6 A Aj,@ (6 A#Aj2"AN   6 A#"Aj, 6 6 A Aj,@ (6 A#Aj2"AN   6 A#"Aj, 6 6 A Aj,E@A (6A A#Aj2" AN!  A 2 (!@ #AjAAA&"ANA!@ ( j"6 Ak! #AjAAA&"AN   AL6 AJ@A 6 ("6 6 (A6 (! (!@@@ E ( ("AkN ( jAk-AG #AjA0E   (  k"k6@ E #AjA 0E   ( k"6@ Ak" ( L ( j-"AqAG A tAqE #AjA0E   ( k6 A#Aj-@   ( k"6@ ( AkN @ ( jAk-Ak #AjA0E @  (" ( ("AkN   ( jAk-AG  #AjA0  (  k"k6@ E ( ("AkN ( jAk-AG #AjA0  ( k6@ E (Ak" ( L ( j-AG #AjA0E   ( k6@ E ( ("AkN ( jAk-AG #AjA0  ( k6  ( k6 E ( ("AkN ( jAk-AG #AjA0E   ( k6@ E ( ("AkN ( jAk-AG #AjA0E (6 3"AH  ("6 (!@@ E ( ("AkN ( jAk-AG #AjA0  (  k"k6A!@ E #AjA 0E !  ( k6  ( k6  (  kj6 (A6  ( k6@ E ( ("AkN ( jAk-AG #AjA0E (! (!@ E #AjA 0E   (  kj6   ( k"6@@@ ( AkN ( jAk-AG #AjA0  ( k! 6@ E (Ak" ( L ( j-AG #AjA0E   ( k6@ E ( ("AkN ( jAk-AG #AjA0  ( k6 E  (6 3"AH  ("6 (!@ E ( ("AkN ( jAk-AG #AjA0E   (  kj6  ( k6A!@ E ( ("AkN ( jAk-AG #AjA0AG! E  (6 3"AH  ("6 (!@ ( ("AkN ( jAk-AG #AjA0AG! @  (  k"k6  ( k6  ( k6A!@ E ( ("AkN ( jAk-AG #AjA0AG!  ( k6  ( k6  (  kj6 (6 3"AH  ("6 ((E@A 6@@ E ( ("AkN ( jAk-AG #AjA0E (6 3"AH  (! (! "E@ (  kj6  AN   ("6 6@@@ E (Ak" ( L @ ( j-Ak #AjA0E E (6 3"AH  ("6  (" ( AkN  ( jAk-"AG@  AG  #AjA0  (  k"k"6 6@ E@ ( k6 E  (6 3"AH  ("6 ( k! E@ ( k6  (6 3"AH  "E@ ( k6  AN   ( k"6 6 E@ ( k6  (6 3"AH  "E@ ( k6  AN   ("6 6@@@ E ( ("AkN @ ( jAk-Ak #AjA0  (6 E  (Ak" ( L @ ( j-Ak #AjA0E   (" ( ("AkN  ( jAk-"AG@  AG  #AjA0  (  k"k6 @ (6 3"AH  ("6 ( k! E@ ( k6  (6 3"AH  "E@ ( k6  AN   ( k6 "E AN   ("6 6@@@ E ( ("AkN ( jAk-AG #AjA0  (6 E  #AjA0E  (! (! @ (6 3"AH  ("6 ( k!@@ E ( ("AkN ( jAk-AG #AjA0  ( k6  (6 3"AH  "E@ ( k6  AN   (  kj"6 ( AkN ( jAk-"AG AGq #AjA0  ("6 6@ E ( ("AkN ( jAk-AG #AjA0E (6 3"AH  ("6 (! @ (6 3"AH  ("6 ( k! E@ ( k6  (6 3"AH  "E@ ( k6  AN   (  k"k6 @ (6 3"AH  (! (! "E@ (  kj6  AN   ( k6 "E@ (  kj6  AN   ("6 6A!@ E (Ak" ( L ( j-AG #AjA0E ! @@ E@ (6A!@ E (Ak" ( L @ ( j-Ak #AjA0E ! E  (6 3"AH  ("6 (!@ E (6 3"AH  "Av"A$ "E  A$F Au q!    (  k"k"6 6@ E@ ( k6 E  (6 3"AH  ("6 ( k! E@ ( k6  (6 3"AH  "E@ ( k6  AN   ( k6 "E@ ( k6  AN  Av   ("6 6A!@ ( ("AkN ( jAk-"AG AGq #AjA0AG! @ (6 3"AN   (6 "Av"A, "E  Au q!@ A,G@ !  ("6 6A!@ E (Ak" ( L @ ( j-Ak #AjA0AG! @@  (6  #AjAAA%A  A (6A!@ E (" ( L @ ( jAk-Ak #AjA0E ! E  (6 3"AH  ("6 (" k!@@ @ (6 3"AH ("6 (!   (  kj6  (  kj6 E  (6 3"AH  (6 "E@ ( k6  AN   ( k6  ("6 6 E@ (6 E  (6 3"AH  ("6 ( k! E@ ( k6  (6 3"AH  "E@ ( k6    AH! Av! E  AH   (6 3"AN   (6 3"AH  (6 A#Aj-! (!@ E@ ( !  (!@ A#Aj-@ (!  (  kj"6 A!  ( "L  (! 6@  L @ ( jAk-Ak @ #AjAAA'AH @ (" ( J@ ( jAk-AF  A#Aj-E  ("6  A#Aj4! 6 AN   (6 #AjAAA'! (!@@ AH (" ( L ( jAk-Ak 6 #AjAAA'! (!@ AH (" ( L @ ( jAk-Ak 6  A#Aj4! 6 AN   6 #AjAAA'AH  (! (! A#Aj-E@ (  kj6 A#Aj-E  ("6  A#Aj4! 6 AN   6  A#Aj4! 6 AH  ("6 6@ #AjA0"E (6@@@@ Ak A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AH  A! (   6   (! (!@ #AjAAA'AH (!@   (" ( "L   ( jAk-AG  Ak6 #AjAAA'AN  ( ! (  k"k"6@  L ( jAk-AG Ak6 #AjAAA'AN  ( k! 6 A#Aӡj-@ #AjAAA'AN  ( k"6@  ( "L ( jAk-AG Ak6 #AjAAA'AN  ( k! ( ! 6@  L ( jAk-AG Ak6 #AjAAA'AN  ( k! 6 A#Aj-@ #AjAAA'AN  ( k"6@  ( L ( jAk-AG Ak6 #AjAAA'AN  ( k! 6 A#Aj-E  #AjAAA'AH  (  kj6A!   (! (! @@ (" ( "L@ !  !  jAk-AG Ak"6 #AjAAA%! (! E  (! ( !   k"j"6  J@A  jAk-AF  A   A#"AH  6A #AjAAA%  ( j   k j 6A K@ E (Ak" ( L ( j-AG #AjA0E !  V@ (Ak" ( L ( j-"AqAG A tAqE #AjA0E !  N@ E ( ("AkN ( jAk-AG #AjA0E !  K@ E (Ak" ( L ( j-AG #AjA0E !  I@ E ( ("AkN ( jAk-AG #AjA0AG!   (6 A#Aj-"E@A (! (!@@@@ E (Ak" ( L @ ( j-Ak #AjA0E (6 3"AH  AG! ("6 (!@ E ( ("AkN ( jAk-AG #AjA0E (6 3"AH  (! (! "E@ (  kj6A AH" A  k" (j6 E@ ( j6A (6 3"AH  ("6 ( k!@@ E ( ("AkN ( jAk-AG #AjA0  ( k6A (6 3"AH  "  ( k6A (  k"k6@ E (Ak" ( L ( j-AG #AjA0E E (6 3"AH  ("6@@@  (" ( AkN  ( jAk-"AG@  AG  #AjA0  (  k"k"6 6 E@ ( k6 E  (6 3"AH  ("6 ( k!   ( k6A (6 3"AH A (6 3"AH  "E@ ( k6A AH A ( k6 "E@ (  kj6A AH A ( k6A! E  ( ("AkN @ ( jAk-Ak #AjA0E @@@  (" ( ("AkN  ( jAk-"AG@  AG  #AjA0  (  k"k6 E  (6 3"AH  ("6 ( k!   ( k6A (6 3"AH A (6 3"AH  "E@ ( k6A AH A ( k6 "AL A AH@   AH A   !   (! (! @@ (" ( "L@ !  !  jAk-AG Ak"6 #AjAAA%! (! E  (! ( !   k"j"6  J@A  jAk-AF  A   A#"AH  6A #AjAAA%  ( j   k j 6A @ (" ( L ( jAk-"AqAG A tA qE #AjA 0E (! (! @ #AjAAA% (! (! #AjAAA' (  kj   k" (j6 #AjAAA%! ( j"6 E  (  ( A#"AH  6 #AjAAA'  ( j 6A!   E@A @ #AjAAA% (! (! @@ (" ( "L@ !  !  jAk-AG Ak"6 #AjAAA%! (! E  (! ( !   k"j"6  J@  jAk-AF    A#"AH  6 #AjAAA%  ( j   k j 6A!   ("!@ 6@@@@@ #AjA/"E ("6@@@@@@@ Ak A#Aj,  6 A#Aj2"AN  A#Aj,  6 A#Aj2"AN   A#Aj,  6 A#Aj2"AN   A#Aåj2"AN   A#Aťj2"AN   A#Aǥj2"AN   A#Aɥj2"AN   6 (  (A""AN  !@ 6 6 #A˥jA A A$E@ (6 3"AN   6 (  (A""AN 6 ( (6 ("6@ A#Aj,E@ 6  ("6@ A#Aj,E@ 6 A#Aj,E  6  6 A#Aj2"AH  (! @@ #AjA(/E (!@@ A#Aj, 6 A#Aj, 6 A#Aj,E  ( (H !  6 A#Aj,! 6   6 A#Aj,@ (6 A#Aj2"AN   6 6 A#Aj,E (6 A#Aj2"AH   6 @ ( (" (A""AH ( 6 6@ Aj" (N ( j-AqAG #AjA/@ (!  6 @ #AjA A A$ #AjA A A$ #AjA A A$ ( (6  6 #AjA A A&AH @ #AjA A A$E ( (6 ("Aj"( ("N  6 6 ("6 6@ #AjA0"E ("6@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak!  ! (( J 3"AN # (( J  A#Aj2"AN  " (( J  3"AH ! (6 #AjA0"E  (6@@@@@@@@@@@@@@@@@@@@@@@@@@ Ak 8 A#Aj2"AN 7 : A#Aj2"AN 6 9 A#Aj2"AN 5 8 A#Aj2"AN 4 7 A#Aj2"AN 3 6 A#Aj2"AN 2 5 A#Aj2"AN 1 4 A#Aj2"AN 0 3 A#AƩj2"AN / 2 A#AΩj2"AN . 1 A#Aԩj2"AN - 0 A#Aکj2"AN , / A#Aj2"AN + . A#Aj2"AN * - A#Aj2"AN ) , A#Aj2"AN ( + A#Aj2"AN ' * A#Aj2"AN & ) A #Aj2"AN % ( A #Aj2"AN $ ' A #Aj2"AN # & A#Aj2"AN " % A#Aj2"AN ! $ A #Aj2"AN # A#AȪj2"AN  " A#AΪj2"AN  ! @  ((N@ 3"AN  " A#A֪j2"AH ! (6 A#Aتj-E  (! (!@ A#Aj-@ (!  (  kj"6 6 A #Aj2"AN  A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#Aj2"AN   A#A«j2"AN   A#Aʫj2"AN   A#Aҫj2"AN  A#Aګj2"AN  A#Aj2"AN  A #Aj2"AN A #Aj2"AN A #Aj2"AN  A#Aj2"AN  A#Aj2"AN  A #Aj2"AN   A#Aj2"AN   A#Aj2"AN   A #Aj2"AN   (( J  A#Aj2"AN   (!@ A#Aj-E@ (  k"k6 A#Aj-E  (( (AjJ  A#Aj2"AN   ( k"6 (( J 3"AH  ("6 6@ Ak" ( L ( j-"AqAG A tAqE #AjA0"E ("6@@ Ak (( J  3"AN   (( J #AjA A A% 3"AH  ("6 6@ #AjA 0"E ("6 AG (( J 3"AH  (!@ 6 6 (" k!@ A#A¬j-E@ (  kj6 A#AĬj-E  (6 3"AH  ( k!  ( k"6 (  ( A#"AN ( 6A!  A#Aj2"AH  6   6 ܀# Ԁ8d @PostgreSQLdsnowball_initmultiple StopWords parametersmultiple Language parametersstopwordsportermissing Language parametergermancatalanrussianindonesianhungarianarmenianlithuanianromanianitaliannorwegianserbiantamilgreeknepalihindiirishfinnishspanishdanishenglishturkishswedishyiddishdutchfrenchbasqueportugueselocate_stem_modulelanguagearabic# 149:pg_unreachable():dict_snowball.cno Snowball stemmer available for language "%s" and encoding "%s"unrecognized Snowball parameter: "%s"AatsedenaraberabadituideabideakideapideakundeagaleataileatzaileaguneakuneatzagagaiaaldiataldiakariagarriakarriakatzakalamenapenakinaezinatezinakunatunakizunaeraberaaraberakeraperaorrakorraduragurakuraturaetaketagailuaezaerrezatzagaitzakaitzakuntzaidebidekidepidekundetzaketzekelegaletailetzailegunekunetzeatzegaialditaldikiarikarilaritarietarigarrikarriarazitarazianeanreankanetanatsedenmenpenkinrekinezintezintunkizungoagotiodakoorkortzatdugailutuatualdatutatubadituezerreztzezgaitzkaitzjoktraminutuzehargeldiigaroaurkaadakadaandadendagabeakabeaaldeakaldeataldeaordeazaleatzaleagileaemeakumeaneaeneazioneauneaguneapeaaurreateakoteaarteaosteaetxeagaangagaiaaldiataldiahandiamendiageiaegiadegiategianahiaohiakiatokiaoiakoiaariakarialariatariaeriakeriateriagarrialarriakirriaduriaasiatiaeziabiziaontziakajokaaurkaskaxkazkagibelagelakailaskilatilaolanakanaenagarrenagerrenaurrenazainatzainakinaminagarnaunadunaasunatasunaondoakondoangoazioakoatakoazkoanoazinoaaroataroazaroaeroaoroaosoatoattoaztoatxoatzoaoaraaradaraliaratiarataraetaratzaraberakeraperaoratzarrakorratrasaosataetaketastaduamenduaordualekuaburuaduruatsuatuamentuaestuatxuazuatzuazaezaerozatzakoitzaantzagintzakintzakuntzagabekabekidealdekaldetaldeordegezaletzalegileemekumenezioneunegunepeaurretekotearteosteetxegaidialditaldigeldihandimendigeiegidegiteginahiohikitokioigoikoiarikarilaritarigarrilarrikirriduriasitiontziiakektarikgibelailkailkantanetanenrengarrengerrenurrententzenzaintzainkinmindunasuntasunaizunondokondogongoziokotrakotakoetakoekotarikoskotukominutukozkonozinoroaroigarotarozaroerogirooroosotottoztotxotzogintzoozpardarbeharzeharliartiartartzarorkorosketdumenduordulekuburudurutsututatumentuestutxuzutzugintzuzezeroztzkoitzzzleakerialaeradadetadedatetategikiiklanikriklarikztikgoroerotoAQ la-laselaleme-mese-tehi'hili-li'l'm-m'n-nho'holoselo'slasselasles-les'ls-ls'ns-nsenslosselosnos-nosvosus-us'tlogiccicalgicaencaadaanciaencianciacialogiainiainiaeriariaatriaallaellavolaimassimaqussimaanainaerasferaoradoraadoraaduraesaosaassaessaissaetaitaotaistaialistaionistaivaativanalogaicsticencescudatgebleableibleismeialismeionismeivismeaireicteisteicicilogiaritorialilallellvolisamissemssemssemssimqussimamenssinarificaregarejaritaritzarferordordurdorasicslgicsudsncesadesanciesenciesnciescieslogiesiniesnieseriesriesatriesblesablesiblesimesssimesqussimesformesismesialismesineseresoresdoresidoresduresesesosesassesictesitesotesistesialistesionistesiqueslgiquesivesativeslogesallengesiciscislogisaristorislsalsellsimsssimsqussimsionscionsacionsesosososassosissosersorsdorsadorsidorsatsitatsbilitatsivitatsativitatstatsetsantsentsmentsamentsotsutsiustriusatiussssdssitatbilitativitatativitattatetantentientmentamentisamentotisseusseusseutriussiuatiuiciaciabaescaiscascaadaidaudadaiaariairiaaraierairaadoraraavaixaitzaaaraerairaaiscscadedidieredreaseieseasteisteiiiniesquieixiitziamemaremiremremremssemssemiguemguemavemvemvemirememaremiremassimessimissimssimssimssimssimmanabanarianaranieranirananaraneraniranenienarienirienarenerenirenrenrenaseniesenassenessenissenssenssenesquenisquensquenavenixeneixenxeneninininsinisinassinessinissinssinesquineixinaronieronarnernirninadoidoandoiendoioixoeixoxoitzoartzarereixeriradorasabasadasidasarasierasasaraserasirasidsesadesidesudesdesatgesiesariesiriesaresiresadoresresasesiesesassesessesissesssesquesesquessquesavesixeseixesxesesabaisaraisieraisaisaraiseraisiraisaseisieseisasteisisteisinissisisisassisessisississsisesquiseixisitzisisariserisirisamsadosidosamosbamosramosiramosamosaramoseramosiramosaremoseremosiremossemosisemosimosadorsasserassessatsitsentssarsirsarsersirssarssisatitantentintuttauerauieuineuareuireureureuasseuesseueresseusseusseuigueugueuveuveuitzeueuireueuareuireuassiuissiussiussiussiussiuuixeixxitziariritzareririrareririiicaeinoirsisossiteuiuiquitzaeiou.A0*hedethederedeeredeendeerendeeneerneereenhedenerenerhedererershedsesendeserendeseneserneseresenshedenserensersetseretseteretgddtgtktstiglsigligeligelslstwwaeiouYAIYheidCheidenigAeneseenhedensgemendiginglijkbaarbarddkkttaaeeoouuyiIYskiskydielietieidlgentlugliearlionlisinglandesatlasbiascosmosdyingearlygentlyhoweidlylyingnewsonlysinglyskiesskisskytyinguglyYAYarsencommungenerssiie''s''siedsiesssesssussucceedproceedexceedcanninginningearringherringoutingeeeeedeedingedlyeedlyinglybbddffggblmmnnpprratttizAitionenceanceableentizeatealfulousivebleogless7ancienciogilibliabliallifullilessliouslientlialitibilitiivititionalationalalismationizationizeratorivenessfulnessousnesstionatealicicateativealizeicitiicaltionalationalfulnessicanceenceableibleateiveizeitialismionerousantentmentementelyA a pastikaanhankinhnknkopkkseksinsammennenisianennnsllanassataltastallnsstltstlleineiewwallanassataltastattalleineksinhandenseenhenttenhinsiinhonhnhnllnsstltstttA aaeeiioouupoejammaimmampaimpammiimmimpiimpiejmmimmmpimpijpommaimmaicAgUIYHeHiYUcolpartapiciqUloguentateuxiabliqUaticiqUeaualeuxantentiqUeatriceanceencelogieableismeeuseisteiveifusionationutionateuriqUesatricesancesenceslogiesablesismeseusesistesivesifsusionsationsutionsateursmentsementsissementsitsmentementissementammentemmentauxeauxeuxitiqUablIrireusivicabiliviraieisseissanteiiraiirirasiesmesissesissantestesisiraisissaisirionsissionsironsissonsissantsitiraitissaitissantiraIentissaIentirentissentironttiriezissiezirezissezaeraasseanteeaieraieraserasmesassesantestesesaiseraisionserionsassionseronsantssaiteraitantaIenteraIentrentassenterontteziezeriezassiezerezHiAieIreireionIerierelleillennonnetteiuyHHeHiIUYssA UYnisuuigereneemenernersesenerstestendigunglichischikheitkeitiglichyuaoUYAkahlahpunnyakumussppdikemememmenmengmenypempenpengpenyteriankanajarajarbebelajarberpepelajarpererfsbcdgptmb'bhbhfbpchd'd'fhdhdtfhgcghh-m'mbmhn-ndngphsht-thtsAochtaaochtaireaireabheabhibhaibhamheamhimhaimhochtaochtirairarcgingrafpaiteidideachapatachaachtaarcachtaeachtagrafaochtapaiteacheachideachgineachpatachgrafaochpataighidighachtileachtilgineasginisachtarcachteachtgrafaochtarcachtagrafaochtaimidaimidmidamidadheadhfaidhfidhilainteartarqUAUIquelacelaglielamelatelavelaleceleglielemeleteleveleneceneglienemeneseneteneveneciliceliglielimeliteliveliglimisitiviloceloglielomeloteloveloandoendoareriricloguenteataticicalogiaosaistaivaanzaenzaiceatriceichelogieabileibileusioneazioneuzioneatoreoseantementeamenteisteiveanzeenzeiciatriciichiabiliibiliismiusioniazioniuzioniatoriosiantiamentiimentiistiiviicoismoosoamentoimentoivoitistististicabilosivicabiliviscaendaataitautaavaevaivaerebbeirebbeisceendeareereireasseateavateevateivateeteereteireteiteeresteiresteuteeraiiraiisciendiereiireiassiatiitierestiirestiutiavieviiviiscoandoendoYamoiamoavamoevamoivamoeremoiremoassimoammoemmoeremmoiremmoimmoanoiscanoavanoevanoivanoerannoirannoonoisconoaronoeronoironoerebberoirebberoasseroesseroisseroatoitoutoavoevoivoarirerirerirAiuIUA0w}eraeedeandeendeaneeneheteneerteenhetenarerhetersasesedesendeseneshetenesenshetensersetsethetertastdtvtlegelegigeigligeligelslovelovslovhetslovYAYyssisiesssessseeeeedeedingbbddffggblmmnnpprratttizAitionenceanceableenteizeatealfulousivebleancienciablielialliouslientlialitibilitiivititionalationalalismationizationizeratorivenessfulnessousnessalicicateativealizeicitiicalfulnessicanceenceableibleateiveizeitialismionerousantentmentementoua~o~A loguenteatatiricanciancialogiairaadoraosaistaivaezaidadeantementeamentevelvelicoismoosoamentoimentoivoaa~oua~oadoricasnciaslogiasirasadorasosasistasivasezasidadesadoresantesao~esuo~esicosismosososamentosimentosivosicadosivanteavelvelicabilivadaidaiaariaeriairiaaraerairaavaasseesseisseasteesteisteeiareiereiireiamiamariameriamiriamarameramiramavamemaremeremiremassemessemissemadoidoandoendoindoara~oera~oira~oarerirasadasidasiasariaseriasiriasaraserasirasavasesardeserdesirdesareseresiresassesessesissesastesestesistesisaiseisareisereisireisreisreisreissseissseissseisveiseisareisereisireisadosidosamosramosramosramosvamosamosaramoseramosiramosemosaremoseremosiremosssemosssemosssemosimosarmosermosirmosmosarsersirseuiuouareriraiooscea~o~A iendoandoarerirlaselalemeseloselolasselasleslosselosnosandoiendoyendondoindoarerirrrricloguenteataticaanciaenciaadoraosaistaivaanzalogaidadableibleantementeamenteacinucinicoismoosoamientoimientoivoadoricasanciasenciasadorasosasistasivasanzaslogasidadesablesiblesacionesucionesadoresantesicosismosososamientosimientosivosicadosivableibleanteicabilivyayeyanyenyeronyendoyoyasyesyaisyamosyabaadaidaaraieraaaraerairaadedidaseieseasteisteanabanaranierananaraneraniranenaseniesenaronieronarnernirnadoidoandoiendoarerirasabasadasidasarasierasasaraserasirasesasesiesesabaisaraisieraisaisaraiseraisiraisaseisieseisasteisisteisisisariserisirisadosidosamosbamosramosiramosamosaramoseramosiramosemosaremoseremosiremossemosisemosimosarsersirssarerirareririaeoosaeiouA waarnaernaheternaornaadeadeandearneareasteenandenarenhetenernarerheterorsasarnasernasornasesadesandesensarenshetensernsatandethetastddgdnndtgtktttlsfulligligelsfulltlstA4csdzsgylynysztyzsalelbbccddffggjjkkllmmnnpprrccssszzsttvvggyllynnyttysszzzbarabereignaknekvalvelulnlnlblrltlblrltllnanbanenbenkppenonnkppkortatetkntankntenkntonkntotrtthezhozhzvvaeeannnkntaestulastulstulstlestlstleaiiikakekokkkkaeajadadedoddddejenkunknknknkukjukjukkjkjkmamemommmoaeidaidjaideidjeidididiaijaieijeiiiitekeitekjeitekitekikaikjaikeikjeikikikinkainkjainkeinkjeinkinkinkaitokjaitokitokimaimjaimeimjeimimimaekakekokkkkA UIaeiabiataieaaiaauaiuaaieeleileiileieiateiiiuluiuleloriloriilortistabilibilivicatiticalaicivaativaitivaicaleaiuneiiuneatoareitoaretoareicitateabilitateibilitateivitateiciveativeitiveicaliatoriicatoriitoritoriicitatiabilitatiivitatiiciviativiitiviicitiabilitiivitiicitiabilitiivitiicalatoricatoritortoricivativitivicalicivativitivicaabilaibilaoasaataitaantaistautaivaiciceabileibileismeiuneoaseateitateiteanteisteuteiveiciabiliibiliiuniatoriosiatiitatiitiantiistiutiitiivioiitiitiabilibilismatorosatitantistutivicabilibiloasatitantistutiveaiaescscindndareereirereseaseseseiseuseseeteteezeaieaiiaiseietitiuieziaiseiaseiseseiiseiuseiseiiiuiiiaieaiiaieiiiiariseriaseriseseriiseriuseriseriiriuririameamiamemasemsesemisemusemsemimmmarmsermasermsesermisermusermsermirmurmrmaueauiauindunduezeascarseraserseseriseruserserirurreazaeieiiuIU#"البالكاللل0123456789ءأإئآؤابةتثجحخدذرزسشصضطظعغفقكلمنهوىيلالألإلآـًٌٍَُِّْ٠١٢٣٤٥٦٧٨٩ﺀﺁﺂﺃﺄﺅﺆﺇﺈﺉﺊﺋﺌﺍﺎﺏﺐﺑﺒﺓﺔﺕﺖﺗﺘﺙﺚﺛﺜﺝﺞﺟﺠﺡﺢﺣﺤﺥﺦﺧﺨﺩﺪﺫﺬﺭﺮﺯﺰﺱﺲﺳﺴﺵﺶﺷﺸﺹﺺﺻﺼﺽﺾﺿﻀﻁﻂﻃﻄﻅﻆﻇﻈﻉﻊﻋﻌﻍﻎﻏﻐﻑﻒﻓﻔﻕﻖﻗﻘﻙﻚﻛﻜﻝﻞﻟﻠﻡﻢﻣﻤﻥﻦﻧﻨﻩﻪﻫﻬﻭﻮﻯﻰﻱﻲﻳﻴﻵﻶﻷﻸﻹﻺﻻﻼككمهمكنهنهكمونيكماهماناهانونينانتنياتماناتاتوتموتمواةككمهمهنهيكماهماناهاويااتتنييىأآاإأآأأأؤأإأاافوالبالكالللبكبباببككيتنأسأستسنسياستتستنستيستءاويآأؤإئآأؤإئերներցուցիցերիցներիցցիցվանիցոջիցվիցոցսավաամբդերդներդուդանդությանդվանդոջդըերըներըանըությանըվանըոջըիերիներիվիերումներումանումներններնունանությանվանիներիններինությաննոջությանսվանսոջսովերովներովանովվովարացարեցարացրիրացիրեցիրվեցիրալուցելուցացեցացրեցալուելուաքցաքացաքացրիքացիքեցիքվեցիքանքցանքացանքացրինքացինքեցինքվեցինքաացաեցավեացրիացիեցիվեցիալըալացնալանալենալելըելնելցնելեցնելչելվելացվելեցվելտելատելոտելկոտելվածումվումանցանացանացրինացինեցինվեցինալիսելիսավացավեցավալովելովբարրորդերորդալիակիորակեղվունարանականեներենեկենորէնինգինովինլայնպեսիվատավետկոտգարվորավորանօցոցուքարքչեքիքալիքանիքվածքույքունքմունքենքոնքիչքորդույթցիուհիիլուկակյականակիկյունությունանարանպանստանեղէնածոիչուսուստAatsedenaraberabadituideabideakideapideakundeagaleataileatzaileaguneakuneatzagagaiaaldiataldiakariagarriakarriakatzakalamenapenakinaezinatezinakunatunakizunaeraberaaraberakeraperaorrakorraduragurakuraturaetaketagailuaezaerrezatzagaitzakaitzakuntzaidebidekidepidekundetzaketzekelegaletailetzailegunekunetzeatzegaialditaldikiarikarilaritarietarigarrikarriarazitarazianeanreankanetanatsedenmenpenkinrekinezintezintunkizungoagotiodakoorkortzatdugailutuatualdatutatubadituezerreztzezgaitzkaitzjoktraminutuzehargeldiigaroaurkaadakadaandadendagabeakabeaaldeakaldeataldeaordeazaleatzaleagileaemeakumeaneaeneazioneauneaguneapeaaurreateakoteaarteaosteaetxeagaangagaiaaldiataldiahandiamendiageiaegiadegiategianahiaohiakiatokiaoiakoiaariakarialariatariaeriakeriateriagarrialarriakirriaduriaasiatiaeziabiziaontziakajokaaurkaskaxkazkagibelagelakailaskilatilaolanakanaenagarrenagerrenaurrenazainatzainakinaminagarnaunadunaasunatasunaondoakondoangoazioakoatakoazkoanoazinoaaroataroazaroaeroaoroaosoatoattoaztoatxoatzoañoaraaradaraliaratiarataraetaratzaraberakeraperaoratzarrakorratrasaosataetaketastaduamenduaordualekuaburuaduruatsuatuamentuaestuatxuazuatzuazaezaerozatzakoitzaantzagintzakintzakuntzagabekabekidealdekaldetaldeordegezaletzalegileemekumenezioneunegunepeaurretekotearteosteetxegaidialditaldigeldihandimendigeiegidegiteginahiohikitokioigoikoiarikarilaritarigarrilarrikirriduriasitiontziñiakektarikgibelailkailkantanetanenrengarrengerrenurrententzenzaintzainkinmindunasuntasunaizunondokondogongoziokotrakotakoetakoekotarikoskotukominutukozkonozinoroaroigarotarozaroerogirooroosotottoztotxotzogintzoñozpardarbeharzeharliartiartartzarorkorosketdumenduordulekuburudurutsututatumentuestutxuzutzugintzuzezeroztzkoitzzzleakerialaeradadetadedatetategikiiklanikriklarikztikgoroerotoAQ la-laselaleme-mese-tehi'hili-li'l'm-m'n-nho'holoselo'slasselasles-les'ls-ls'ns-nsenslosselosnos-nosvosus-us'tlogiccicalógicaencaadaanciaenciaènciaícialogiainiaíiniaeriaàriaatòriaallaellaívolaimaíssimaquíssimaanainaerasferaoradoraadoraaduraesaosaassaessaissaetaitaotaistaialistaionistaivaativançalogíaicísticencescudatgebleableibleismeialismeionismeivismeaireicteisteiciícilogiaritorialilallellívolisamissemìssemíssemíssimquíssimamenìssinarificaregarejaritaritzarferordordurdorasicslógicsudsncesadesanciesenciesènciesícieslogiesiniesínieseriesàriesatòriesblesablesiblesimesíssimesquíssimesformesismesialismesineseresoresdoresidoresduresesesosesassesictesitesotesistesialistesionistesiqueslógiquesivesativeslogíesallengüesicisícislogisaristorislsalsellsimsíssimsquíssimsionscionsacionsesosososassosissosersorsdorsadorsidorsatsitatsbilitatsivitatsativitatsïtatsetsantsentsmentsamentsotsutsiustriusatiusèsésísdísósitatbilitativitatativitatïtatetantentientmentamentisamentotisseuìsseuísseutriuíssiuatiuóiócióacióabaescaiscaïscaadaidaudaïdaiaariairiaaraierairaadoraïraavaixaitzaíaaríaeríairíaïaiscïscadedidieredreaseieseasteisteiiiniesquieixiitziamemaremiremàremíremàsseméssemiguemïguemavemàvemávemirìemíemaríemiríemassimessimissimàssimèssiméssimíssimïmanabanarianaranieraniraníanaríaneríaniríanenienarienirienarenerenirenàrenïrenaseniesenassenessenissenéssenïssenesquenisquenïsquenavenixeneixenïxenïeninininsinisinassinessinissinïssinesquineixinaronieronaráneránirániïnadoidoandoiendoioixoeixoïxoitzoartzarereixeriradorasabasadasidasarasierasíasaríaseríasiríasidsesadesidesudesïdesatgesiesariesiriesaresiresadoresïresasesiesesassesessesissesïssesquesesquesïsquesavesixeseixesïxesïesabaisaraisieraisíaisaríaiseríaisiríaisaseisieseisasteisisteisinissisisisassisessisissisïssisesquiseixisitzisáisaréiseréisiréisamsadosidosamosábamosáramosiéramosíamosaríamoseríamosiríamosaremoseremosiremosásemosiésemosimosadorsasserassessatsitsentsàsaràsiràsaráserásirásésarésísiïsatitantentintutïtauerauieuineuareuireuàreuíreuasseuesseueresseuàsseuésseuigueuïgueuàveuáveuitzeuìeuirìeuíeuaríeuiríeuassiuissiuàssiuèssiuéssiuíssiuïuixeixïxitziàaràiràitzàaráeráiráirèaréeréiréíiïióicaeiïnoirsisosïsiteuiuiquitzàáéìíïóaeiou.·àáèéìíïòóúüA0*hedethederedeeredeendeerendeeneerneereenhedenerenerhedererershedsesendeserendeseneserneseresenshedenserensersetseretseteretgddtgtktstigløsigligeligelsløstwwaeiouYAIYáäéëíïóöúüheidCheidenigAeneseenhedensgemendiginglijkbaarbarddkkttaaeeoouuyiIYskiskydielietieidlgentlugliearlionlisinglandesatlasbiascosmosdyingearlygentlyhoweidlylyingnewsonlysinglyskiesskisskytyinguglyYAYarsencommungenerssiie''s''siedsiesssesssussucceedproceedexceedcanninginningearringherringoutingeeeeedeedingedlyeedlyinglybbddffggblmmnnpprratttizAitionenceanceableentizeatealfulousivebleogless7ancienciogilibliabliallifullilessliouslientlialitibilitiivititionalationalalismationizationizeratorivenessfulnessousnesstionatealicicateativealizeicitiicaltionalationalfulnessicanceenceableibleateiveizeitialismionerousantentmentementelyA a pastikaanhankinhänkäänkopäkökseksinsammennenisianenännsällanassataltastallänässätältäställeineäöiewwallanassataltastattalleineksinhandenseenhenttenhinsiinhonhänhönällänässätältästättäA aaeeiioouuääööpoejammaimmampaimpammiimmimpiimpiejämmäimmämpäimpäijpommaimmaiçcAgUIYëHeïHiYUcolpartapiciqUloguentateuxiabliqUaticiqUeaualeuxantentiqUeatriceanceencelogieableismeeuseisteiveifusionationutionateuriqUesatricesancesenceslogiesablesismeseusesistesivesifsusionsationsutionsateursmentsementsissementsitésmentementissementammentemmentauxeauxeuxitéiqUablIèrièreusivicabiliviraieisseissanteiiraiirirasiesîmesissesissantesîtesisiraisissaisirionsissionsironsissonsissantsitiraitissaitissantiraIentissaIentirentissentirontîtiriezissiezirezissezaeraasseanteéeaieraieraserasâmesassesantesâteséesaiseraisionserionsassionseronsantsésaiteraitantaIenteraIentèrentassenterontâteziezeriezassiezerezéHiAieIèreièreionIerierelleillennonnettéèeiuyëïHHeHiIUYßssA UYnisuuigereneemenernersesenerstestendigunglichischikheitkeitiglichyuaoUYäöüαβγδεζηθικλμνξοπρστυφχψωςΆΈΉΊϊϋΌόύΎώΏΐΑΒΓΔΕΖΗΘΙΚΛΜΝΞΟΠΡΣΤΥΦΧΨΩΪΫάέήίΰφασκαολοσοτατοκρεπερτερφωκαθεστγεγονκαθεστωσφωσπεραστερασκρεασκαθεστωτοσφωτοσπερατοστερατοσκρεατοσγεγονοτοσγεγονοσφαγιουσκαγιουσογιουτατογιουολογιουκαθεστωταφωταπερατατερατακρεαταγεγονοταφαγιασκαγιασογιατατογιαολογιαπερατηκαθεστωτωνφωτωνπερατωντερατωνκρεατωνγεγονοτωνφαγιωνσκαγιωνσογιωντατογιωνολογιωνιιζιζεσιζεισιζωιζαιζατειζετειζειζουμειζαμειζουνειζανειζειιζουνιζανπιμπρπρμπραρργλυκυρπολυραμπαρμαργκρπιπερορβολβοργλυκορλουπαξαναπαεπαπεριπααναμπαεμπαβδανεβαθυριβαρκμαρκλμκορναθροσυναθροωνωθηκεσωθηκαωθηκατεωθηκεωθηκαμεωθηκανεωθηκανσχυψζωβιλιαλενισαισιισισεσισαισεισατεισαμεισανεισανπλαρδημοκραταφγιγαντοαφξαναπαεπαπεριπααναμπαεμπαχαρτοπαεξαρχαπεεπεμετεπεεσεγεγκεκλεεσωκλεεκλεαπεκλεαποκλεδανεγκμπουκαμκομαναθροσυναθροολοιισεισισωισετεισουμεισουνεισειισουνξαναπαεπαπεριπααναμπαεμπαχαρτοπαεξαρχαπεεπεμετεπεεσεκλεεσωκλεεκλεαπεκλεαποκλεδανεαθροσυναθροιιστιστουσιστεσιστησιστοσιστουισταιστειστηιστοιιστωνιστοπευπαπεμπγυρχρχωραραορχταχτκτακτσχασχταχυψαταφαηφαλυγμεγηδσεασεπλεκλεεσωκλεδανεεχθκαθσκκακμακκυλφιλμγεμαχνσυναθροισμιαγνωστατομγνωστεθνεκλεκτσκεπττοπαλεξανδρβυζαντθεατρισμουσισμοσισμουισμοιισμωνισμοσεμετασεμικροσεεγκλεαποκλεδανεαντιδανετοπικσκεπτικγνωστικαγνωστικεκλεκτικατομικεθνικθεατριναλεξανδρινβυζαντιναρακαρακιαουδακιααρακιουδακισχακιτσκοριτσιτσασιτσεσιτσαακιααρακιαακιαρακιιτσωνπκατραπρβρλαβραμβρπατερμερανθρκορσναγκαστοσμουστρυφσφαλισφνυφχββαμβσλοβτσεχοσλοβκαρδζτζκσκκαπακσοκπλφυλλουλβαλμαλγλτριπολφαρμκαιμκλιμμακρυνσπανγιανηγουμενκονιδιδιδιαιδιωνιδιοιρψαλαιφνολοεπαιχνισκισκοσισκουισκεισκοριβδλυκφραγκοβελμηναδαδεσαδωνμπαμπκυρπατερπεθερνταντγιαγιθειοκμαμμανεδεδεσεδωνκρασπυπδαπγηπιπεμποπμιλουδουδεσουδωνσπφρσλιχτραγφεαρκσκκαλιακλουλφλπεταλβελχνπλεξεεωσεωνππαρδιδθγαλελνQAιιουιαιωνικικικουικαικωνικοκαλπγερπλιατσπετσπιτσφυσχασμποσσερτμπαγιατνιτπικαντεξωδαδκαταδσυναδαντιδενδυποδπρωτοδφυλοδηθανηθξικμουλαλαμμοχαλσυνομηλμπολβρωμτσαμμπαναμανκαλλινποστελνφιλοναγαμεαγαμαμεαμουσαμεησαμεαγαμεηκαμεηθηκαμεαναππικραποστποτχσιχβουβπεθξεθαποθαποκουλαγανανεQAανανουσανεησανεουντανειουντανεοντανειοντανεοτανειοτανεαγανεηκανεηθηκανετρτσπσππολυδαπαδαπχαμηλοδαπτσοπκοπυποκοππεριτρουρερβετεργερλουθηρκορμορσσαρακατσθυσβασπολισκαστδιατπλαττσαρλαττετπουριτσουλτζωντμαιντφπενταρφκοιλαρφορφδιαφστεφφωτοστεφπερηφυπερηφχπολυμηχαμηχβιομηχμικροβιομηχμεγλοβιομηχκαπνοβιομηχλιχταβνταβψηλοταβλιβκλιβξηροκλιβγανοργενοργαγτραγτσαγτσιγγατσιγγαθιγγστεγαπηγσιγκαλπουζθμωαμεθπιθαπιθβασκβραχυκδεκπελεκικανικβουλκπλδιπλψυχοπλλαοπλουλγαλβαθυγαλκαταγαλολογαλκαστελμελπορτολμδραδουμβραχμολιγοδαμμουσουλμναμερικανετεετετετησετεπυρευρχωρβαρβραιρφορνετσχσυνδενδοδυπερθσθευθραθταθδιαθκαθτιθεκθσυνθενθροθαρκωφελβολσυναινπονρονσερπκοπθαρρντραβαρεναραβρμπορυσυρφνιφπαγδαδθαθσκτοκαπλπαρακαλσκελεμανβενβαροναρχοντκρεωντωντασοντασονομαστομαστειομαστειεστειεστεστειεστπαπακαταπσυμπασυμπαμεταμφαρνισζαλπαρακαλεκτελμξπροηκηκηθηκεσηθηκαηθηκεηκεσηκαηκεσφναρθπιθοθσκουλσκωλθπροσθπαρακαταθδιαθσυνθουσουσουσεσουσαουσεβλεπποδαρπρωτκυματπανταχλαχφαγληγφρυδμαντιλμαλλομεκλιπραναρρενδιαφερπατκαθαρευδευτερευλεχτσαχαδμεδλαμπιδδεπλεμεσαζδεσποζαιθφαρμακαγκανηκλμαμβρομυποτεινησησουησαησενεπτανδωδεκανχερσονμεγαλονερημονκολλαγαγαγαγεσαγααγερππρφρχορτσφοφψοφλοχναυλοχπελλλσμηνπασπανυπαρτιπαειπσυμππροσωποπσιδηροπδροσοπνεοπκροκαλοπολοπρτρουρασπαρχαραχαραπερτανυσταβαστπροσταιμοστδιατεπιτσυντυποταποτομοτνομοτναυπολυφαφξεφαδηφπαμφαμαλλιλαμαλμουλαμενδερβενηστηστεχρδυσχρευχραχρκοινοχρπαλιμψσβασβαπλαειμνουνουνεησουνεηθουνερστραβομουτσκακομουτσσπινεξωνουμουμεησουμεηθουμεασουσπαρασουσαλλοσουσφχαζωριοπλμαματοσματαματωνυσουσασεσησεσηδεσησεισηθεισοσυουωησωαωηθωαιουμαοσουναιοσουναομουναιομουναειεσαστεοσαστειοσαστεουμαστειουμαστειεμαστεουσατεησατεαγατεηκατεηθηκατεειτεηθειτεηιασαιεσαιιεσαιαταιεταιιεταιουνταιιουνταιονταιουμαιαμαιιεμαιομαιειησειαειηθειοιουνησουνοσουνιοσουνηθουνομουνιομουνωνηδωνανουσανοντουσανιοντουσανησανοσαστανιοσαστανομαστανιομαστανουντανιουντανοντανιοντανοτανιοταναγανηκανηθηκανοεστερυτερωτεροτερεστατυτατωτατοτατीूंगीेंगीऊंगीआऊंगीाऊंगीएंगीआएंगीाएंगीेगीोगीएगीआएगीाएगीओगीआओगीाओगीतीअतीआतीातीनीअनीआँाँइयाँआइयाँाइयाँियाँुींतींअतींआतींातींआंुआंउआंेंईंआईंाईंोंइयोंआइयोंाइयोंियोंएंुएंआएंउएंाएंताएंअताएंनाएंअनाएंओंुओंआओंउओंाओंताओंअताओंनाओंअनाओंांइयांआइयांाइयांियांूअआइेेंगेएंगेआएंगेाएंगेोगेओगेआओगेाओगेतेअतेआतेातेनेअनेआनेानेईआईाईउऊो्एआएइएआइएाइएाएिएओआओाओकरअकरआकराकराूंगाऊंगाआऊंगााऊंगाेगाएगाआएगााएगाताअताआताातानाअनाआनाानाआयाायािA$ csdzsgylynysztyzsalelbbccddffggjjkkllmmnnpprrccssszzsttvvggyllynnyttysszzzbarabereignaknekvalvelulbőlrőltőlnálnélbólróltólülnanbanenbenképpenonönképpkortatetkéntankéntenkéntonkéntotértöthezhozhözvávéaeáéeaánénánkéntaestulastulástulstülestüléstüláéeaéiáéiééiékéakéekéokéákéékéökéééaeajadadedodádédödejenkunkánkénkünkukjukájukükjükéjükmamemomámémoáéaeidaidjaideidjeidáidéidiaijaieijeiáiéiitekeitekjeitekéitekikaikjaikeikjeikáikéikinkainkjainkeinkjeinkáinkéinkaitokjaitokáitokimaimjaimeimjeimáiméimaekakekokákékökAkahlahpunnyakumussppdikemememmenmengmenypempenpengpenyteriankanajarajarbebelajarberpepelajarpererfsbcdgptmb'bhbhfbpchd'd'fhdhdtfhgcghh-m'mbmhn-ndngphsht-thtsAíochtaaíochtaireaireabheabhibhaibhamheamhimhaimhíochtaíochtiríairíarcgingrafpaiteóidóideachapatachaachtaarcachtaeachtagrafaíochtapaiteacheachóideachgineachpatachgrafaíochpataighóidighachtúileachtúilgineasginisachtarcachteachtgrafaíochtarcachtaígrafaíochtaíimidaimidímidaímidadheadhfaidhfidháilainteartaràèìòùqUAUIquáéíóúelacelaglielamelatelavelaleceleglielemeleteleveleneceneglienemeneseneteneveneciliceliglielimeliteliveliglimisitiviloceloglielomeloteloveloandoendoareriricloguenteataticicalogiaosaistaivaanzaenzaiceatriceichelogieabileibileusioneazioneuzioneatoreoseantementeamenteisteiveanzeenzeiciatriciichiabiliibiliismiusioniazioniuzioniatoriosiantiamentiimentiistiiviicoismoosoamentoimentoivoitàistàistèistìicabilosivicabiliviscaendaataitautaavaevaivaerebbeirebbeisceendeareereireasseateavateevateivateeteereteireteiteeresteiresteuteeraiiraiisciendiereiireiassiatiitierestiirestiutiavieviiviiscoandoendoYamoiamoavamoevamoivamoeremoiremoassimoammoemmoeremmoiremmoimmoanoiscanoavanoevanoivanoerannoirannoonoisconoaronoeronoironoerebberoirebberoasseroesseroisseroatoitoutoavoevoivoarireràiràeròiròAiuIUA@@aitėuotėėjimasesysasysavimasojimasokatėojimeėjimeavimeokateaiteuoteasiusokatėsaitėsuotėsesiuaiaeriaosnaiosnauosnaiuosnaysnaėsnaeieenieerieojeiojeujeiujeyjeenyjeeryjeėjeameiamesimeomeėmetumėmeoseioseuoseiuoseyseenyseeryseėseateiateitekitesiteotetuteėtetumėteiaiiaieriaieitumeikiimierimiumiiumisiasiiasiesiiesisiesiisiaisieisitumeisiuisiosiėjosiuosiiuosisiuosiusiausičiausiąsiėsiųsitųsitientiintiotiiotiuotiiuotiautiiautiytiėtitelėtiinėtiterėtiuiiuieniuiojėjkamiamiemimsimomtumėmtumėmanonionuniunėnoioenioėjouosasiasesiesisaisiaistumeisimisenimisomisiomisumisėmisenisasisysisamsiamsiemsimsenimserimsomsiomsumsėmsensosiosuosiuosersusausiausiusysenyserysąsiąsėsamėsiamėsimėskimėssimėsomėsėmėstumėmėsatėsiatėssitėsotėsėtėstumėtėsūsįstųsatiatitsitotėttumėtuauiaučiauiueniusiuyąiąėęįenįerįųiųerųtdčdžingajiajiejojiojuojiuojaująjiąjėjųjiųjokiokiukuliukučiukiškiulylėlamdamjamzganainesnopiopiasiesaisiaisosiosuosiuosausiausąsiąsęsutėaitantiantsiantintotuotiuotytėtykštiaudavsvšvykščęėjęggdएेकीलाइलेलाईकैसँगैमैकोसँगसंगमार्फतरतकामाद्वाराकिपछिँंैयौछौनौथेत्रँंैेकीएकीइएकीिएकीदेखीथीदीछुेछुनेछुएछुनुहरुहरूछेथेनेेकैनेकैएकैदैइदैिदैेकोनेकोएकोइएकोिएकोदोइदोिदोयोइयोथ्योभयोियोथियोदियोछौइछौेछौनेछौएछौिछौयौछ्यौथ्यौथियौछन्इछन्ेछन्नेछन्एछन्िछन्लान्छिन्थिन्पर्इस्थिइस्छेस्होस्छस्इछस्ेछस्नेछस्एछस्िछस्िस्थिस्थिएछइछेछनेछहुनेछहुन्छइन्छिन्छएछिछेकानेकाएकाइएकािएकादाइदािदादेखिमाथिA0w}eraeedeandeendeaneeneheteneerteenhetenarerhetersasesedesendeseneshetenesenshetensersetsethetertastdtvtlegelegigeigligeligelslovelovslovhetslovYAYyssisiesssessseeeeedeedingbbddffggblmmnnpprratttizAitionenceanceableenteizeatealfulousivebleancienciablielialliouslientlialitibilitiivititionalationalalismationizationizeratorivenessfulnessousnessalicicateativealizeicitiicalfulnessicanceenceableibleateiveizeitialismionerousantentmentementoua~o~ãõA loguenteatatiricaânciaêncialogiairaadoraosaistaivaezaidadeantementeamenteávelívelicoismoosoamentoimentoivoaça~ouça~oadoricasênciaslogiasirasadorasosasistasivasezasidadesadoresantesaço~esuço~esicosismosososamentosimentosivosicadosivanteavelívelicabilivadaidaiaariaeriairiaaraerairaavaasseesseisseasteesteisteeiareiereiireiamiamariameriamiriamarameramiramavamemaremeremiremassemessemissemadoidoandoendoindoara~oera~oira~oarerirasadasidasiasariaseriasiriasaraserasirasavasesardeserdesirdesareseresiresassesessesissesastesestesistesisaiseisareisereisireisáreiséreisíreisásseisésseisísseisáveisíeisaríeiseríeisiríeisadosidosamosáramoséramosíramosávamosíamosaríamoseríamosiríamosemosaremoseremosiremosássemosêssemosíssemosimosarmosermosirmosámosaráserásiráseuiuouaráeráiráaioosáíóceçéêãõa~o~A UIaeiabiataţieaaţiaauaiuaaţieeleileiileieiateiiiuluiuleloriloriilorţtistabilibilivicatiticalaicivaativaitivaicaleaţiuneiţiuneatoareitoareătoareicitateabilitateibilitateivitateiciveativeitiveicaliatoriicatoriitoriătoriicitatiabilitatiivitatiiciviativiitiviicităiabilităiivităiicităţiabilităţiivităţiicalatoricatoritorătoricivativitivicalăicivăativăitivăicaabilaibilaoasaataitaantaistautaivaiciceabileibileismeiuneoaseateitateiteanteisteuteiveiciabiliibiliiuniatoriosiatiitatiitiantiistiutiiştiiviităioşiităţiabilibilismatorosatitantistutivicăabilăibilăoasăatăităantăistăutăivăeaiaescăscindândareereireâreseaseseseiseuseâseeşteăşteezeaieaiiaiseieştiăştiuieziaşiseşiaseşiseseşiiseşiuseşiâseşiişiuşiâşiâiaţieaţiiaţieţiiţiarăţiserăţiaserăţiseserăţiiserăţiuserăţiâserăţiirăţiurăţiârăţiâţiameamiamemasemsesemisemusemâsemimămarămserămaserămseserămiserămuserămâserămirămurămârămâmaueauiauinduânduezeascăarăserăaserăseserăiserăuserăâserăirăurăârăeazăaeieiăiuIUёеи!Aаявшисьывшисьившисьвывиввшиывшиившисьсяаяемуомуыхихуюююеюоюяяаяыеееиеоеымиимиыйейийойымемимомегооговшывшившщющующемннаяытютуютятетуетитныенытьытьитьешьишьюуюлаылаиланаенаетеитейтеуйтеейтелиылиилийуйейлылилымемимненлоылоилоноенонноуяхияхахыьюьюиюяьяияаевовеьеиеиеиииямииямиамийейиейийойямиямамемиемомоостостьнннейшьейшенabvgdđežzijklljmnnjoprstćufhcčdžšабвгдежзиклмнопрстуфхцчшђјљњћџw_ ijeejeedjđAAlogapehvojkabojkajakčajnicajniernilarniesnianjcaajcaljcaejcaojcaajkaojkašcaingtveniktetikanstvaniktikziksnikkusikusnikustvadušnidusniantnibilnitilniavilnisilnigilnirilninilnialniozniravistavnipravnitivnisivniatnientatetnipletnišavisaviantaačkaackauškauskaatkaetkaitkaotkautkaesknatičniticniojskaesmametracentraistraostiostidbačkamcancavoljniankivcascarcaalcaelcaolcanjcaektaizmajebibaciašniasnidabaajacaejacaljacanjacaojacaalacaelacaolacamacanacaracasacavacašacaaocaacakaajakaojakaanakaatakaetakaitakaotakautakaačakaesamaizamajacimanicimaticimateticimazicimaatcimautcimačcimapesimainzimalozimametaracentaraistaraekataanatanstavakustavaajacejacljacnjacanjacojacalacelacolacmacnacracsacvacšacjebeolcekuseravesavešavebacijacitvenicisniciteticibojcivojciojsciatciitciutcičcipesiinziloziacakusakataketakitakotakutakačakušakizamticancajančajanvoljaneskanalanbilangilannilanrilansilantilanavilanlaraneranasanesandusankusanatanpletantetanantanpravanstavansivantivanozantičanašandušanmetarcentaristarekatenatoscuošćuskškstvštvtanijmanijpanijranijganijaninonnaćećućugovugloggrariotisiliujcajčajćajđajlajrajbijcijdijlijnijmijžijgijfijpijrijsijtijzijnalijalozilolovollemramardreroresistašnašjaškašbašgašvašešišikatlatetestistkstostištovaavevivovmovlovelanjenjšnjenšnčinrošioševitovitastkevaavaivauvairačačaniaurastajistajostajajastaistaostatainjasilučjetieatlucsnjosacecucrosiacajastasgasnaskasvasbasascinastajistajostajastaistaostaavaevaivauvaovajetiinjistesetisirurujnisntaaienacaecaucagaacegaecegaucegaanjijegaenjijegasnjijegašnjijegakijegaskijegaškijegaelijeganijegaosijegaatijegaevitijegaovitijegaastijegaavijegaevijegaivijegaovijegaošijegaanjegaenjegasnjegašnjegakegaskegaškegaeleganegaanegaenegasnegašnegaosegaategaevitegaovitegaastegaavegaevegaivegaovegaaćegaećegaućegaošegaacogaecogaucogaanjogaenjogasnjogašnjogakogaskogaškogalogaeloganogacinogačinogaosogaatogaevitogaovitogaastogaavogaevogaivogaovogaaćogaećogaućogaošogaugaajacajalajarajaćajačajađajabijacijadijafijagijaanjijaenjijasnjijašnjijakijaskijaškijalijaelijamijanijaganijamanijapanijaranijatanijapijarijararijasijaosijatijaatijaevitijaovitijaotijaastijaavijaevijaivijaovijazijaošijažijaanjaenjasnjašnjakaskaškaalaacalaastajalaistajalaostajalaijalainjalanalairalauralatalaastalaistalaostalaavalaevalaivalaovalauvalaačalaelailaacilalucilanilaastanilaistanilaostanilarosilajetilaozilaačilalučilarošilaolaaslanulagamalogamaugamaajamacajamalajamarajamaćajamačajamađajamabijamacijamadijamafijamagijamalijamamijamanijamaganijamamanijamapanijamaranijamatanijamapijamarijamasijamatijamazijamažijamaalamaijalamanalamaelamailamaramamalemamainamacinamačinamaramaaramadramaeramaoramabasamagasamajasamakasamanasamatasamavasamaesamaisamaetamaestamaistamakstamaostamaavamaevamaivamabašamagašamajašamakašamanašamatašamavašamaešamaišamalemaacimaecimaucimaajimacajimalajimarajimaćajimačajimađajimabijimacijimadijimafijimagijimaanjijimaenjijimasnjijimašnjijimakijimaskijimaškijimalijimaelijimamijimanijimaganijimamanijimapanijimaranijimatanijimapijimarijimasijimaosijimatijimaatijimaevitijimaovitijimaastijimaavijimaevijimaivijimaovijimazijimaošijimažijimaanjimaenjimasnjimašnjimakimaskimaškimaalimaijalimanalimaelimailimaozilimaolimalemimanimaanimainimacinimačinimaonimaarimadrimaerimaorimabasimagasimajasimakasimanasimatasimavasimaesimaisimaosimaatimaikatimalatimaetimaevitimaovitimaastimaestimaistimakstimaostimaištimaavimaevimaajevimacajevimalajevimarajevimaćajevimačajevimađajevimaivimaovimagovimaugovimalovimaolovimamovimaonovimastvimaštvimaaćimaećimaućimabašimagašimajašimakašimanašimatašimavašimaešimaišimaošimanaanaacanauranatanaavanaevanaivanauvanaačanaacenalucenaačenalučenainacinaaninačinaonaaradraeraorabasagasajasakasanasatasavasaesaisaosaataikatalataetaevitaovitaastaestaistakstaostanutaištaavaevaajevacajevalajevarajevaćajevačajevađajevaivaovagovaugovalovaolovamovaonovastvaštvaaćaećaućabašagašajašakašanašatašavašaešaišaošaaceeceuceluceastadeistadeostadegelogeugeajecajelajerajeastajeistajeostajećaječajeđajeijebijecijedijefijegijeanjijeenjijesnjiješnjijekijeskiješkijelijeelijemijenijeganijemanijepanijeranijetanijepijerijesijeosijetijeatijeevitijeovitijeastijeavijeevijeivijeovijezijeošiježijeanjeenjesnješnjeujelucujeirujelučujekeskeškealeacaleastajaleistajaleostajaleijaleinjalenaleiraleuraletaleastaleistaleostaleavaleevaleivaleovaleuvaleačaleeleileacilelucilenilerosilejetileozileačilelučilerošileoleaslenuleramelemeacomeecomeucomeanjomeenjomesnjomešnjomekomeskomeškomeelomenomecinomečinomeosomeatomeevitomeovitomeastomeavomeevomeivomeovomeaćomeećomeućomeošomeneaneacaneuranetaneastaneistaneostaneavaneevaneivaneuvaneačaneaceneluceneačenelučeneinecineaninečineonearedreereoreasebaseacasegasejaseastajaseistajaseostajaseinjasekasenaseiraseurasetasevaseavaseevaseivaseovaseuvaseeseiseaciseluciserosisejetiseoseastadoseistadoseostadoseateacateikatelateirateuratetateavateevateivateuvateačateeteastadeteistadeteostadeteastajeteistajeteostajeteijeteinjeteujetelucujeteirujetelučujeteneteastaneteistaneteostaneteasteteiteaciteluciteniteastaniteistaniteostaniterositejetiteastiteeviteoviteačitelučiterošiteajteurajtetajteastajteistajteostajteavajteevajteivajteuvajteijtelucujteirujtelučujteasteacasteastajasteistajasteostajasteinjasteirasteurastetasteavasteevasteivasteovasteuvasteačasteesteisteacistelucistenisterosistejetisteačistelučisterošisteksteosteastadosteistadosteostadostenusteišteaveeveajevecajevelajeverajevećajevečajeveđajeveiveovegoveugoveloveolovemoveonoveaćeećeućeačelučeašebašegašejašeastajašeistajašeostajašeinjašekašenašeirašeurašetaševašeavašeevašeivašeovašeuvašeačašeešeišejetišeačišelučišerošišeošeastadošeistadošeostadošeacegeceguceganjijegenjijegsnjijegšnjijegkijegskijegškijegelijegnijegosijegatijegevitijegovitijegastijegavijegevijegivijegovijegošijeganjegenjegsnjegšnjegkegelegneganegenegsnegšnegosegategavegevegivegovegaćegećegućegošegacogecogucoganjogenjogsnjogšnjogkogskogškogelognogcinogčinogosogatogevitogovitogastogavogevogivogovogaćogećogućogošogahacahastajahistajahostajahinjahirahurahtahavahevahivahovahuvahačahihacihecihucihlucihanjijihenjijihsnjijihšnjijihkijihskijihškijihelijihnijihosijihatijihevitijihovitijihastijihavijihevijihivijihovijihošijihanjihenjihsnjihšnjihkihskihškihelihnihcinihčinihosihrosihatihjetihevitihovitihastihavihevihivihovihaćihećihućihačihlučihošihrošihastadohistadohostadohacuhecuhucuhaćuhećuhućuhaciaceciieciajuciirajuciurajuciastajuciistajuciostajuciavajucievajuciivajuciuvajuciujucilucujuciirujucilucinucietuciastucigiugiajicajilajirajićajičajiđajibijicijidijifijigijianjijienjijisnjijišnjijikijiskijiškijilijielijimijinijiganijimanijipanijiranijitanijipijirijisijiosijitijiatijievitijiovitijiastijiavijievijiivijiovijizijiošijižijianjienjisnjišnjikiskiškialiacaliastajaliistajaliostajaliijaliinjalinaliiraliuralitaliastaliistaliostaliavalievaliivaliovaliuvaliačalieliiliacililucilinilirosilijetilioziliačililučilirošilioliaslinuliramileminianiacaniuranitaniavanievaniivaniuvaniačaniaceniluceniačenilučeniiniciničinioniaridrierioribasigasijasikasinasitasivasiesiisiosiavsiacavsiiravsitavsietavsiastavsiistavsiostavsiivsinivsirosivsinuvsiatiacatiastajatiistajatiostajatiinjatiikatilatiiratiuratitatiastatiistatiostatiavatievatiivatiovatiuvatiačatietiitiacitilucitinitirositijetitievitiovitiačitilučitirošitiastiestiistikstiostinutiavieviajevicajevilajevirajevićajevičajeviđajeviiviovigoviugoviloviolovimovionoviiećiačećiajućiirajućiurajućiastajućiistajućiostajućiavajućievajućiivajućiuvajućiujućiirujućilučujućinućietućiastućiačilučibašigašijašikašinašitašivašiešiišiošiavšiiravšitavšietavšiastavšiistavšiostavšiačavšiivšinivširošivšinuvšiajurajtajavajevajivajuvajijacojecojucojanjijojenjijojsnjijojšnjijojkijojskijojškijojelijojnijojosijojevitijojovitijojastijojavijojevijojivijojovijojošijojanjojenjojsnjojšnjojkojskojškojalojelojnojcinojčinojosojatojevitojovitojastojavojevojivojovojaćojećojućojošojlucujirujlučujaliraluralelilamacamiramuramtamavamevamivamuvamačamemacemecemucemastademistademostademajemcajemlajemrajemastajemistajemostajemćajemčajemđajemijemanjijemenjijemsnjijemšnjijemkijemskijemškijemlijemelijemnijemrarijemsijemosijematijemevitijemovitijemotijemastijemavijemevijemivijemovijemošijemanjemenjeminjemsnjemšnjemujemlucujemirujemlučujemkemskemškemelemnemanemastanemistanemostanemenemsnemšnembasemgasemjasemkasemnasemtasemvasemesemisemosematemetemevitemovitemastemistemištemavemevemivemaćemećemućembašemgašemjašemkašemnašemtašemvašemešemišemošemimacimecimucimlucimanjijimenjijimsnjijimšnjijimkijimskijimškijimelijimnijimosijimatijimevitijimovitijimastijimavijimevijimivijimovijimošijimanjimenjimsnjimšnjimkimskimškimelimnimcinimčinimosimrosimatimjetimevitimovitimastimavimevimivimovimaćimećimućimačimlučimošimrošimacomecomucomgomlogomugombijomcijomdijomfijomgijomlijommijomnijomganijommanijompanijomranijomtanijompijomrijomsijomtijomzijomžijomanjomenjomsnjomšnjomkomskomškomalomijalomnalomelomilomozilomolomramomlemomnomanominomcinomaninomčinomonomaromdromeromorombasomgasomjasomkasomnasomtasomvasomesomisomosomatomikatomlatometomevitomovitomastomestomistomkstomostomavomevomivomovomlovommovomstvomštvomaćomećomućombašomgašomjašomkašomnašomtašomvašomešomišomošomanacaniranurantanavanevanivanuvanačanacenlucenačenlučenaninaoacaoastajaoistajaoostajaoinjaoiraouraotaoastaoistaoostaoavaoevaoivaoovaouvaoačaogougoioacioluciolioniorariosiorosiojetiootioačiolučiorošiobijocijodijofijogijolijomijonijopijorijosijotijozijožijoanjoenjosnjošnjokoskoškoaloacaloastajaloistajaloostajaloijaloinjalonaloiralouralotaloastaloistaloostaloavaloevaloivaloovalouvaloačaloeloiloacilolucilonilorosilojetiloačilolučilorošiloaslonuloamoacamoramoiramouramotamoavamoevamoivamouvamoačamoemoastademoistademoostademoastajemoistajemoostajemoijemoinjemoujemolucujemoirujemolučujemolemonemoastanemoistanemoostanemoetemoastemoimoacimolucimonimoastanimoistanimoostanimorosimoetimojetimoastimoačimolučimorošimoajmourajmotajmoastajmoistajmoostajmoavajmoevajmoivajmouvajmoijmoujmolucujmoirujmolučujmoasmoacasmoastajasmoistajasmoostajasmoinjasmoirasmourasmotasmoavasmoevasmoivasmoovasmouvasmoačasmoismoacismolucismonismorosismojetismoačismolučismorošismoastadosmoistadosmoostadosmonusmonoanoacanouranotanoavanoevanoivanouvanoačanoacenolucenoačenolučenoinocinočinoatoikatolatoetoevitoovitoastoestoistokstoostonutonuoavoevoivoovostvoštvoasacasirasurastasavasevasivasuvasesastadesistadesostadesastajesistajesostajesijesinjesujeslucujesirujesnesastanesistanesostanesetesastesisacislucisnisrosisjetisatacatastajatistajatostajatinjatiraturattatastatistatostatavatevativatirivatovatuvatačatitacitlucitrositjetitačitlučitrošitnutastaduistaduostaduguloguuguahuacahuastajahuistajahuostajahuinjahuirahuurahuavahuevahuivahuovahuuvahuačahuajucajuacajulajurajuirajuurajutajuastajuistajuostajuavajuevajuivajuuvajućajučajuačajuđajuijubijucijudijufijugijuanjijuenjijusnjijušnjijukijulijuelijumijunijuganijumanijupanijuranijutanijupijurijurarijusijuosijutijuatijuotijuavijuevijuivijuovijuzijuošijužijuanjuenjusnjušnjuujulucujuirujulučujukuskuškualuijalunalueluiluoziluoluramuacemuecemuucemuanjijemuenjijemusnjijemušnjijemukijemuskijemuškijemuelijemunijemuosijemuatijemuevitijemuovitijemuastijemuavijemuevijemuivijemuovijemuošijemuanjemuenjemusnjemušnjemukemuskemuškemulemuelemunemuanemuenemusnemušnemuosemuatemuevitemuovitemuastemuavemuevemuivemuovemuaćemuećemuućemuošemuacomuecomuucomuanjomuenjomusnjomušnjomukomuskomuškomuelomunomucinomučinomuosomuatomuevitomuovitomuastomuavomuevomuivomuovomuaćomuećomuućomuošomunuanuastanuistanuostanuinucinuaninučinuonuarudrueruorubasugasujasukasunasutasuvasuesuisuosuatuikatulatuetuevituovituastuestuistukstuostuištuavuevuivuovulovumovustvuštvubašugašujašukašunašutašuvašuešuišuošuavavevavivavuvavkovaširašuraštašavaševašivašuvašačašešastadešistadešostadešastaješistaješostaješiješinješuješiruješlučuješnešastanešistanešostanešetešastešišnišjetišačišlučišrošišaogaamaimaenaeoganogenoganihenihianienianojenojanimenimomenomoanoenoostuenuA iendoandoarerirlaselalemeseloselolasselasleslosselosnosandoiendoyendoándoiéndoareriráréríricloguenteataticaanciaenciaadoraosaistaivaanzalogíaidadableibleantementeamenteaciónuciónicoismoosoamientoimientoivoadoricasanciasenciasadorasosasistasivasanzaslogíasidadesablesiblesacionesucionesadoresantesicosismosososamientosimientosivosicadosivableibleanteicabilivyayeyanyenyeronyendoyoyasyesyaisyamosyóabaadaidaaraieraíaaríaeríairíaadedidaseieseasteisteanabanaranieraníanaríaneríaniríanenaseniesenaronieronaránerániránadoidoandoiendoarerirasabasadasidasarasierasíasaríaseríasiríasesasesiesesabaisaraisieraisíaisaríaiseríaisiríaisaseisieseisasteisisteisáiséisaréiseréisiréisadosidosamosábamosáramosiéramosíamosaríamoseríamosiríamosemosaremoseremosiremosásemosiésemosimosaráserásirásísaráeráiráaréeréiréióaeoosáéíóaeiouáéíóúA waarnaernaheternaornaadeadeandearneareasteenandenarenhetenernarerheterorsasarnasernasornasesadesandesensarenshetensernsatandethetastddgdnndtgtktttlösfulligligelsfulltlöstய்ட்ப்ட்க்ள்ன்ற்ல்ற்க்ல்ட்ட்டுத்த்ைம்ுக்ுக்க்்்்ுக்்்்்்னுங்ைம்ங்்்ந்த்ந்ந்தீைிகசடதபறகசடதபறகசடதபறயரலளழவஙஞணநனமவ்யவீுூெேைாிீுூெேைாிஎ்கஙசஞதநபமயவவோவோஓவொவொஒவுவுஉவூவூஊ்அஇஉகஙசஞதநபமயவ்ேோாும்்ுடன்ில்லைிடம்ின்றிாகிாகியென்றுுள்ளுடையுடைெனும்ல்லெனாகி்ீுூெேைாிபட்டுவிட்டுபடுவிடுபட்டதுெல்லாம்பட்டபட்டணதானபடிதானகுரியபடிபற்றினைினைைை்்ொடுோடுில்ிற்ின்மின்றுிருந்துவிடிடம்ால்ுடைாமல்ல்ுள்்கண்முன்மேல்மேற்கீழ்பின்துீிின்்கசடதபறகசடதபறீுூெேைாிீுூெேைாிுங்கள்்ற்கள்ல்ட்கள்ள்கள்கசடதபறபிவிமார்மின்னன்னான்னாள்னார்வன்னள்வள்னர்வர்னபகதயபன்பள்பர்துிற்றுபம்னம்தும்றும்கும்னென்னைவைான்சாள்ார்ேன்ாாம்ெம்ேம்ோம்கும்தும்டும்றும்ாய்னென்னிர்ீர்ீயர்்குது்படுகொண்டிர்அஆஇஈஉஊஎஏஐஒஓஔீுூெேைாிகின்ற்ாநின்ற்கிற்கின்றாநின்றகிறA @ıAöAümişmuşmışmüşditidiktikduktukdıktıkdüktükdimtimdumtumdımtımdümtümdintinduntundıntındüntündutudıtıdütüsasesakseksamsemsansenkencasınacesinesinizsunuzsınızsünüzlarlerimumımümsinsunsınsünizuzızüzdirtirdurturdırtırdürtürniznuznıznüzkicacelerilarımnmiznizmuznuzmıznızmüznüzndandenanendanndenninunınüdantandenteninunınünlaledatadeteaeadsoyııiuöüüpçtkbcdğּװִױִײכמנפצווויייךםןףץגעלטבנGEצוגנצוקטצוקנגעבנגעGEצוTSU!אדורכאהינאהעראהײמאומאונטעראיבעראנאנטאנטקעגנאנידעראפאפיראקעגנאראפארומארונטעראריבערארױסארױפארײנאװעקאױסאױפאײנבאבײדורכדערמיטנאכפארפארבײפארױספונאנדערצוצוזאמענצונױפצוריקצעדזששטרשטששפריעגײנעממײדבײטבײסװײזטרײבלײטקלײברײברײסשװײגשמײסשנײדשרײבבינדװיטשזינגטרינקצװינגשלינגבײגהײבפארלירשטײשװערטבראכגעברענגגײנעמשרײבמײדבײטבײסװײזטרײבלײטקלײברײברײסשװײגשמײסשנײדבינדװיטשזינגטרינקצװינגשלינגבײגהײבפארלירשטײשװערברענגהגשיסGETSUונגסטוטבראכטסטיסטעטשאפטהײטקײטיקײטלעכעלעכיזמימעמענעמטענעמנקליבנריבנטריבנשריבנהױבנשװיגנזונגנשלונגנצװונגנבױגנבונדנװיזנטנGEביטנGEליטנGEמיטנשניטנסטניסטנעטנGEביסנשמיסנGEריסנענגאנגענעלעננומעניזמענשטאנענטרונקנפארלױרנשװױרנװוטשנגײנסטסעטסנסטנסענסעסיעסעלעסערסענערסעטעסטעעטעיעעלעענעטענעערטערסטערעטערענערטענערותקליבריבטריבשריבהױבשװיגגאנגזונגשלונגצװונגבױגבונדװיזביטליטמיטשניטנומשטאנביסשמיסריסטרונקפארלױרשװױרװוטשונגשאפטהײטקײטיקײטליגיקדיקנדיקענדיקבליקגליקניקיש|Ho O 8u2 !"#$%&'()@*+,_-./ 012 3456789:;<=>|?@ABCDHEFGoHIJOKLM8NOPuQRSTUVWXY,Z[\]^_`ab2cdefghijk%lmnopqrstuvwxyz{|}~@_WgO W[`ejpu{ ! '*$',-,3,9<0@0D0HMRWY7]7b7hlps=wz~@CCCFJLMLLTVZ^cd dchh %JMQUZ_diouz ##( *,,",'+0005;AGLPSW\bd<h< m<p<s<v|HHJJJHNHHHHSSUW[[^`` f f$(,/1l4m8m=mBmFqKmPlTlXl\l_leljlmo{rt}w~{}~  $&+-159=@BFKPUZ]`dhloquwz} #(+148@CEIKN SW[^behjmpsv|~ """%          # % ' * D F I M O Q T V Y [ ^ ` c e g i k m o r t x z }            !   $                         " % ) . 3 6 9 = A E H K N R $Y $` c 'h k p r +w z }    1 1  4 4 4                   I    M M M M M   T  " % X+ . 2 6 < B H M S X ] b g n r gw g|  j k   n    r s         | |         ! % * , / 3 6 < D H M S W [ ` e h k o t y |                                      % ) * , / 3 6 : > B E H K N P T X [ _ b g j m p t v z ~                      * * * * * * * * * * * * * 7 7  !#%B)B.B2B7B;B>HCHHHMOLRMWM\L`LdLhLlLpLtLyL~LLLLLLLLL`LLddfffffdd  y}!#(*.048<@EHMRWZ\`dhlqty~#(-38=@EJORVZ^djqv} !(-27<@DILQTY^chmrw|~ !$)-.37=@DGI N RT Y ]^bdipty}479;@DGILPT]_acWY[gh     $*17>EOQTW[`egikmoqsuwy{        $ 6;@EJNT[^bdhlptwz}  #%(+.78;=@BEHKNQTU X [ _ b f i m p s vwz|  -03cgmquz~     "# " !"' *' .147:=@CEGKMPRV]^bdhkot|    "%(-17>CGILQTY`ekprt w!|!    #'+-157?@ABCGJMPSU[]_adgkoruy}    "&)-0 49 ?BX`glt z     "&),0VXYZ[\^`djnrvx|        "(,16;AGMRUY^dh kosv|    #'*-047<AFINSV\beimquy}66::::AAA!A&.6<BHKNQTWZ\^adg              # & * . ? @ C G M O R U W Y [ ] _ a c e g i k                     ! !!!!!"!&!(!,!0!4!8!;!>!A!D!F!I!L!N!Q!T!W![!`!f!g!!!!!! !!!!!!!!! !!!!!!!!!!!!"" " """"#"'"-"3"8">"D"H"M"Q"X"_"c"e"g"i"k"o"s"w"y"}""""""""""""""""""""""""""""""""""""## # #####"#'#)#+#-#/#/3#/7#/:#2?#2D#2I#/M#/Q#/U#/Y#[#:`#:e#:j#:n#:r#:v#:{#:#:#:#:#:##G#G#I#I#I#I#I#I#I#I#I#I#I#T#T#T####Z#Z#Z$Z $Z$_$_$_%$)$c/$c5$c;$cB$cI$cP$T$Y$^$c$g$k$o$s$u$w$y$|$$$$$$$$$$$$$$$$$$$$$$$$$$$ $$$$$$%%%% % %%%$%)%.%1%5% 8%<%A%E%I%M%Q%V% \%a%f%i%m%p%w%~% %%%%%%%% %%%%%%%%%%%%%%% %%&&& & &&&&&&& &#&(&-&/&2&5&9&>&@&C&F&I&L&P&R&V&Z&^&`&b&d&g&k&o&s&u&y&}&&&&&&&&&&&&&&&&&&&&&&'&'&'&'&'&'&-&-&-&&1&1&'' ''7'7'7#'('.'4':'='@'@E'@J'@O'S'W'['Fa'Fg'Fn'Fs'Jz'J'J''N'N'N'N'N'''''''''''''''''''''''''(( (((((( ($(((+(/(1( 6( :( ?(B(D(F(K(M(N(P(U(Z(_(a(e(j(m(r(x(|(~((((((((((((((((((((((((((((((((((((((((((())) ) )))))))))!)$)&))),)/)2)5)8);)>)@)A)C)F)H)K)Q)S)U)Y)\)])_)a)e) k) q) w)y)|)~))))))))))))))))))))))))))))))))))))))))) )) ) ) ) )*** * **********!*#*&***-*1*4*7*8*:*=*?* B*D*F*J*O*U*Z*\*_*c*f*j*m*p*s*w*|****** ***#*$*#*&*#*#*************++ + ++++++ +A,D,I,N,R,U,X,\,`,c,f,h,k,p,u,y,},,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,-- ------9+>+C+H+M+R+X+^+d+j+p+ w+ +++++++++++ +++++++++ +, ,,,#,,!,%,),-,2,7,<, -"-$-'-*---0-3-6-9-<->- A- E- H- K- N-R-V-Y-[-^-a-d-h-l-n-q-t-x-}----------&-&--------------------6-6--9-9.9.9 .9....A.A.C#.C*.C0.C6.C<.A@.AD.AH.J.LM.LP.T.X.Z._.b.f.Tk.Tq.Tv.T{.T.........................//// /.......................... //////// /#/&/ */ ./0/ 3/ 6/7/9/;//@/B/D/F/G/I/K/N/Q/S/V/Y/[/ ^/`/"c/e/g/i/k/'n/'q/t/w/y/,|/}/////////// / / / ///////////////////////////////H0J0L0N0P0R0T0V0X0Z0\0^0`0b0d0f0h0 j0 l0 n0 q0t0w0 z0 }00000000000000000000000000000000000000000000111 1 11111 1 1 "1 %1!(1!+1!.1!11"41"71":1"=1#@1#C1#F1#I1$L1$O1$R1$U1%X1%[1%^1%a1&d1&g1&j1&m1'p1's1'v1'y1(|1(1(1(1)1)1)1)1*1*1*1*1+1+1+1+1,1,1,1,1-1-1.1.1/1/1/1/1313111112121010111111112 222222!2%2)2+2-23272;2=2?2E2I2M2O2Q2U2Y2]2_2a2g2m2q2u2w2y2{222222222222222222222222222 3 3 33333333"3&3,3.34383 @3J3 P3Z3b3h3l3p3t3z3|333333333333333333 3 4" 444% 4&(4%.4% 24)>4)D4%H4, P4-Z4%h4l4z44444 454444444 444 4 4 444 5  5555$5 ,565>5 F5P5V5 ^5 h5 t5 ~5 555555555"55$ 5$5$5$55)5)5+ 5,6)6) 6/ 6/(6).62662 >64H6N6T67\6`69f6: n6x66 6>6666B6B6666 6666666777 7 "7*7.747<7D7J7N7R7Z7`7f7l7t7|7777777 7 777 7777777777788888*8.868<8D8L8R8V8\8{88888888888888 8888888888888899 99999!"9&9*9.92959'99?9B9*H9K9,Q9,W9,]9`90d90h90l9q9v9{9}9797979999=999@999C9C9C9F9999J99L9M9L9L99999T99V::: :Z ::::^:::$:&:c):d/:d3:c9:;:h@:hD:I:n:q:u:y:~:::::::: ::::::::::::::::::::;;;;;#;# ;%;);,;(1;4;*8;<;,A;,F;,K;O;0T;0Y;_;e;k;p;t;w;{;;;;<;< ;<;<;<;;;;;;;;H;H;J;J;J;H;N;H;H;H;H;S;S;U;<W< <<<[<[<<^#<'<`,<`1<5<9<=<@<fD<fH<L<P<T<V<lY<m]<mb<mg<mk<qp<mu<ly<l}<l<l<l<l<l<<{<<}<~<}<<<<<<<<<<<<<<<<<<<<<== =====!=%='=+=0=4=7=;===B=E=I=K=P=R=V=Z=^=b=e=g=k=p=u=z=====================================>> > >>>>>>#>(>->1>6>8>;>>>@>E>I>N>Q>W>Z>^>f>i>k>o>q>t> y>}>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>? ??" ?" ?"?%??? ?#?'?+?/?3?5?7?9? >? A? F? J?L?N?Q?t?v?y?}????????? ???????????????????????!???$???????@@ @@@ @ @%@,@0@4@:@=@ D@M@P@S@V@[@^@b@g@l@o@r@v@z@~@@@@@$@$@@'@@@@+@@@@@@1@1@@4@4@4@@@@@@@@AAAA AAAAA$A*AI2A6AAMDAMHAMLAMPAMUAXAZAT]A`AeAhAXoArAvAzAAAAAAAAAAAAgAgAAj AkAAAnAAAArAsB BBBBB B$B)B|1B|9B >BGBKBQB XBbBfBkBpBtByB{B~BBB BBBBBBBBBBBBBBBBB BBBBBBCC C CCCCCC"C&C)C-C4C:CBCGCICLCOCSCWC\CcCeCjCpCvCzCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCDD DDDDDD D"D$D*(D*,D*1D*6D*IBIDIIIPITIYI]I`IfIkInIqIvIxI|I~IIIIIIIIIIIIIIIIIIJJJJ J$J'J)J,J0J4J=J?JAJCJ7J9J;JGJHJrJwJ|JJJJ JJJJJJ J JJJJJJJJJJJJJJJJJJJK KKKK%K/K1K4K7K;K@KEKGKIKKKMKOKQKSKUKWKYK[KKKK KK KKK KK KKK K KKKKKKKK K L LL L%L*L.L4L;L>LBLDLHLLLPLTLWLZL]L`LbLeLhLjLmLpLsLwL|L}LLLLLLLLLLLLLLLLLLLLLLLLLLMM M MMMMM(M)M,M.M1M3M6M9MQ@QCQGQKQMQQQUQWQ_Q`QaQcQeQQQQQQ QQQQQQQQQQQQQQQQQQ Q Q Q Q QQQQQQQQQQQQ QQQQQ Q@R PR VR `R jRR R RRRR R RR S S0S@S RS ZS fS rSS S S SS S SS S S TT0T BTNT \TpTTT TTT T TT T T T TT U UUUUU U&U ,U 8U BULURUXU fU rU~UU UU U UUUU UUUUUUUU V VV *V4VBV PV\V^V`VdVhVlVpVtVVVV V V VVVVVVV WW W W,W4W BWNWRW  XW dWjWnWtW zWW W WWWW WWWWWW WW W X XX "X ,X8X >X JXVX^X lXxX|X XXX X X  X  X XXX X X Y Y Y Y(Y0Y 8Y BYLYTYVY\Y`YfYlYpYvYzYYY YY YY YYYYYYYYYYYY YYYYYZZZZZZ$"Z(Z Z Z Z Z ZZZ ZZ [ [[ [ 0[:[H[`[p[ [ [[ [[ [[ \ \\\ 2\ <\F\N\ V\b\ h\ r\|\ ~\\\\\ \\\\\ \ \  \\\\ \\\\\]]"]*],]0]2] 6]@]F]J]P]X]^]d] h]t]|]] ]]]]]] ]]]]]]] ] ^ ^^$^,^.^2^4^ :^D^L^V^^^ f^p^ v^ ^ ^ ^^^^^^^ ^^^^^^^^ ^ _____ _(_,_2_ 6_B_J_ N_X_^_b_l_r_x_z________________ _____` ``"` (`4`<` @`  J`  T`^`d` l` x````````````` `` ` $a 0a :a DaNa\ada lava|a~aaaaaaa a aaa b b b $b 0b :bDb RbVbZb\b`bnbbbb b bbb b b  b bbbcc ccc&c.ceBeI JeTeXeL `eL leLve|eeQeQ eQ ee eeeX eXeXfXf f] BfLfRfXf^fdfhfnftfzf~fff ffffffffffffffffffg ggg g&g.g6ghLhPhVhXh\h jhthvhxh h h hhhhhhhh hhh hhi i i(i0i8i @iJi Ri \ihinitizi iii ii iiiiiiiij jjj j (j4j :jFjLjTjVjXj\jdjvj~jjj jj jj jjjjjjjjk kkk k&k,k0k8k:k@k HkRkZkpkk kkkkkk k  k k kk k k l l l l(l0l8l@lHl PlZl `ljlnltl|l lll&l l(l l*ll llll lllm mm "m .m:m@m`mrmxmzmm m m mmmmmm m mn nnnn"n&n.n6n:n @nJnNnPn TnVn \n `n fn hn rn~n nnnn nnnnn n o o o(o 6o >o"JoLoNo%Vo% ^o'ho%po% xo* o%o, o% o%o% o%o%o%o3o3o3o%o o8 o8 p: p8 p8 "p=.p2p?:p >pAPpB`pCrpAzpApFpApH pApJ pA pLpA pNqA qA qQq q*q2q:q BqLqTq\qdq gq sq qqq qqq q q q q q r r r'r -r 6r ?rHr NrWr]r cror~r rrr r r r rr r# r#rr r' r's s*s+&s+ 5s*As Gs/ Ps/ Ys/ bs/ ks3ws4 s3s6s s8 s8 s8 s8 s<s= s<s?t tAtB"tB 1tA=t@tCtFtIt LtJ XtJdtLstL tJ tJ tP tPtJ tS tS tStJ tW tW tWtt[t[tuuu u ubub ud !ud*ub0ub6u9ui?uiEu Kul Tul ]ulfu iup uupurur up up uv uvup uy uy uyup u} u} v} vp vpvSvUvXvZv\v^v`vbvdvfvhvjvlvnvpvrvtvvvxvzv|v~vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvw w w wwww"w%w)w,w1w3w7w:w=wGwKwPwVw[wawhwjwnwqwvw{w}wwwwwwwwwwwwwwwwwww ww w w w wwwwwwwwwwwwwwwwwwwwxx x xxxx xxx x%x+x1x3x6x:x=xAxExIxLxPxUxYx^xcxhxmx sxyx{x#~x$x#x&x#x#xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxyyyyyyyy!y#y %y'y)y+y-y/y1y 3y5y7y9y;y=y?y Aydykysyvyzy}yyyyyyy yy yy yyyyy yyyyyz z zz z'z /z8z>zCzGzNz Sz ^zhzvzzzzzzzzzzzzzzzzzzzzzzzzzzz{{ {{{{ { { #{ '{ +{ /{1{3{7{={A{E{I{L{N{P{R{T{V{Z{`{d{h{l{p{t{v{x{{{{{{ {{{{{{{{{{{{{{{{{{ {{{{|| |||||%|*|-|1|7|=|A| D|G|K|N|T|Z| ]|a|f|k|p|r|v|x|z||||||||||||||||||||||||||||||||||||}} } }}}}}"}%}(},}0}4}8}<}A}F}K}P}U}[}_}c}6i}6o}s}v}:|}:}:}:}}}}A}A}A}A}}}}}}}}}}}}}}}}}~~n~s~y~~~~~~~~~~~~~~~~~~~~~ ~ ~ ~ ~ ~ ~~ ~~~ ~ ~~     !&+ / 2#6 9%=%A D H L*ST,V-Y.^,`0e,g,j3o,r5v,x7{87:;7==?=7BBDE7GH777L,NNNQQSNUNNX XX,\] "%&(b+.0e358;iACElHJnMPQqSrWq[q]^v`wcveyhvj{m|q{w{{{{{{{{vvvvvvŀvȀvʀ̀ЀԀv׀vـ܀vvv  ',28= CLvOvRvVX[]`beklnqvx| āǁʁ ΁ЁӁցہ  !##% '$')+.58-<.ADF1I2MORWZ]_bhj<px ~    Ђ !$'KNQ T ] f r ~     Ƀ҃؃ރ       # / 8 DP V _h n w   # # & & ń( ф& ڄ& , , ,  0 "0.2 =0 I0 U a m y :    > Dž>Ӆ@ > >  D G!G 'I0J?G NG ZGfGlG r {Q  S S V V  ̆   ! &')+/48?BHKNPSVY[]`dfilpsvz~       % */ 6:> E L W\afkorvx|   $),039?BHNRV]c gmqvz~‰ĉȉ̉щӉ׉ى܉߉  !$).37;?CEIMQV[`cfjnrw|///222////:::Ċ:Ȋ:̊:Њ:Պ:ڊ:ߊ:::GGIIII IIII%I,I2I7T>TETLPTXZ_ZfZmZtZz___ccccccċɋ΋Ӌ؋݋ CEJMPUX[_bfhlnrvƍʍ͍ЍҍՍڍߍ  %(,038;@DKOSVZ\^`cfhjntzČˌ Ҍ ی  &-27< CL S \ gptx#~   Ď ǎ ˎЎ֎َێގ !%*-1&6&;?CJ R, [, e, n, w,6699999@Ə@̏BӏBۏBBB@@@L L !&T,T3T9T?TFJNSXYZ\]ab q { 37=CEIOSŐːϐӐאېߐ #'-[_cimqw{  Ǒ͑ӑۑ   &(#()-+3+9;?EIKMOSWY ] acgkmquw{ ÒŒ˒ْߒ " $ & (*,.02468:<>@BD FHJL%I) .3 8U=BRGSLTQKULYQ]PaOejRn7sx}N:;<=>6CWŕ˕:ѕ>וJݕDEFV5  ! %U)1 .2R6S:T>KALDQGPJOMQXUTY]*a4e3jYnry~B:<>J79:;<Ö=ǖ>˖6Ж8ՖWٖAޖM?(!%'& $"# !%[) -27/;2A1F K,Q+W.\-a)e@kZpvD{EFV0HG|}~|}~TUz V_ Ǚ ϙS֙ ܙ{x \ ]^M NOP [(T.U4z:VA_EJPSU Y" ^"Wc"h"Xn{sxx\]^MNOP[|}š~ǚT͚UӚzٚV_;;>S @@Y {x\]!^'M,N1O6P;AGM[SVmYQ]QaQeQjQoQt x!|"('TUzV_aadS% g Ǜg͛gӛgٛgߛ)*np{,rxr\r] rr^MN"O'P,-0[6&;T?UCzGVL_NQUhX]jekmlu/zr.diqnopa`bLcfÜSƜtɜ|ΜyԜg؜nopv0euZ2s  $*/m4:@FMT[ a!g"m(s'y#%$ )*+ŝ,˝-ѝ&؝hݝ/.wt43  Y456 7%8*06<BHNTY^FcGiHoIuJ{MNO?@=><;ABCǞ3˞|О}՞~ڞmߞ  !"('$T,U4z <VE_KRZ#`Sg%m s  {    )*+{,x \ ʟ]ӟ^۟MNOP-[& TUzV%_)%.%4h9(/@(.FSKtP,0W2\3b f0 k0 p2v2Y}0 56789Š:ʠ{ϠxԠDD۠DEF\]^GHI JKMN#Qm*R2R:R BR KR TR]ObPgZm[tZRz]1ZQZ ?@=¡>ɡ<С;סAޡBC[ p qqiqqqaq` qbqcqfp|"py(pe.pu5p 8~<~ A~YFp I5L6O7R8UY]aeimq9t:w{zx}DEF\]^GHIJ KMNmǢ͢ԢۢOPR1Q  ?@"='>,<1;6A;B?CC[G|J}M~PyTnZo`pfhlohrvz~jklt !"('TU£zȣVϣ_ӣأޣ#S%   )*+{,"x'\.]5^;M@NEOJPO-S[Y&^TbUfzjVoryxd}u_hjkl/r.diƤqʤ nФ o֤ pܤa`bLcfSt|y gv0!e'u.Z528s< @4D3H|M}R~WT]UcziVp_t.y.S 22Y{x\]^MNO¥Pǥͥӥ٥[ߥ B CCiCqFnFoFpCa C`CbCcCfB|#By)Be/Bu6B 9S=S BSYGB J5M6P7S8VY\]\b\f\j`r`z``\\\\\\jjjjj9:q|Ʀqy̦qҦqئ{ۦvvvhzzDzEzd zizqzaz`zb!zc&zf,F/n7o?pGjOkWl_tdrjoywd ~u nopst|y nço˧pӧ٧vߧs\]euZhi qjk l'a-`3b9c?tCyJdPuX^\ bj kk tl}rdiqa`bLcfGH¨|ȨyϨgԨۨveuZIJ n o p !K&M)N,m17=CJQXO[P^bgRk1pQt y}euh?@= j k lré>ȩ<ͩdөi٩;ީAa`bLcfB Cveu&Z.[ 2n ;o DpM|Q}U~YT`UgznVv_{S {x\]^MNªOȪPΪ[ժTڪUߪzV_S % %W%%X{ x MNOP"',[1|5}9~=TBUGzLVR_U;Y;^Sb e?j?Yp{txx\~]^MNOP[hOOjOkOlȫOrͫOdѫOiիOqثOaܫO`ObOLOcOft^|^}^~ay^T ^U^z^V!^_&g,g3^S9^ >^{D^xJ^\R^]Z^^a^Mg^Nm^Os^Py^[^T^U^z^V^_zz^S^ ~~Y^{^x^vŬ^\ˬ^]Ѭ^^֬^Mڬ^Nެ^O^P^^^^e^u^[Z nop |$}(~,16;|>|CGLSZbjryyymŭɭέӭح ܭ!"('TUzV_ #S%! % +17=C)G*K+O{T,Xx]\d]k^qMvN{OP-[&TUzV_hjkƮlή/Ӯrٮ.ݮdiqnopa`b LcfSt"|'y-g17v=0BeHuOZV2Ys] a4e3i k  n s ix q| a ` b c f | y e u  Y  56ï7Ư8ɯͯѯկٯݯ{))), ,,,"1'1.3h65;5jC5kK5lS5rY5D^5Eb5dg5il5qp?nv?o|?p5a5`5b5L5c5fFtJ|JyJgJJv°J\ǰJ]̰JeҰJuٰJZ^GHIJ MN\m] ]]]]#]*O-P0e4f9eR=h1BeQFe KtPeWh]ndeni mnj vnk nlnan`nbncxd xu űF˱sұeֱu۱?@=><;ABC[ hdqF#n+o3p;fCtHg NZW ]h_icqfaj`nbrcvtx||}~TUzV_S {IJ\̲]Բ^۲MNOP[TUz V_hS# &+Y1{5x9\?]E^JMNNROVPZ_di[nysdwu}hdiwthdiqa`bcfw|}~nƳoͳpԳhسݳjkltTU {'V/_4:AFSL QX]{cxi\q]y^MNOP[TUrzVô yʴ dд uش_۴ߴS  nopW X %*/48<{@xDFH\N]T^Y^KdMhNlOpuz?@=><;ABC[t=|=}µ=~Ƶ@y˵=Tҵ=Uٵ=z=V=_FF=S= ={ =x=\=]!=^(=M.=N4=O:=P@=[G=TL=UQ=zV=V\=__YcYh=Sl= o]t]Yz={~`=x=v=\=]=^=M=N=O=P====e=uǶ=[̶pZҶ|ֶ}ڶ~޶uu !"('#% $  '.5):*?+D,I-N&TTYU^zcVi_lpuhy/.St0243    Y 5ķ6ȷ7̷8зշڷ߷9:{xD EF\]^#G(H-I2J7M;N?OCPGRLQQV\afk?q@w=}><;ABC[hdiqa`bcŸfʸ|θyӸeظu޸ hjklrdi q nopa `$b(L,c0f57:t<|@yEHgKPSXv]aefulZr v!z"~('#%$)*+,-&TUzV_Źhȹ͹jչkݹl/r.diqnopa`b#L(c-f3S6t9*|>*yD*gH*N*vT*eZ*ua*Zhsl phs5x54|7d7i5q5a5`5b5c5fw@n@o@p@jǺ@kϺ@l׺@tܺ@r@IyId Iu@3@ NnNoNp@F$@s*t-T|2Ty8T <WnDWoLWpTTZTF_\veTskTeqTuxTZhbibqdjdkdlbab`bbbctûmyʻmdлmuػhܻq qj qk qlqrqd qiqqqaq`!qb'qL-qc3qf:t>|DyKgPWv^eeumZ un ~o p  hiqa`bcf¼|ǼyͼeӼuڼ ݼYxDEF\]^GH IJ  MN O#P&*/159=@DHLPRY`gnu|y|y½ŽʽϽhѽսjܽklrdiqnop a `bdLc#f(t*|.y38v=eBuHZN QnWo]pceilhotj|klrdia`bLcfh¾Ǿ˾ϾdԾiپqݾ j k la`bc ft !#"'(+'/T5U;zAVH_LP SU%Y ]# c#i#o#u#{)**,{,.x.MNOP-[&ÿTǿU˿zϿVԿ׿<yݿ<d<u_@@hC/C.StG0 2 4|}~T'U/z 7V@_FRMRUS\ b{ix p\ y]^MNOP[TUzV_ee3hS j jWjjX{x\ ]^MN O%P*06<[B|G}L~QTWU]zcVj_nsyS~ Y{x\]^MNOP[  nop  Y 56 7 8 $(,9/:2{5x8D=EAFD\I]N^RGVHZI^JbKgMjNmOpPsRwQ{?@=><;ABC[a`bc_hdiqa`bcfwnop jkl$t)r/4d ;uD HnPoXp`Fesktngrvxe~uZ      # (+/49>DFHJMPadinsvz }     %).2:B FHJLNRVZ\`bdfilqvx{~   '$'(','0'5'9-?-E-KM1Q1V[`fk7r7y7@@@FFFFJJJNNNNN$),048<@DGHIJLNPRY[]_a      !$',  !$'*-0369<?BEHKNQTWZ]`cfilorux~ #&),/258;ADG  0 B K`    #&),/258;>ADGJMPSVY\_beh 0 EQ` r !$(,047:=@DHLPSVY\`dhlnpsvy|~ #&)-15Z]`bdhlnpsvy| (2:BJ P \fjp ~     $ .@PT# b# l#vzGMS U_c!imu{           % - 1 ; E OY_$g m w  ** * * *   5658 85;;%5 +>57@;AAAG@K@Q@WF_cHiIqIyH L       ! ) / 9EMU[ciowy} asmdylink.0@"``````envcheck_encoding_conversion_argsenvreport_invalid_encodingenvpg_encoding_verifymbcharenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_func'pg_finfo_euc_jis_2004_to_shift_jis_2004'pg_finfo_shift_jis_2004_to_euc_jis_2004euc_jis_2004_to_shift_jis_2004shift_jis_2004_to_euc_jis_2004  # #A8j #AIA A!jAqA O A jAv: AqE  AjAqA>K   Ak: Aj   A  A jAqAM@  Ak: Aj  @ Aj! A   Ak: Aj   A  A   : Aj! Aq@ AjAqA>M@  Ak:  A jAqAM@  Ak:   A   Ak: Aj !  k! j ! AJ A: k   (K AG A:  :  AG  Aq! -"!@@@ AF AK A@j"A>M@ A?k!A!  @ AHA AjAqAK  Ak!A ! AN   A)   @ ApqA`F@ A@j"A>M@ A?k!A!  @ AHA AjAqAK  Ak!A ! AN   A)   @ A|qApF@ A@j"A>M@ A?k!A!  @ AHA AjAqAK  Ak!A ! AN   A)   @ A jAqAM@ A@j"A>M@ A?k!A!  @ AHA AjAqAK  Ak!A ! AN   A)    A)   AtF@A   At kAk  @@@@ Ak AA   AA   A A   AA  ! A: Aj!  At jAk!  At jAk!  Ak:  Ak: Aj!  j! k "AJ A:  k F# @8d @PostgreSQLasmdylink.0@"``````envcheck_encoding_conversion_argsenvreport_invalid_encodingenvreport_untranslatable_charenv __memory_baseenvmemoryw__wasm_call_ctors Pg_magic_funcpg_finfo_euc_cn_to_micpg_finfo_mic_to_euc_cn euc_cn_to_mic mic_to_euc_cn  # #A8j #AM@ A:  : Aj!  #! -" Atr"AkAM@ Aj!A!A!@ Aq F@ /"Aq! Av! #Aj Aj"Atj"/"AG AL@ AA AK" j AIj:  AtAq rAj: Aj!  AG AIqE AkAKqE@ A; Aj!  AkA M@ AA AK" j AIj:  AtA"jAq rAj: Aj!  AkA M@ A: AA AK" j AIj:  AtAjAq rAj: Aj!  #!A! AI Aj!A!@@ AqG ("AN@ A:  Ar:  AvAr: Aj!   Ar:  AvAr: Aj! #Aj Aj"Atj"/"AG  k!  j ! AJ A:  k  (M@ A:A!  : Aj  AH@@@ AF AG AIqE@ A jAqAK  ,"A}H  A@jAqA?I  A#   #! Aq" Atr"AkAM@ Aj!A!A!@ F@ /"Aq! Av! #Aj Aj"Atj"/"AG AL@ A:A! AA AJ" j AHj:  AtAq rAj:  AG AIqE AkAKqE@ A;A! A:  AkA M@ A:A! AA AJ" j AHj:  AtA"jAq rAj:  AkA M@ A:A! AA AJ" j AHj:  AtAjAq rAj:  #!A!A~!A! AI  Aj!A!@ Aq F@  ("Ar:  AvAr: AA AJ: Aj! #Aj Aj"Atj"/"AG  E@ A#    :A! Aj !A!  Aj!A~!  j!  j"AJ A:  k   (Jj   Aj " Ak  "jAu!  N  A Aq  Aq!@@@@@@@@@@@@ Ak @@ Ak #! Ak   #! A͈L@ AF  AF  AG /! AϞL@ AΈF  AܖG #/! AОF  AʠG #/! #AjA ! #AjA/ !  #/!  #/!  #/!  #/!  #Aj!  #Aj!  AG #A j! /! Aq #Aj #Aj #Aj #Aj #Aj #Aj #Aj  (j6#Aj#Aj6#Aj#A4j6#Aj#Aj6#Aj#A5j6#Aj#Aj6#AЂj#A-j6#AԂj#Aj6#A؂j#A6j6#Aj#A.j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A3j6#Aj#Aj6#Aj#A4j6#Aj#Aj6#Aȃj#Aj6#Ãj#Aj6#A؃j#Aj6#A܃j#Aj6#Aj#A j6#Aj#Aj6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A-j6#AĄj#Aj6#AЄj#A-j6#AԄj#Aj6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#Aj6#Aj#A4j6#Aj#Aj6#Aj#A4j6#Aj#Aj6#Aj#A3j6#Aȅj#A4j6#A̅j#Aj6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#A5j6#Aj#A6j6#Aj#Aj6#Aj#A*j6#Aj#A*j6#AĆj#Aj6#A؆j#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A9j6#Aj#Aj6#Aj#A6j6#Aj#A  B > Aj#Aj Aj@@@@ -AF@ Aj#"Aj  (6` Aj Aj Aj ("@  6P Aj#Aj Aj @ - AG (A H Aj#Aj @ ($E (A H  ($6@ Aj#Aj A@k (! (! Aj@ E (AL  ( ((" "E  Aj   (AH A!@ ( Atj((! AjA,   "E  Aj   Aj" (H ("E  (  "E@AA@A   (6#"Aj Aj  AjA A,j #Aj  60 Aj#Aj A0j   @ -AG (AH Aj#Aj AjA)   (6p Aj#Aj Aj ( (! ( "AF@   !  AF AA@A   (6 #"Aj A j  AjA A,j #Aj (  Aj$ AG AA@A   (6#"Aj   AjA A,j #Aj #A@j"$@ (AAJ@ (E  AA@A0   (6#"Aj   AjA A,j #Aj A6@@@ ("AF@ AN@ AF  AA@A #"A,jA  AjA A,j #Aj AG   (E AA@A0   (60#"Aj A0j  AjA A,j #Aj  AA6  (! AG@AA@A   (6 #"Aj A j  AjA A,j #Aj  (@AA@A   (6#"Aj Aj  AjA A,j #Aj A@k$ C@@ E #(A# AA0Aq@#(  A  #A@j"$ ( A6@@ ( Aj"A" (E@AA@A0   (6#"Aj   AjA A/j #Aj ( A"  (6A!  AF@ ("AF@ A! ("E   (AF AA@A   (6#"Aj Aj  AjA A/j #Aj ! A! AF AA@A   (6 #"Aj A j  AjA A/j #Aj A~L@AA@A   (60#"Aj A0j  AjA A/j #Aj  (6 A@k$  }#Ak"$@ (  AJ@ (E  AA@A0   (6#"Aj   AjA A>j #Aj Aj$ #A0k"$ (! A j  6 A j#Aj Aj @ A j#Aj @ -AF@ A j#Aj@@@@@@ A N@ A jA(      @ A j#Aj A jA  @ A j#Aj A jA   A j#"Aj A j Aj E  A j#"Aj A j Aj AI@ A j#Aj Atj( A jA)  A j#Aj  A j#Aj  A j#Aj  A N@ A j#Aj  A j#Aj ( ( ! (  AG@ AA@A   (6  6#"Aj   AjA Aj #Aj @ #A AA)7 A! AAE@ AA!  A0j$ #A0k"$ A j ! A/A2 #"j6  6 A j Aj Aj ( ( ! (  AG@AA@A   (6  6#"Aj   AjA Aj #Aj  A0j$ ( #A4k"$#!A! (E@AA@A #"A#jA  AjA Aj #Aj @@@@@@@@@ ( "  A6  "G@AA@A #"A2jA   6  6 Aj   AjA Aj #Aj A! AA#( 6  !"6 AJ@ ( Aj"    Atj(AA" " G (  #! E A!#(#AjAAA$! AJ@ AL! @#"(! 6A! E@@A! Aj Atj        6 Aj" G  Aj%! ( &# 6 '  Aj"J (  A6  A6  A6  A6  A6 #Aj6  A6 #A;j6  A6  (6 A"E  -AjA?q -AjA?qAtr -AjA?qA tr -AjA?qAtr -AjA?qAtr6  A4j$   ( (  #Ak"$@AA)"E@A!   6 B7  *"6 @ E @@@@  A j+Aj *"    ( !  6  A! Aj$  #Ak"$ (! A6 A6 A6@@@@@ ("@ E@ #AjA   G@ #AjA  Ak @ (#A! ( A j$ @"E E@ #AjA  (AF@ #A)jA  A: E E  (6  (6  A6 A6 AA)"6@ E ( (Alj"(! ( ! (! ("@  *"6 E  @  *"6 E  @  *"6 E  @  *"6 E  AA)"6 E Aj AjA  /6 A6  A6 #AjA  U@ E @@ (Ak #A#jA A6A E !  M@ E @@ (Ak #A#jA A6A !  m (AG@  "E@A @ AH@?(E  A6A #AjA A6A A6 AjA       '  A6 A6 A6 A;   @ E (AF A."E  AjA  (6 (! B7  6 Aj"B7 Aj"A6@ ("@  Aj #AjE  (<"@  Aj #A jE  (@"@   #A5jE  (D"@  Aj #A*jE  (H"E@    #AjE   A   #A0k"$?"(!@ E@ #Aj @  @ /AAA"AF@ #Aj @  @ /AF (E A6 @@ (  B.7  ("At AqAtr AvAq Avrr6(  ("At AqAtr AvAq Avrr6,@  A jAAAF@@  A jAAAH@ (AF  BA!  (AF #Aj @  kAk" AN@ (! A: Aj!@ " Ak" A oA0j: A J! A n!  Ak"#Aj"(6 /;  C" jA ; AF B  6 A0j$   E@A @ (AF@ (#Aj (@  ! (! (! E@ #Aj @    !  E A (! A6 6A  @#AjD #AjE  ("AG@ B A6 @ A6 B7 A6 ("@@ (! (  " B7 ("@@ (! (  " A6 ("@  ((  A6 &@  "E (AF    ~#Ak" $@"E Aj! @@ E@  ("E @  Atj(!@ #A3j E @ #AjA FE #AjA FE A= A!   A"E   Aj"Atj(" A! #!@A ."@ Aj! !@  )7  (6  )7  )7 Aj! A(j"(@  )7  (6  )7  )7  )P78 A@k )X7  )`7H  (h6P  )x7T  )7\  )7d  (6l Aj! Aj!  AqE A8j MqE@ B7 A6 B7 B7 ("@@@  Atj("E -E @ "("@@  E  Aj"(" 6 #Aj  (@ !@ (  Aj"(  E  (E  !@ (  Aj"(  @@ #A3j E ! ("E @@ ( E A! ("E @  @  Aj"Alj("    AljA j"(  ( *"6  #AjA (@ !@ (  Aj"(  (E  !@ (  Aj"(  Aj"(" "(E @ (  Aj"(  (   *"6   #AjA (@ !@ (  Aj"(  E  (E  !@ (  Aj"(  A! Aj" Atj(" @ (@ !@ (  Aj"(  #!  @ Aj! A=j!@@@@@ ) " BS "("E @  @ Aj"("   ( "E  j"(  *"6 E  A(j"(" (@ !@ (  Aj"(  E  -AG G  #Aj  #AjA (@ !@ (  Aj"(   A6 A6 B7 -E@ A6 A; A6 (AF@ A6 AF  A A6  (@ !@ (  Aj"( !  #AjA E  (E !@ (  Aj"(  A6 Aj$  ~#Ak"$ A6 @ E (AF @ ( "@  A j #AjE  ( ! B=~!A~!B!A! AL!A~!@@ AF   (F@ ( F   |! (! (! A!@@@@  H AA "AF   AA "AF  AF@ A6 A: -AF@ !  !  A6A! Aj$  A."E@A @ AqE@ AjO  AA  AA A6 B7 A 6 B7 A: A6 A; A6 B7 A6 A6 A6 #"Aj6 Aj6A.! A6 6A.! A 6 6 A.6 Aj Aj@ (E (E (E (E (E  A  #Ak" $@@@@ #AjA F@ #AjA F  #!A ."@ Aj! !@  )7  (6  )7  )7 Aj! A(j"(@  )7  (6  )7  )7  )P78 A@k )X7  )`7H  (h6P  )x7T  )7\  )7d  (6l Aj! Aj!  AqE A8j MqE@ B7 A6 B7 B7 Aj Aj@@@ (\@ (P  #AjA  *" E@A! #AjA  A !@ #AjA FE A ! #AjA FE 60 #Aj A0j   j"!@@@ !@@ -"A/k E  Aj!  @@@ -"A:k Aj!  A: -@ #A j  AE  @ A:G@ !  !@ "Aj! -AG A: Aj"-E #A=j  AE  Aj! @@@@ "-"AF@ Aj"!@ -"E  AG@ Aj!   F@ 6 #Aj Aj  A: Aj","Aq"A,k"AK A tA!qE   @ Aq"A,k"AMAA tA!q  E  Aj"-! 6 #Aj   E 6( 6  kAj6$ #Aj A j  A: Aj  AqA:F@ Aj"!@@ -"A,k"AMAA tA q E Aj!  A: Aj  AqA,F@ AjA, AjA, Aj!  (\E (PE (T"-@ #Aj  AE  (H"-@ #Aj  AE  @ Aq"E A?F Aj"!@@ -"E A?F Aj!  A: -E #A3j  AE  Aq@#A0k" $@ Aj"-"E@A!  @@@ !A!@@@ Aq"A=G@ @ A&G  A: Aj!   6 #Aj AjA!  @ 6 #Aj A!  A: Aj"-! !  Aj"-!   "AG! E   "E@ A!  A!@ #A)j #A/j  #"A3j! A9j!A! (! ! "#A)jE@#"A9j! A3A -A1Fj! "("E @  @ Aj"("   *"@ (   6 @   -"   #AjA ( G  6 #Aj A j A! E   A0j$ E  Aj Aj  E     (E  !@ (  Aj"(  Aj Aj  (E !@ (  Aj"(   A! #AjA  #!A ."@ Aj! !@  )7  (6  )7  )7 Aj! A(j"(@  )7  (6  )7  )7  )P78 A@k )X7  )`7H  (h6P  )x7T  )7\  )7d  (6l Aj! Aj!  AqE A8j MqE@ B7 A6 B7 B7 *" E  !@@ -"A kAI A F !@@ @@@@@@@@ Aq> A:@ Aj"-"A kAI A F E  AqA=F  6@ #A+j A@k (E  !@ (  Aj"(  A:@@ "Aj"-"A kAI ! !@ A k @@@@ Aq" AG@A! ! Aj"-"E A! : Aj!  j"-!  ! A:  Aj!@@ "-"AG@ A'F A  A! #A+jA (@ !@ (  Aj"(    Aj"-"E A ! : Aj!  j!  A: Aj!  Aj"-!  A: Aj! A:   E@ !   @ !  (@ !@ (  Aj"(      A! !   (E !@ (  Aj"(    Aj! #AjA  A!  #AjA (@ !@ (  Aj"(  Aj$   #Ak"$@@@@@@ ("@ !@ #A=jE  Aj"(" A:  ( ! A:   #AjI"E  @@@#AjI"@ A j A@  @@#AjI"E -E A0j A@  J A0jAKE  #"A/j6$  A0j6 A jA Aj A j A j AjL  A j   A j! -    #"AjI" A*j 6 A jA A/j Aj A j AjLE@ A j   A j"  - Aq   6 #A>j A! AG! E     AG! A! ("E A!@@ #Aj! @ ( @ ("E I"E *"6    A!  @ #A9j@ !  !#AjI" E -A1G #A3j*"6  Eq   A!  ("@ *"6 !    A!  #A jE@ A6 !  ! Aj"(" E  E  ( "E  #A)j  (  #A*j*"6 AG!  E  A! #AjA Aj$  & ~#A k"$ A6@@ ("E -"E A! !@@ Aq"A,G@    Aj! Aj"-! ("E@A!  A! -"E @@ Aq"A,G@ E   Aj! Aj"-! 6 A)"6@@@@ E @ E -E AL @ !@@ -"E A,F Aj!   k" Aj."@ @    jA:  Al"j 6 (" j(E  (! A,G  Aj! Aj" H @@@ ("E -E @ AL A!@ !@@ -"E A,F Aj!   k" Aj."@ @    jA:  Al"j 6 (" j(E  Aj! (! A,F@ Aj!  J  A,F  F  A6 (!A!@@ -"A,G@    6  6 #Aj AjA Aj! Aj! AL  A!@@@@ ( Alj"("E -E A!  @ ("E -E A6A! -A/k #A!j*! A6  6     6 Aj" ("H @ ("E -E @ AL A!@ ! !@@ -"E A,F Aj!   k"Aj."@ @     jA: Al" (j 6 ( j( E  Aj! (! A,F@ Aj!  J  @ A,F"  AH  (!A!@  Al"j ( *6 (" j( E  Aj" (H    F  A6 (!A!@@ -"A,G@    6  6 #A j AjA  Aj! Aj! @ (,"@ -   Aj"6,  A6A  @ ($"@ -   (,*"6$ E  @ (0"@ -  @ (4"@ -  @@@#AjI"E -E Aj A@  J AjAKE  (4 A."64 E  #"A j6  Aj6 A Aj Aj (4"E  -E  (AL # (! A!@@ Al" (j"("@ -  (! A!@ ($"E (," E -E -E ( ! (4! #!@ E@ Aj!  #! @@ -"A/k   Aj!  #"Aj  A!j! @ @ -  #Aj! AjL ("AqAG@  6 #Aj AjM  A?q@  6 #Aj AjM  #A jN" E A j@ O @ P  A jAE  ( " ( j ( k QE   ( " ( " j j" 6 @@ @  jAk-A F  OE  ( ! @ -A#F RAL  "E  "E  "E  "E *! S ( ( T A j "! E @@ -"AG@ A A:G  A: !  Aj"  -"! A !  : Aj! Aj! A6 OE S ( ( T A j ( j 6 Aj" (H @ ("E -E A6 A:A!A! A! A!@ !@@ -"E A,F Aj!   k"Aj."E  @     jA:@@@ -" A!G"E@ Aq@A! A6A! A:  Aq  A6  6 #Aj Aj  AqE  A6  6 #Aj Aj Aj "#A=jE@A!  #AjE@A !  #A jE@A!  #A*jE@A!  #AjE@A8!  #A3jE@@ E@A! AqE  A! AqE  :  !  A6  6 #"A+j6 Aj Aj   q!  E@ E   Asq   F   r "6  Aj! A!F! A! A,F @ (8"@ #A6jE  #A jE  #A3jE  A6  6 #"A-j6 Aj AjA  #A6j*"68 E  @ (h"E #A)j A6  6 #"Aj6 A'j AjA  @ (L"@@ #A6jE #AjE #A jE #A3jE #AjE #A*jE A6  6 #"A9j6 Aj AjA  @ -Ak A6  6 #"A9j6 A'j AjA  #A6j*"6L E  @ (P"@@ #AjE #A jE A6  6 #"A$j6 Aj AjA  -AF  A6  6 #"A$j6 A'j AjA  #Aj*"6P E  (E@ A6  (6t #"A'j6p Aj AjA  (E@ A6  (6d #"A&j6` Aj AjA   (!A!@ ("E E -E -E #AjXE A #AjXE   XAL!  E@ A6 #A7jAA  @ (d"@@ #A6jE #AjE #A3jE A6  6T #"A9j6P Aj AjA  #A3j  A6  6D #"A9j6@ A'j A@kA  #A6j*"6d E  @ (|"@@ #A6jE #A jE #A3jE A6  64 #"A9j60 Aj A0jA  #A3j  A6  6 #A(j A jA  #A6j*"6| E  A!@ ("E #AjE #A/jE@A!  #AjE@A!  #AjE@A!  #AjE@A!  #Aj A! 6@@ ("E #A6jE #A)j@ A6  6 #"A j6 Aj A  A6#Ak"$ B7 B7@ Aj"A,@ Y  AZ [ 4 )\ Aj$ (AH  Aj! B! @ B U! Aj" (" Alj"Aj"(6 Aj" Aj")7  )7   Al" j")7  )7  (6 ( j" )7  )7  (6 B|" 4S  A6 @ ("E #A!j  AAVW*"6 E  A:A  A6 #AjAA  A6  6 #"A j6 Aj AjA  A6  6 #Aj A! Aj$ @"E @@@ @@ #AjA FE #AjA FE A=E      #Aj   #AjE  -E ($  *"6$ E  @ E -E (  *"6 E  @ E -E (  *"6 E  @ E -E (  *"6 E  @ E -E (,  *"6, E  @ E -E (0  *"60 E  E @@ -AG GE@ Aj#Aj  A6 A6 B7 -E@ A6 A; A6 (AF@ A6 AF  A A6    A6 #AjA  4A!@       AA !   ("@@ ( !  " B7 ("@@ (!  " B7 Aj"A: B7 A6 A 6 ( A: A: A: A6 A: A; ( A6 -E@ B7 #Ak"$@ /AF@ Aj (AA A0jAAc  A0j6 Aj#Aj   ( (Alj"AA ("AFj(!@ ( "@ -  #Aj! @ AF -E  E  6(  6$  6 Aj#Aj A j   6  6 Aj#Aj Aj Aj$  ("@ (AJ@ Al" (j( ( j( ( j(  ( j("@  T ( j( Aj" (H (   #Ak"$@ E @@ -AG GE@ Aj#Aj  A6 A6 B7 -E@ A6 A; A6 (AF@ A6 AF  A A6  E (AL @  6 A A j ( Alj"( ( Aj" (H Aj$ A E  @ -AG GE@ Aj#Aj  A6 A6 B7 -E@ A6 A; A6 (AF@ A6 A AF  A A6A |#Ak"$@ E@  "AG (AJ@A!@  6 A A j ( Alj"( ( Aj" (H A! Aj$  n#Ak"$ @ A6 Aj@ ( E@A!  AjA!@ E  (6A!  Aj Aj$ #Ak"$ #A)jE@#"A9j! A3A -A1Fj! @@ ("@@  E  Aj"(" A!  6 #Aj   @ @  " A!  *" A! #AjA  (  6 Aj$ ~#Ak"$@ E Aj ( E #!@A ."@ Aj! !@  )7  (6  )7  )7 Aj! A(j"(@  )7  (6  )7  )7  )P78 A@k )X7  )`7H  (h6P  )x7T  )7\  )7d  (6l Aj! Aj!  AqE  A8jOqE@ B7 A6 B7 B7 #"Aj! A=j!@@ ) "BS j("E #A)jE@#"A9j! A3A -A1Fj! "("E @  @ Aj"("   *"E@ Aj#AjA  (   6 A(j"("  Aj#AjA Aj Aj$  #A k"$@@@ Aj."@ ! !@ -"A%G@  : E  Aj! Aj!  AP!AP ,"A0kAqA I AI AkAqAI  AkAqAK A ! @ ,"A0kAqA I AkAqAI@AI!  AkAqAO A!  j  jAtr"@ Aj!  : Aj!   6 #Aj   A! #AjA   6 #Aj Aj A! A j$   E@A ($  E@A (, A E@A @ ("@  (Alj("  (0! #Aj  W E@A @@ ("E  (Alj"("@ -  ("E -  #Aj! , E@A @ (@ ("  #Aj! 0 E@A ("E@#Aj  (Alj( #AjA   E@A (  E@A ( .A!@ E ( A! ( (!  :@ E E Aj!@ ("E  (  (!  !@ E (AF /!  !@ E (AF (!  2#! E@ Aj #! (E@ Aj (  E@A ( @ E ( (!   E@A ( \@ E @ ("@  (Alj("  (0! A! -AF@ #Aj -E  A!   E@A -  E@A - "A!@ E ( (!  #Ak"$A!@ E E ( #A!jE@AAVW! AkA~I  6 Aj#Aj d Aj"E (! AA AG! Aj$   E@A (! 6   E@A (! 6  , E@A (! @ 6 6  , E@A (! @ 6 6  # "(!  #Aj 6  A."E@A B7 B7 B7t A6` A:  6 B7 B7 A6 B7 B7 B7 Aj!@ @  )7  )7  (6| A MAA tA&qE@#! Aj Aj (E #Aj  ("AjA"E   e 6 ("AL   (  Aj"6t E@ A  (6x  A6| B7 B7  @ E E@ Aj @ E ("Ao"E A k" j6 ( k6  ("M@  k6 (" j6  (j AO@ Aj"."E  ( j6 Aj! ("@  (6  6  A6 A6 6  A."E (Aj6  (6 AA  k6 AA " j6 6  j!   E@A Al"."@  Al"j" j"(6 (! A: A6  6  ("*"6 E@ @@ Al jAk( AJ! Ak!  A  jAj! Aj" G  ( j6   #Ak"$@ E #AjF (xAJ@@ (t" Al"j"-AF  6 A A j ( ( (t  j( Aj" (xH (t@ ("@ (6   (   Aj$ d @#!  Aj E #! Aj (E #! Aj ( j"AjA"E   e 6 @ E #AjF (AJ A! AL E Al"A"6A! E 6 @    A! A6` (AL Aj! (!A!@@  Al"j"("@ AjA"@  e ( j 6   6 (" j"(E@A ( E@ A6` A! Aj" (H  %@ E #AjF A!   AjA"@ e #Ak"$@ E A."E B7 B7 B7t A6` A: B7 B7 B7d B7 B7 B 7 B7 B7l  (|6| A j A je@ Aq@  ( (E  @ AqE ("AL (!@A! AJ@@    ( Atj( Atj"( (E  Aj" ("H (! Aj" H Aq@ Aj" )d7  )l7 @@ AqE (x"AL  (t  Aj"6t E   (x"6x  (x! AJ@A!@ Al" (tj-AF@  6  6 A Aj (t j"( (@ (t jA: (x! Aj" H !  A! Aj$  #A0k"$@ E #AjF (" J ANqE@  6  Ak6$ Aj#Aj A j  AN (" NqE@  6  6 Aj#Aj   @  F@#! Aj AtA" E  (AJ@ Aj!A!@ Atj" 6 A6 Aj" (H @ (" ("H@ ( !  @ AL@ AJ A  #! AG  Aj  AO  At "At! ( "E@ .   f !#! Aj E  6 (! 6 (  kAtj6 (!  Atj 6 (Aj6 ( Atj( Atj! A AGE@ A6  Aj6A!  AL@ A6  Aj6A!   AjA"6#! Aj E   6 @    ( jA:A!  #Aj 6 Aj#Aj AjA! A0j$  #Ak"$@ (E  6 AjA  g A:A."E B7 B7 B7t A6` A: B7 B7 A6| B7 B7 B7 B7  )7d  )7l  AjAjA"@ A: Aj Aje (6  6 A A"@ A: #Aj"(6 (6 (6  6 A A"@ A: #Aj"(6 (6 (6  6   AjAjA"6@ @  Aj6 #Aj d  #Aj6 (h  (d  Aj$  E@A ( , ( A: A6 ( A6 4 ( A: A6 ( A: A6 @ ("@ (AG  (6  -E@ #A6jA @ ("AN@  (I  A6 #!A."E@ Aj!  B7 B7t A6` B7 B7 B7 B7 B7 B7 B7 A:  )7d  )7l  (6| ("AJ@  (  Aj"6t E@ #Aj!   (6x A6#! Aj Aj (E #Aj  ( (j"AjA"E   e 6 (6 A: (! A6 6  ; AjA"@  : Aj e  (6 6 #A k"$ Aj"!@@ ! ("E  ! (  (!@ @  6   6  " jAj."@  A j"6   e jAj"6  e  (6  6 @ #A-jE@ h"A AJ"6#Aؐj 6  #A jE@A!@ -AG -AG -E! :#Aܐj :  #A&jE@  Aj6  Aj6  Aj6A!@@@@ #Aj iAk ( ( (AljAlj6  (! ("A N@  Alj6   AljAl6  (Al! 6  #AjE@A!@ -AG -AG AA -! 6  #AjE@A!@ -AG -AG AA -! 6  #A j 6 A j$   (! ("(!@ -AG ( A "E@A A A -6 (6 6 @@  AtA" E AJ@ Aj! @@ At"j" ("AH@A! !   Aj ( Alj( AG"E  @  (   jA:  j" 6  6 Aj" G @ (" ("H@ ( !  @ AL@ AJ A  AG  #Aj6A AO  At "At! ( "E@ .   f "E@A  6 (!  6  (  kAtj6 (!  Atj 6A!  (Aj"6 -AG  (H A6  #Aj6A A #Ak"$@ E E@ #AjA  (@ #"Aj6 A:j   @ ("E@A ." A! #AjA  (6 B7@@@A AH  AH AN  ("@  A6  (6  A6  *6 AN@ A!  ("@  A6  (6 6A! Aj$   E@A @ E ( Aj A6 (@ #AjAA (!@ ("@   #A jAA A   ( A: A6 ( A6 A; A6A AkAK@A #AjAA k@ (E@ 6  ( 6 6@@@ ( (  A6 @ (  A w#Ak"$@ AE E@ #AjA  AO@ A6 #Aj   #Aj      ! Aj$ @ (" E@A ."  #AjAA (6 B7@ @A AH   AH   AH @@ E E A AH @  Atj(A AH   Aj" G  AA AH  AH  A AH #Aj AH  AH @@ E E A! A AH @  Atj(A AH   Aj" G  AA AH  A AH @ @A! @@@ E  At"j"(" E @ E  j(E E   j(   "A AH  (  AN   AA AH  Aj" G AA AH  A   AH A AH A AH #Aj AH  AH A AH #Aj AH AA AH  AH  (E@A AH  AH  A6 @ *6 @ (AF@ (AH  AH  A #AjA ("@  A6 (6 6A #Ak"$@ AE E@ #AjA  E@ #AjA  AO@ A6 #Aj   @ ("E@A ." A! #AjA  (6 B7@A AH  AH  AH @@ E E A! A AH @  Atj(A AH   Aj"G  AA AH  AH (E@A AH  AH  A6  *6@ (AF@ (AH  AH  A!  ("@  A6  (6 6A! Aj$  @ ("AkAI @ E@ (E  A6 A; A6  A6 A; ( A6 Aj A6 ( A: A6 ( A6@ (AF@ ((AG  A6 A "6 E@ #AjA  A6 r#Ak"$@ AE E@ #AjA  AO@ A6 #Aj   A  A    ! Aj$  S@ E (AG ("E (AK ( - A! A6 A;  Y@ E AL (AG ("E (AK ( - 6A! A;  2 E@A  -AF@A AH  AsAv )@ E  (AG (AG!  #Ak"$@ E@  @@@@@@@@@@@ ("AG@   @@@ "AJ@AA E    AA  AN  ( A: A6 ( A: A6 A6 !  -AG (AG @ ("@ Aj  (A:  #AjA ( A: A6 ( A: A6 A6 !  ! ( @ ("E ("E (A F AGrE ("6 E@ A6 A6 ("@  A6  (6 6 (@ A6 (A G    A6  ! A6  (! (@  A: A6 ( A: A6 A6  @ (AF  A!  (! (@  A: A6 ( A: A6 A6  @ (AF  A!  (! (@  A: A6 ( A: A6 A6  @ (AF  A!   6 #Aj  ( A: A6 ( A: A6 A6 ! E  (xAJ@  ! Aj$  w@ ("E As ("Eq  AGrE ("6 E@ A6 A6 ("@  A6  (6 6 ^@ E AE A!@ "E@   ("AMAA tAq  ! (AG   E@A (E@ Aj A6 #!@ (@ A;j!  @@ "E! E (! #Aj!@@@ Ak #AjAN   A6 (AG   AA A!@ E @@ (Ak #A jAA @ @A AH   AH  AN   A AH  AH  @ ("E (E A AH  AH  AA (AF6 AuAr!  #Ak" $@ E AE E@ #AjA  AO@ A6 #Aj   #Aj      E A!@ "E@ !   ("AMAA tAq  ! (AG Aj$  b@ E    E A!@ "E@   ("AMAA tAq  ! (AG  #Ak"$@ E AE E@ #AjA  AO@ A6 #Aj   A  A    E A!@ "E@ !   ("AMAA tAq  ! (AG Aj$  b@ E AA E A!@ "E@   ("AMAA tAq  ! (AG  #!@ AE @ ("E@A ."  #AjAA (6 B7@  AH  AH  Aj  AH AH (E@A AH  AH  AA AF6@ (AF@ (AH  AH  @ (E@ 6  ( 6 6A!@@ ( (  A6A @ ( A ("@  A6  (6 6A!  b@ E AA E A!@ "E@   ("AMAA tAq  ! (AG   AA   AA  b@ E AA E A!@ "E@   ("AMAA tAq  ! (AG  b@ E AA E A!@ "E@   ("AMAA tAq  ! (AG   AA   AA  D@ E  ("E ( "6 E@ A6 A6 !  A!@ E @@ (Ak #A jAA  AJ@@ ( (kAk N AH   (jAj E A -Ask A AH    AH  AH  A!  ? A6A~!  (AkAO@ #A jAA~    7A!@ E AL A: E AI  !   E@A   AA  AL AA  AL  E@A  #Ak"$ A6@ E (E@ Aj A6 (@ #"A(j6 A:j   @@ (AF ( ( -AG  #A0jA       ! Aj$  : E@A (@A (@ #A5jAA A6A  E@A (!@ ( @  ( A @@@@ Ak #A jAA #A:jAA #AjA (@ #A jAA A6 A6 AsAv A @@ E (E@ #A:jAA (AkAM@ Aj#AjA @ ("E@A ."  #AjAA (6 B7 A6A AH  AH @ @ AN   (AF@ (AH  AH  @ (E@ 6  ( 6 6A!@@ ( (  A6A @ (   ("@  A6  (6 6A A  E@A (@ #AjAA @ (E ( #A jAA @A AH AH A! (AF@ (AH  AsAv!   E@A (  A K@#A;j # Atj( (#! E@ Aj ("#Aj  r#Ak"$@ @ (A~qAF  #Aj*  Aj Aj   ( E@ Aj#Aj*  ( ! Aj$ 4@ E Aj!@ ("E   ,G Aj!   E@A (  E@A (  E@A (` n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  A!@ E E -E (E !@@ -"A"F E@ ("AL  (!A!@   Alj(E@  Aj" G  Aj! j F  *"E ! -"@A! !@@@@ Aq@ AqA"G A"! Aj"-A"F A! !  Aq"A"F@A! !  j! !  : Aj! Aj"-" A! A:A!@ ("AL (!@   Alj(E@ !  Aj" G   n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj( ! Aj$  n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Alj(! Aj$  A jA  s#! E@ Aj A j#"AjAF@ Aj #"Aj!A A'j" Ajk" AO"@   jA:  v#Ak"$ A6 @ E A j#AjAF A'j"-A:kAqAI A jA l! ( "E -A rA G ! Aj$  #Ak"$#!@ E@ Aj!  @ A j"#AjAFE@ A'j!@ -"E  A G@ Aj!  Aj  @@ #AjAFE #AjAFE #AjAF  A'j  @ #AjAF@ #AjAF  A&j  @ #AjAFE #"AjAFE Aj!  A%j "-"E !@ A0kAqA K  Aj"-"  G   6 Aj#"Aj  Aj! Aj$  #A k"$@ E (" J ANqE@  6  Ak6 Aj#Aj Aj  (" J ANqE@  6  Ak6 Aj#Aj   ( Atj( Atj(! A j$  #A k"$@ E (" J ANqE@  6  Ak6 Aj#Aj Aj  (" J ANqE@  6  Ak6 Aj#Aj   ( Atj( Atj("A AG! A j$  #A k"$A!@ E (" J ANqE@  6  Ak6 Aj#Aj Aj  (" J ANqE@  6  Ak6 Aj#Aj   ( Atj( Atj(AF! A j$   E@A ( n#Ak"$@ E (" J ANqE@  6  Ak6 Aj#Aj   ("E Atj(! Aj$  \A!@ E (AF AG" -G@ (E@ Aj A6   : A!  !@ E (AF -!  A $A!@ E (AF !  X E@ A:A E  A6A (E@ Aj A6     ( -   m! @ A6 ! @ AG! @@ -"" AN@@ A'G@ AG     : Aj!  : Ak! Aj! Aj!  @    n" I"   oAF AL  Aq! AO@ Aq! A!@  -:  -:  -:  -:  -:  -:  -:  -: Aj! Aj! Aj" G A! @@  -: Aj! Aj! Aj" G  k!  @ A6 E rAq r #A A jAA !  p Ak! Aj! Aj!  A:  k %A  A#"Aؐj( Aܐj-  A   m! E@A (E@ Aj A6 A"A' ! @ ! !@@ -"F@ Aj!  "AF@ Aj!  AN  (  n"I@ #A jAA @ Aq (  q F #A jAA  Ak"k!  j!A! Aj! Ak"  jA Aj  ALr"jAj." E@ #AjAA ! E@ A; Aj!  : Aj!@ A  Er@ E @ -"!@  GA  AGrE@  :  -: Aj!  AN@  : Aj!  ( r!  -: Aj! Ak"E A! Aq"@@  Aj"-: Ak! Aj! Aj" G AkAO@@  -:  -:  -:  -:  -:  -:  -:  Aj"-: Aj! Ak" Aj k! Aj! Ak"  @     j!  : A:  A B E@A (E@ Aj A6    - (AJ A!AA !@@@ E@@ E AA ! Aj! ! AG@ A~q! @ -"AkAqAI A A'F  AF A j! -"AkAqAI A A'F  AF A ! Aj!  j! Aj" G AqE @ -"AkAqAI A'F@A!  ! AF A!  j!  6 ." ! E    At jAj"6 ."  E@A #AjAA ! E@ A: Aj! A; Aj! @@ -! @ #Aj" Aqj-:   Avj-: Aj  AkAqAM@ E@ A: Aj! A:  AqA0r:  AvA0r:  AvAqA0r: Aj  @ AG@ A'G  A; Aj  E@ Aܸ; Aj! Aܸ; Aj   : Aj ! Aj! Ak" A: A  #Aܐj-A @ E !@@ -AG -AG A Ak" AMAv."E  ! Aj"-"@@ Aj!@@ Aq"AK@ !  #! -"E@ !  Aj j-"AF@ !  Aj! AK #Aj j-"AF   Atr: Aj! -! Aq  k!  Aj."E  E @ Aj!@  j"-"AG  j-"AF@A! Aj  AqA0G@ !  -" AqA0G@ !  -"AqA0G@ !  At Atj jAj! Aj !  j : Aj!  I  Ajf"E@ A  6  #A k"$ AHA  6 B7  6 B7 (( Aj AjA A"! A ( AG ! A j$ #Ak"$A!@ E Aj A6@ (E@A4."E@ #AjA  @ AqE@  A4jO  B7 A60 B7( B7 B7 B7 B7  B7 A60 B7( B7 B7 B7 B7 #Aj"E@   (AG  AJ@@  A!  A!@ #A)jE@  6  #A2jE@  6  #A jE@  6  #A0jE@  6  #A*jE@  6  #A*jE@  6  #AjE@  6  #A*jE@  6  #AjE@  6  #A0jE@  6$  #AjE@  6(  #AjE@  6,  #A/j  60  Aj"J  (E@ #"A)j6 Aj    (E@ #"A2j6 Aj Aj   (E@ #"A j6 Aj A j   (E@ #"A*j60 Aj A0j   (E@ #"A*j6@ Aj A@k   (E@ #"A*j6P Aj Aj   (,E@ #"Aj6` Aj Aj   (0E@ #"A/j6p Aj Aj   6 A!    #AjA Aj$  r#A k"$ AHA  6 B7 (( Aj A jA AjA"! A ( AG ! A j$ #A0k"$A!@ AH (($"E@ #"A0j6 Aj   AH@ #A6jA   6 B7  6$ B7  A j AjA AjA"! A ( AG! A0j$  #A0k"$A!@ AH ((("E@ #"Aj6 Aj    6 B7 B7  B8 BB( BB BB BB BB B(B B87(  A(j6$  A j AjA AjA"! A ( AG! A0j$  #A0k"$A!@ AH AH@ #A7jA   6 B7  6$ B7 ((,  A jA AjA"! A ( AG! A0j$  #A0k"$A!@ AH AH@ #A6jA  A6  6 B7  6$  6 ((0 Aj A jA AjA"! A ( AG! A0j$  #A@j"$ AHA  6 B7  6$ B7  60 B7( (( A j AjA AjA"! A ( AG ! A@k$ ~#A@j"$B!@ AH (("E@ #"Aj6 Aj    6 B7  60 B7( B7  B8 BB( BB BB BB BB B(B B878  A8j6$  Aj AjA AjA"! (!  AG AG )"B8 BB( BB BB BB BB B(B B8! A@k$  o#A k"$ AN@  6 B7 (( Aj A jA AjA"!  (A AF! A j$  #A k"$@ AH (( "E@ #"A0j6 Aj    6 B7  Aj A jA AjA"!  (A AF! A j$  r#A k"$ AHA  6 B7 (( Aj A jA AjA"! A ( AG ! A j$ ~#A k"$B!@ AH (( "E@ #"Aj6 Aj    6 B7  Aj AjA A jA"! (!  AG AG )"B8 BB( BB BB BB BB B(B B8! A j$  r#A k"$ AHA  6 B7 (( A j AjA AjA"! A ( AG ! A j$ A #Ak"$@ E@  Aj" A6 A6 A A js"AH@ ?( A0jA]6  6 #Aj    E@A AH  A6 B7 (( A0j AjA AjA"!  (0A AF   "E@ BA!  @ AH  6 B7 A6 B7 (( A0j AjA AjA"!  AG (0"AF @@  AjAt"AL   Aj  F BA!  AH@?(!A! AN@  68 B70 (( Aj AjA A0jA"  B  A6   A0jA]6  6 #Aj Aj  BA! AH   68 B70 (( Aj AjA A0jA"!  AG A  (B!  BA! Aj$    #Ak"$@@ AN@  6 B7 A6 B7 (( A@k AjA AjA"!  AF  A!  A! (@"AF A60@@@ A A0js"AN@@ AH   6H B7@ A6T B7L ((, Aj AjA A@kA"!  AG  (B"AL   Aj u F ?(! AN@  6H B7@ (( Aj AjA A@kA"  B Aj A6   A@kA]6  6 #Aj Aj  ?(! AN@  6 B7 (( A@k AjA AjA"  Aj A6   A@kA]6  6 #Aj   AH AH  6H B7@ (( Aj AjA A@kA"!  AG (BE  B  BE@A!  ?( A@kA]6$  6 #Aj A j Aj$  A ;A! (" (H  Aj6 ( j-:A  ?A! (Aj   ( (j :  (Aj6A  (" I !@ At"AJ@ K  @ K AL ( f"E@ (!   6  6A @ A@k"AJ@ K  @ K AL ( f"E  6  6A Aj#AjA  oA!@ (" ("N (! !@  j-@ Aj" G     (j  k  Aj6A!  fA!@ (" ("N (! !@  j-@ Aj" G    j  k  Aj6A!  NA! ( Aj"j   @ ( (j   ( j6A GA! ( ("k O @ ( j   ( j6A  -A! ( ("k O  j6A  GA! ( j   @ ( (j   ( j6A #Ak"$ @@@@ Ak ("Aj" (L A  A ("Aj" (J  ( j(!  6 At AqAtr AvAq Avrr   6 Aj#Aj A  ( j/!  6 At AvrAq 6A ! Aj$  #Ak"$@@@@ Ak (Aj   ( (j At AqAvr;  (Aj6A  (Aj   ( (j At AqAtr AvAq Avrr6  (Aj6A   6 Aj#Aj  A ! Aj$  @ ("M ("k!@@  ("H@ AL   k"@ ("  j   ( ("k6  ( k6  B7 A6 M @ At"AJ@ K  @ K AL ( f"E  6  6A (!@ A@k"AJ@ K  @ K AL ( f"E  6  6A Aj#AjA!  d (!@ E@ Aj" E A Aj" @A ( (j : Aj!  6  6A  ("AN@ ( j ( k"At AqAtr AvAq Avrr6 @ (E (! (" ("H@  jA   j ("6@ AH AqAN A A @@ -AF@ A6A! (AG@ AH  A (AF  (! (!@ AL@  @@  "AH@?("AF  AF  A6A! (AG@ AH  A -Ask  k!  j!  k"AJ A!  A! AH  -@A!  AAB"AH   #AjA @ AL E (   6  A:#Aj*! A6 6A  (AF@ #A)jAA @@ (" ("J@ AL   k"@ ("  j  ( ("k"6 ( k6  B7A! A6 @ ( kA?J A@k E ( (kAN A A!A!@@@@@ (" (j ( k"AH@?("AF A!@ AkD AF A @ ( j"6 AH@A A!A!A! ( kA?J   A! E @@ AAB" @@A! (" (j ( k"AN ?("AF @ AkD AF   E ( j6A #AjA A A6A A !  ~#Ak"$@ E@A!  A! (AG@A A A !  r! B|!@@ E@A!  (! A;  6  ;@ BX@ Ak   AjAZ  4 )B=~|W A"AO ?("AF   AjA]6 #"A j6 Aj   #A jA Aj$  T#Ak"$?! (@ Aj! (!@  6  6  E A  Aj$ AAB 3 ("AL@A (" v (   2  B"AH@A   #AjAA 2   "AH@A   #AjAA AAB ~#A k"$  r" A6  6 @ A A A ; @ B|"BX@ Ak   AjAZ  4 )B=~|W AA ! A j$  5~#Ak"$ AZ )! 4! Aj$  B=~|   r  rm   w /@#AjI"E -E h"A AJ! S#Ak"$?!@ E (E (!@  6  6  E A  Aj$ #Ak"$@ " AL (! ! A)! A)! A)!@@ E E E ("@@ "Aj!  Atj( A AL! A!@  Atj@@  N At" (j("-E  j 6   Atj  "6  A   "6  j"   H!  j! Aj" G # (" ! (!@ -E G # (xyE xyE x!  Aj6@@ A AjzAF /" E /"  A6A!A! #AjI"E #Ajk F - @ -@  Ajl AqN    ljAj Aqm"Aj l -AGt Aq AsAtA -"jA~A jH  Av ! #Aj{"E Aj AjE!A! ! @@ -" -E@ -E  Aj At)" # (#AjAMA!  -E - E@A AL! A!A!@  Atj(" | ! Aj"J@ ( |  j j!  G A }  k"@@A- } Ak" A }  -@  (6 #"A>j6   k6 Aj AjM   (6 #"A>j6 Aj AjM @ -E -E ("@  6 #Aj AjM   6  6 #Aj AjM AJ@A AL!  k!A!@@ -E -@ ( !  6  #"Aj 6 Aj AjM   6 #Aj AjM   lAtj! A!@   !   !@@@@@@ AL E -"  -  -E   @ -E  j"- !@@@ A0kAq" A I @ Aq"A k& AG   (| j"-" A K -A rAG  A: @ -E@ -E@ -E   At"j" ("  H6  j Aj."6 E   e  -@  j-!  Atj(!  6  6 #"A A j6 Aj AjM   Atj(! (! -E   6  6  6  6 #Aj AjM   | AjJ@ ( |  A }  A! # (#AjAM   6x  6t  6p #Aj AjM Aj" G @ -E -E #AjA A ~ Aj" G A! @ - -!@@ -E@ AqE  Aj!  Aj! AqE  -@ ( "#Aj ! ("@  6d  6` #Aj AjM   6X  6T  6P #Aj AjM   ( "#"Aj 6@ Aj A@kM -A!A!A!A!#A@j" $@@ -E@ -"AGAt! AO@ j! Aq!@  j  Atj"(j j (j j (j j ( j j! Aj! Aj" G Aq"@@  Atj(  jj j! Aj! Aj" G A!  AtAjA jAj."E@# (#AjAM  !@ E ("-E @ A+: Aj! Aj"- A!@  Atj( -"AGAtj"@ @ A-  -!  j! @ AqE Aj" Oq ("-E @ A+: Aj! Aj"-  G A: -E  60 #Aj A0jM  #AjAA ~ -@ ( | Ak! A!@  !@ -@  j-!  Atj(6$ #"A A j6 Aj A jM  "  Atj" ("J@ 6 !  j-! -! 6 6 #"Aj Aj  Aj Aj   AjM -E  Oq ( | Aj" G @ -@#AjAA ~  6 #Aj M ! A@k$ A ! AL Ak! A!@@ -@#AjAA ~  -E ( |  lAtj!A!@  j-!  At"j(!@ -@  #"Aj 64  A A Aqj60 Aj A0jM   j(! -!  #"Aj 6$  6 Aj Aj  Aj Aj  Aq A jM -E  Oq ( | Aj" G @ -@#AjAA ~  -E  6 #Aj AjM A } Aj" G @ -E - ! !  6 #"AA AFj6 Aj M -E  - #AjA A ~  # (#AjAM    @ Aj l"@@  Ak"Atj(    E  E Aj -A Aj$  #A k" $# !#! ! !@@@@@@ E@  At." E  AL AL!@ Atj" "6A! E@@ "   H"6 Aj" G Aj" G  ( !  Aj ! E A! AL @  |@ E ! Atj( k"AH @A  " Ak!  | Aj" G #AjAMA!@@ E Atj("AH @A-  " Ak!  | Aj" G  # (#AjAM  #AjAM #AjAM AJ@ AL!A! @A! E@@ 6 #Aj AjM@ E ! Atj( k"AH @A  " Ak!  | Aj" G #AjAM Aj" G E@ ! ! 6 #"AA AFj6  Aj M v  A j$ #Ak"$ ! ! @ AJ@  6P Aj#Aj Ajd  Aj#AjAd @@ AL@  #!A!@@ @ Aj  Al"Ar."E @ AL E A-   jA:  6@ #"Aj A@kM A8j !@ @  64  60  Aj A0jM Aj" G  @ #AjAM   6 #Aj A jM  Aj" G  # (#AjAM  AL #AA8 j!A  AL! A!@A!@  !  6  #Aj 6  Aj AjM Aj" G @ @ #AjAM   6 #Aj M Aj" G  Aj$ #Ak"$ (6@ Aj  Aj! Aj! Aj! Aj! Aj!@ AjA   (d"AL@  ,k6  6 #Aj   A6 A A6  -k"!@ AI @ Ak$     Ak"6d  ( ("kJ@  j E   ,k6  (d6 #Aj Aj  A6 A A6  @@@@ Ak E   AE   @@ ( @@@ Ak AE      Aj Aj E@ ( (l Aj  Aj   6` #A5j Aj ( (dj6  @@@@@@@@@@@@@@@@@@ A1kD       @@ (" -  A"6  #AjA  ("E  A j (A@ A6  A  A6  Aj  A!@@@@ -lAk A!  A!  A! 6 (@ A "6 E@ #AjA   A6 A6  AA A6  @ ( - A"6  #AjA  A6  ("E (AG @ ( - A"6  #AjA  A6 ("E (AG @ ( - A"6  #AjA  A6   Aj Aj E@ ( (l Aj Aj A  A E @@@ -E@ ("E  (AG   j6 ("E  (AG  A!#A k"$@@@@ @ ("E (AF A  (" A "  #!@ Aj"A @ A8j!  @ (" AJ@   Al"A"6 E@A!  @@ AK Aq   j"O  As  Aj"  KjA|qAj"E  A   E A  A6` Aj!A!@#!  @ A8j!  #! AjA @ A8j!  #! AjA @ A8j!  #! AjA @ A8j!  #! AjA @ A8j!  #! A jA @ A8j!  #! AjA @ A8j!   .6  .6  .6  (! Al" (j 6 ( j" (E@A!  (6 ( j (6 ( j (6 ( j (6 ( j (6 ( j ( 6 (AG@ A6` Aj" G  A6` 6A!A! ("E  (AG    (F    #"Aj 6 Aj Aj    (jAj!A! j 6 A j$ A6 ("E  (AG @ ( - A"6  #AjA  A6  #!@ A"E@ Aj!  #A8j Aj"A  @ ("AJ@   At"A"6#Aj E @@ AK Aq   j"O  As  Aj"  KjA|qAj! E A  A!@ AjA   ( Atj (l6 Aj" G 6 #A8j !  (F    6@ #Aj A@k   (jAj6  @ ("@@@ ("Ak  #! (!@ AjA @  A9j6l  #!  (|G@  A9j6l  (! ( H@  Atf"E@ A6l  6 6 A! AJ@@#! AjA @  A9j6l   Atj" (x"6  ( (j6@ AL #!  E  A9j6l  Aj" G A6l Aj  (l"E@ #Aj"6l  6P #Aj Aj   (jAj6 AF  -AqE   -  #AjA  ( (dj6  A  A6  A  A6 A6  A  A6 A6   j6   60 #Aj A0j  A6 ( (dj6   j6 @ (" (" (djAjF@ (E  ( jA (!   ,k6 #Aj A j  A6 (d (jAj! 6 6 Aj E Aj$ L#Ak"$  6  6 #Aj   A6 A A6 Aj$ #Ak"$A!@ A jA  Aj"  (*"E  A " ("jAj."@  Aj"6   e jAj"6  e ( ! A6  6@ ("@  6  6 6 A !  Aj$  #Ak"$ @ (@ A6  Aj A"@ AA 6 @@@ Aj  Aj!@ -E  Aj    , (@@@ -Ak  (A@  A! Aj E A!  @ E AsrAq ("E ("E   6 Aj Aj  ( ( @ @ @  AjA 6  A: ( E@A! #AjA  Aj (A!  A! E  (#Aj ( 6 (d"@ (h    Aj Aj$  #Ak"$@ "E Aj   ,6` Aj"A  ("AJ@   Al"A"6 E @@ AK Aq   j"O  As  Aj"  KjA|qAj"E  A   E A  A!@ A jA   ( Alj . 6 Aj" G 6A  A ! Aj$ #Ak"$@ E@ #Aj  (E@@ ("E -E   #Aj  A"@  6 #Aj Aj @@@ Ak A"E@A!   6 #Aj Aj  A!A! A"E  6 #Aj Aj A"@  @ A"@@ E ("E !   6 #Aj AjA!A!  A! A"E@A!  A!@ E E !   6 #Aj Aj A @ E @ E AL (|! *" E AtAj"." @ ." @ Ak! !A!A!@@ -"E@A!A!  !A!A!@ At"j" 6 j 6@ Aq"A F@ A :  @ A k  N @@ A F E Ak(j-A F  Aj! Aj! A!A! AG@A w" AL!  ! Aj!  j!  j"j"-" At"j 6  j 6  N@@  Atj("kA=H@ !A!A!  Atj(A j" Aj Aj  #AjA  A! ( G  #Aj  Aj (\ A! Aj$ 9#AjI"E@A *!@ E A! #AjA >J#AjI"E@A *!@ E  A! #AjA  H#Ak"$ A6 @A$."E    A j@ !   Aj$  #Ak"$@ @ Aj A6 E@ #A"j"E  AG@   @ AF@ AF   #AjA  AA"A3O@  #A+jA  A0j e!  @@@ -AG -AG -E  #A/j  #Aj! #AjE@ A6,  ( A,j"   (,6 #Aj   #AjE@A$."@ A6,     A,j@ !   (,6 #Aj Aj   #AjA   6 #Aj A j Aj$  #A k"$@  A"E  !  E  "@ Aj  6  6 Aj#Aj  (! Aj   A j$  # 8d @PostgreSQL|cannot exit pipeline mode while busyout of memoryempty queryPQsendQueryGSS-libraryprimaryanydefault_transaction_read_onlySHOW transaction_read_onlysession is not read-onlysession is read-onlysslkeySSL-Client-Keyin_hot_standbyprefer-standby \x%02xUnknown message: %02xprotocol error: id=0x%xallowsize_t overflow.%06uprotocol version not supported by server: client uses %u.%u, server supports up to %u.%uTIMELINE_HISTORY %u TIMELINE %ulibpqrcv query result contextconnect_timeouttcp_user_timeoutConnect-timeoutTCP-User-TimeoutlocalhostDatabase-HostSSL-Revocation-Listchannel binding required but not supported by server's authentication requestreceived invalid authentication requestduplicate SASL authentication requestportDatabase-PortsslrootcertsslcertSSL-Client-Certsetsockoptlibpqrcv_alter_slotlibpqrcv_create_slotkeepalives_countTCP-Keepalives-Countp=tls-server-end-pointinteger of size %lu not supported by pqPutIntinteger of size %lu not supported by pqGetIntout of memory for query resultprotocol error: no function resultdefaultcould not generate random salt_PG_initchannel binding is required, but client does not support itrightleftGSSAPI encryption required but it is not supported over a local socketinvalid socketdirectlibpqrcv_connectselectlo_creatc=biwsload_balance_hostscould not match %d port numbers to %d hostsLoad-Balance-Hostscannot exit pipeline mode with uncollected resultsgssanother command is already in progressno COPY in progressDatabase-Host-IP-Addressno client response found after SASL exchange success.pgpasstarget_session_attrsTarget-Session-AttrsoptionsBackend-Optionsscram_iterationsstandard_conforming_stringskeepalivesTCP-Keepalivescould not match %d host names to %d hostaddr valuespostgresPGresult cannot support more than INT_MAX tupleslibpqrcv_processTuplesnegative require_auth method "%s" cannot be mixed with non-negative methodsrequire_auth method "%s" cannot be mixed with negative methods%%s %%-%ds%-*s%*s%s%s=%s,,n=,r=%s%s:%s%s/%s%%s %%s, publication_names %s at character %scannot determine OID of function %sALTER USER %s PASSWORD %scould not send end-of-streaming message to primary: %sinvalid connection string syntax: %scould not get client address from socket: %scould not create socket: %scould not send startup packet: %scould not send cancel packet: %scould not get socket error status: %scould not translate Unix-domain socket path "%s" to address: %scould not translate host name "%s" to address: %scould not get peer credentials: %scould not receive timeline history file from the primary server: %scould not receive database system identifier and timeline ID from the primary server: %sprotocol extensions not supported by server: %sprotocol extension not supported by server: %scould not send data to server: %scould not interpret result from server: %scould not receive data from server: %scould not send data to WAL stream: %scould not receive data from WAL stream: %scould not clear search path: %scould not parse connection string: %scould not start WAL streaming: %scould not calculate client proof: %sunexpected result after CommandComplete: %scould not verify server signature: %serror received from server in SCRAM exchange: %scould not set socket to TCP no delay mode: %scould not encrypt password: %serror reading result of streaming command: %s%s(%s) failed: %s%s() failed: %sauthentication method requirement "%s" failed: %serror while shutting down streaming COPY: %scould not alter replication slot "%s": %scould not create replication slot "%s": %scould not parse network address "%s": %scould not write to file "%s": %scould not open file "%s": %scould not read from file "%s": %s %ssslcrldirSSL-Revocation-List-Dirinvalid response from primary serverunexpected response from serverno connection to the servercommand string is a null pointerstatement name is a null pointerlength must be given for binary parameterincomplete multibyte characterinvalid multibyte characteruserDatabase-UserpreferrequirepeerRequire-Peerhostaddrunexpected message from server during startup/tmpautogeqolibpqrcv_get_conninfolibpqrcv_get_dbname_from_conninfolibpqrcv_check_conninfoshow password_encryptioninvalid connection state, probably indicative of memory corruptioninvalid connection state %d, probably indicative of memory corruptioncancel request is already being sent on this connectionthe query interface requires a database connectionserver offered SCRAM-SHA-256-PLUS authentication over a non-SSL connectionsslnegotiationSSL-NegotiationgssdelegationGSS-delegationserver did not complete authenticationserver requested SASL authenticationserver requested SSPI authenticationserver requested GSSAPI authenticationreplicationReplicationsslcompressionSSL-Compressionserver_versionssl_max_protocol_versionssl_min_protocol_versionNegotiateProtocolVersionSSL-Maximum-Protocol-VersionSSL-Minimum-Protocol-Version%s value "%s" invalid when SSL support is not compiled ingssencmode value "%s" invalid when GSSAPI support is not compiled inPQfnlo_openconnection not openrequirepeer parameter is not supported on this platformrandomlibpqrcv_identify_systemrequiresslsslcrl/install/pglite/etc/postgresqlverify-fulllo_tellkeepalives_intervalTCP-Keepalives-Intervallo_unlinklo_lseeksspisslsnirequire_authRequire-AuthFlush"password_encryption" value too longunterminated quoted string in connection info stringmissing "=" after "%s" in connection info stringlibpqrcv_startstreaminglibpqrcv_endstreamingunexpected result set after end-of-streamingclient_encodingClient-Encodingchannel_bindingchannel binding required, but server authenticated client without channel bindingchannel binding is required, but server did not offer an authentication method that supports channel bindingChannel-Bindingcould not encode client proof%s/pg_service.conf.pg_service.confofflibpqrcv_receivetruelowriteread-writeParseCompleteCloseCompleteBindCompleteconnection in wrong stateinvalid SCRAM exchange stateTerminatelo_createlo_truncateserver did not request an SSL certificateserver accepted connection without a valid SSL certificateSSL-Root-Certificatechannel binding required, but SSL not in uselo_closeinvalid query responseEmptyQueryResponseErrorResponseNoticeResponsefalsedatabaseincorrect server signaturerequireserver requested an unknown authentication typetimezonenoneCopyDonekrbsrvnamedbnamefallback_application_nameKerberos-service-nameFallback-Application-NameDatabase-Namedatestylelibpqrcv_readtimelinehistoryfilepassfileDatabase-Password-Filekeepalives_idlecannot enter pipeline mode, connection not idlemessage type 0x%02x arrived from server while idleTCP-Keepalives-Idledisableno error text availableargument of lo_write exceeds integer rangeargument of lo_truncate exceeds integer rangeargument of lo_read exceeds integer rangeinvalid SSL protocol version rangeinvalid %s messagereceived invalid error messagereceived invalid protocol negotiation messageinsufficient data in "t" messageinsufficient data in "T" messageunexpected field count in "D" messageinsufficient data in "D" messagesslcertmodesslmodegssencmodeserver is not in hot standby modeserver is in hot standby modecannot send pipeline when not in pipeline mode%s not allowed in pipeline modesynchronous command execution functions are not allowed in pipeline modeunexpected pipeline modeinvalid ExecStatusType codeSSL-Client-Cert-ModeSSL-ModeGSSENC-Modecould not generate noncecould not encode noncerequire_auth method "%s" is specified more than onceserviceDatabase-Servicesslpasswordserver requested a cleartext passwordserver requested a hashed passwordSSL-Client-Key-PasswordDatabase-Passwordservice file "%s" not founddefinition of service "%s" not foundlibpqrcv_sendFieldauthentication method %u not supportedCrypt authentication not supportedSSPI authentication not supportedGSSAPI authentication not supportedKerberos 5 authentication not supportedKerberos 4 authentication not supportednone of the server's SASL authentication mechanisms are supportedAuthenticationSASLFinal received from server, but SASL authentication was not completedpassword is requiredtimeout expiredwrite to server failed"%s" failedPQcancel() -- no cancel object suppliedPortalSuspendedlibpqwalreceiver already loadedloread%d.%d.%d%s/.s.PGSQL.%drow number %d is out of range 0..%dparameter number %d is out of range 0..%dcolumn number %d is out of range 0..%dUnknown message: length is %dlost synchronization with server: got message type "%c", length %dsyntax error in service file "%s", line %dnested service specifications not supported in service file "%s", line %dnumber of parameters must be between 0 and %dunexpected asyncStatus: %dSynclibpqrcv_execCOPY terminated by new PQexec# 149:pg_unreachable():libpqwalreceiver.cexpected authentication request from server, but received %cgsslibquery to initialize large object functions did not return dataNoDataverify-caPGTZPGRES_EMPTY_QUERY TEMPORARYcannot exit pipeline mode while in COPYcannot queue commands during COPYPGSSLKEY %X/%Xunexpected shape of result set returned for SHOWPGRES_COPY_OUTPGCONNECT_TIMEOUTTCP_USER_TIMEOUTPQgetline: not doing text COPY OUTPGHOSTPGPORTPGSSLROOTCERTPGSSLCERTNOEXPORT_SNAPSHOTUSE_SNAPSHOTTCP_KEEPCNTSCRAM-SHA-256-PLUSPGLOADBALANCEHOSTSPGTARGETSESSIONATTRSPGOPTIONS%Y-%m-%d %H:%M:%SPGRES_FATAL_ERRORPGRES_NONFATAL_ERRORPGSSLCRLDIRPGSYSCONFDIRFAILOVERPGUSERPAGERPGREQUIREPEERPGHOSTADDRPGGEQOPGSSLNEGOTIATIONPGGSSDELEGATIONSTART_REPLICATIONPGSSLCOMPRESSIONPGSSLMAXPROTOCOLVERSIONPGSSLMINPROTOCOLVERSION NNNNPGRES_COPY_INIDENTIFY_SYSTEMTCP_KEEPINTVLPGREQUIRESSLPGSSLCRLconnection pointer is NULL PHYSICAL RESERVE_WAL LOGICALPGRES_TUPLES_OKPGRES_COMMAND_OKPGRES_TUPLES_CHUNKPGSSLSNISSL-SNIPGREQUIREAUTHPGRES_COPY_BOTHPQexec not allowed during COPY BOTHPGCLIENTENCODINGPGCHANNELBINDINGFSO_KEEPALIVEPGRES_BAD_RESPONSETWO_PHASEPGDATABASEHOMEPGKRBSRVNAMEPGAPPNAMEPGDATESTYLEPGRES_SINGLE_TUPLEPGPASSFILEPGSERVICEFILETCP_KEEPIDLEPGSSLCERTMODEPGSSLMODEPGGSSENCMODEPGSERVICENOTICEPGPASSWORDPGRES_PIPELINE_ABORTEDPGRES_PIPELINE_SYNCPGGSSLIB Is the server running locally and accepting connections on that socket? Is the server running on that host and accepting TCP/IP connections?,p=SELECT pg_catalog.set_config('search_path', '', false);0123456789scram-sha-256SCRAM-SHA-256md5lo_tell64lo_lseek64lo_truncate6442704-c datestyle=ISO -c intervalstyle=postgres -c extra_float_digits=357P03TLSv1.35432TLSv1.2TLSv128P01TLSv1.10server closed the connection unexpectedly This probably means the server terminated abnormally before or while processing the request.Target server's authentication method must be changed, or set password_required=false in the subscription parameters.Could not identify system: got %d rows and %d fields, expected %d rows and %d or more fields.Expected %d fields, got %d fields.Expected 1 tuple with 2 fields, got %d tuples with %d fields.Non-superusers must provide a password in the connection string.Non-superuser cannot connect if the server does not request a password.\....,********malformed SCRAM message (invalid iteration count)malformed SCRAM message (invalid salt)Unix-domain socket path "%s" is too long (maximum %d bytes)malformed SCRAM message (length mismatch)invalid SCRAM response (nonce mismatch)malformed SCRAM message (invalid server signature)malformed SCRAM message (garbage at end of server-first-message)malformed SCRAM message (garbage at end of server-final-message)malformed SCRAM message (empty message)server sent data ("D" message) without prior row description ("T" message)malformed SCRAM message (attribute "%c" expected)out of memory allocating SASL buffer (%d) PHYSICAL (RESERVE_WAL)SELECT pg_catalog.pg_is_in_recovery()SELECT pg_is_in_recovery()select proname, oid from pg_catalog.pg_proc where proname in ('lo_open', 'lo_close', 'lo_creat', 'lo_create', 'lo_unlink', 'lo_lseek', 'lo_lseek64', 'lo_tell', 'lo_tell64', 'lo_truncate', 'lo_truncate64', 'loread', 'lowrite') and pronamespace = (select oid from pg_catalog.pg_namespace where nspname = 'pg_catalog')malformed SCRAM message (expected character "=" for attribute "%c")ALTER_REPLICATION_SLOT %s ( FAILOVER %s ) (proto_version '%u'SNAPSHOT 'export', origin '%s', streaming '%s', two_phase 'on'SNAPSHOT 'nothing', binary 'true'SNAPSHOT 'use' 'requirepeer specifies "%s", but actual peer user name is "%s"invalid integer value "%s" for connection option "%s"invalid connection option "%s"unrecognized password encryption algorithm "%s"password retrieved from file "%s"line %d too long in service file "%s"CREATE_REPLICATION_SLOT "%s" SLOT "%s"missing key/value separator "=" in URI query parameter: "%s"extra key/value separator "=" in URI query parameter: "%s"invalid URI query parameter: "%s"invalid port number: "%s"invalid percent-encoded token: "%s"invalid %s value: "%s"forbidden value %%00 in percent-encoded value: "%s"invalid "%s" value: "%s"invalid URI propagated to internal parser routine: "%s"IPv6 host address may not be empty in URI: "%s"end of string reached when looking for matching "]" in IPv6 host address in URI: "%s"unexpected character "%c" at position %d in URI (expected ":" or "/"): "%s"unexpected response from server; first received character was "%c"message contents do not agree with length in message type "%c" "SSSS" LOGICAL pgoutput %-*s %*s error COPY INSERT SELECT FETCH MOVE DELETE UPDATE MERGE %s: connection to server at "%s" (%s), port %s failed: connection to server at "%s", port %s failed: PQcancel() -- setsockopt(SO_KEEPALIVE) failed: PQcancel() -- socket() failed: PQcancel() -- connect() failed: PQcancel() -- send() failed: connection to server on socket "%s" failed: LINE %d: %s, %s: LOCATION: out of memory PGresult is not an error result WARNING: password file "%s" has group or world access; permissions should be u=rw (0600) or less libpq is incorrectly linked to backend functions fe_sendauth: invalid authentication request from server: invalid list of authentication mechanisms %s%s%s %-*s%s %s QUERY: %s CONTEXT: %s HINT: %s DETAIL: %s CONSTRAINT NAME: %s COLUMN NAME: %s DATATYPE NAME: %s TABLE NAME: %s SCHEMA NAME: %s | %s cannot allocate memory for output buffer cannot allocate memory for input buffer fe_sendauth: error sending password authentication fe_sendauth: error in SASL authentication PQrequestCancel() -- connection is not open connection not open %s%sValue %-*s%s Value WARNING: password file "%s" is not a plain file no error message available channel binding not supported by this build fe_sendauth: no password supplied mismatched message length: consumed %d, expected %d internal error: cannot send pipeline while in COPY fe_sendauth: invalid authentication request from server: AUTH_REQ_SASL_CONT without AUTH_REQ_SASL connection pointer is NULL

Query retrieved %d rows * %d fields

%s

%s%s
%s%s
Retrieved %d rows * %d fields
%s
%d
Query returned %d row%s. -- RECORD %d -- (%d row%s) ReadyForQuery DataRow CancelRequest ParameterStatus %s RowDescription ParameterDescription Authentication NegotiateProtocolVersion FunctionCall CopyFail Execute CommandComplete Parse Close CopyOutResponse NotificationResponse CopyInResponse FunctionCallResponse CopyBothResponse Describe Bind %s %d F %d BackendKeyData %s NN set client_encoding to '%s'postgresql://postgres://0123456789abcdef   112J(S8$Q&(!?=+&B!?,(2-0~i(!?@4'%z!?8"$C!? #(E!?$i:%n!?(pF&2!?-,A%*1!?'!? %!?!?(@(4!?@+!?@ !?<!? @:N!? D!? H2S!? (%!? L^X&Em!? PJ&*Y!?TKV%S!?@\$ !?@X(!?d2-`?H%!?@h '|!?@l &!?@p~'*'!?tW8&c!? x'!?&*!?x&!?(%!?|3(E!?#(!?}i&*!?2>((%!?n%%!?=$^'N'$&(%%'V(((o'7  asmdylink.0 |``````~```````~`~~``~~``qenvpalloc0envAllocSetContextCreateInternal env"MemoryContextRegisterResetCallbackenvstrcmpenv errstart_coldenverrcodeenverrmsgenv errfinishenvputsenv__errno_locationenvstrtoulenvSplitIdentifierStringenv defGetBooleanenvdefGetStreamingModeenv defGetStringenv pg_strcasecmpenverrmsg_internalenvCacheRegisterSyscacheCallbackenv hash_create envCacheRegisterRelcacheCallbackenvMemoryContextAllocZeroenvis_publishable_relationenverrstartenvRelationIdGetRelationenvExecStoreHeapTupleenvMakeTupleTableSlotenvexecute_attr_map_slotenvget_namespace_nameenvMemoryContextResetenvMakePerTupleExprContextenvslot_getsomeattrs_intenvMakeSingleTupleTableSlotenvmemcpyenvExecStoreVirtualTupleenvOutputPluginPrepareWriteenvlogicalrep_write_insert envlogicalrep_write_updateenvlogicalrep_write_delete envOutputPluginWriteenv RelationCloseenvExecDropSingleTupleTableSlotenvlogicalrep_write_truncate envlogicalrep_write_message envOutputPluginUpdateProgressenvpfreeenvlogicalrep_write_commitenvlogicalrep_write_begin_prepareenvreplorigin_by_oidenvlogicalrep_write_originenvlogicalrep_write_prepareenv logicalrep_write_commit_preparedenv"logicalrep_write_rollback_prepared env hash_destroyenvlogicalrep_write_stream_startenvlogicalrep_write_stream_stopenvlogicalrep_write_stream_abortenv hash_seq_initenvhash_seq_searchenvlist_delete_nth_cellenvlogicalrep_write_stream_commitenvlogicalrep_write_stream_prepareenv hash_search envget_rel_namespaceenvGetRelationPublicationsenvGetSchemaPublicationsenvget_rel_relispartitionenvget_rel_relkindenvGetPublicationByNameenvlappendenv list_freeenvbms_freeenv FreeTupleDescenv free_attrmapenvMemoryContextDeleteenvget_partition_ancestorsenvGetTopMostAncestorInPublicationenvlist_member_oidenvCreateTupleDescCopyConstrenvbuild_attrmap_by_name_if_reqenvSearchSysCacheExists envSearchSysCache2envSysCacheGetAttr envReleaseSysCacheenvlist_free_deepenvtext_to_cstringenvMemoryContextStrdupenvMemoryContextSetIdentifierenvCreateExecutorStateenvaddRTEPermissionInfoenvlist_make1_implenvExecInitRangeTableenvGetCurrentCommandIdenv stringToNodeenv make_orclauseenvExecPrepareExprenvpub_collist_to_bitmapsetenvbms_num_membersenv bms_equalenvlogicalrep_write_beginenvlist_member_xidenv lappend_xidenv bms_is_memberenvlogicalrep_write_typenvlogicalrep_write_relenv__stack_pointerenv __memory_baseenv __table_baseGOT.memCurrentMemoryContextGOT.mem TTSOpsVirtualGOT.memCacheMemoryContextGOT.memTTSOpsHeapTupleenvmemoryenv__indirect_function_tablep  >__wasm_call_ctorsh Pg_magic_funci_PG_output_plugin_initj # klmnopqrstuvwxyz{|}~ D #  #"6 Aj"6 Aj"6 Aj6 Aj6 Aj60 Aj6, Aj6( Aj6$ A j6 6P 6L 6H A j6D A j6< A j68 A j64 Aj6 Aj6 Aj6@ h ("-AF@ -AF@ (! @ E ("E -  A" (      * A&   (" -AF@ ( (! (! #"(!  (6 At! @ AL A!@  Atj("(8! @ E " -AG (0-AF@ (( G  Atj 6@ E -  Aj!    Aj" G AL A" (   - -) A& # 6 ( #A@j"$ (! (! (!@ E -AF@ ( (!  !@@@@  -   -AG  ($ AAE #"A jA A jA A j  - E  #"(!  (6 ((" "(8G@ "! @ ($"E  ($"A (,E (4#! (,  ! @ (("E@   ( "A (,E (4#! (,  ! @@ #A j Atj(Atj(" E A A@ (0(D! (0!  60  Aj64#"Aj A0j A jA Aj @ ("(" @ ( ("("  ! A E@   6#"(!  (6 A?j (!  6A A@ #"A j" A j" -?" 6$   6 A j A j A jA Aj -?    ( (" .J@   ( (" .J@   (4"(" AJ@ Aj! A!@@ ( j- ( j- Alj/AG At" (j("-AG -AG ( j("-AF@ -AF  E@ #" ((  ( ( (At  ( ( (  ( j(! ( j 6 ( j ( j-: (! Aj" H 6#"(!  (6 A?j (!  6A A@ #"A j" A j" -?"6    6 A j Aj A jA Aj ! -?As AGq!  !   6#"(!  (6 A?j (!  6A A@ #"A j" A j" -?"6   6 A j  A jA Aj -?As AGq"rAqE  AsrAqE@  !A!  A Aq  ! @ E -     A"@@@@  (    - (0#  (     - (0$  (    - (0% A& @ ' @ (,E @ ( E ( # 6 ( A@k$   (A6  #Ak"$A " (#"AjAAA6  ( AjAAA6 A j ( AjAAA6A "#Aj6 (  6 A6@ E@ (t! A6@@ E (AL Aj!A!@@@ ( Atj("("#AjE@ @AA@A#"AjA A jA Aj #A j  "A6 ( ( AjA  ! (E@ (-E  AA@A#"AjA A jA Aj #A j #AjE@ @AA@A#"AjA A jA Aj #A j A! ( (A,  AA@A#"AjA A jA Aj #A j #A8jE@ @AA@A#"AjA A jA Aj #A j   :A!  #AjE@ @AA@A#"AjA A jA Aj #A j   :A!  #A jE@ @AA@A#"AjA A jA Aj #A j   :A!  #A jE@ @AA@A#"AjA A jA Aj #A j   :A!  #A jE@ @AA@A#"AjA A jA Aj #A j "#A jE@A! A:  #A?jE@ A:A!  AA@A  6p#"A j Aj A jA Aj #A j AA@  (6#"Aj Aj A jA Aj #A j  6 A! Aj" (H  AA@A #"Aj6 A j  A jA Aj #A j E@AA@A #"Aj6` A j Aj A jA Aj #A j ( "AO@AA@A ( ! A6  6#"Aj Aj A jA Aj #A j E@AA@A ( ! A6$  6 #"Aj A j A jA Aj #A j @@@@@ -Ak AG AA@A ( ! A6D  6@#"Aj A@k A jA Aj #A j AF AA@A ( ! A6T  6P#"Aj Aj A jA Aj #A j - AA@A#"AjA A jA Aj #A j A: A!@ -AG ( AM@AA@A ( ! A64  60#"Aj A0j A jA Aj #A j A! - AA@A#"AjA A jA Aj #A j : A6#"A jA: A j-E@A1#AjA#A jA: #!#A j(   (6 B7#"A j A jA AjA6 A j- #"AjAA$ Aj"AA3 AA0 A#A jA:  A; Aj$ " A+ A" (   3 A& A+ A" (  2 A& A+ A" (  1 A& m~#Ak"$ /8"E" ( .@ E )@! /8A A j/E A& A" ( ( 0 A& Aj$ #Ak"$ ("-"As+ , A6@ E@AAE   (6#"Aj  A jA Aj  A" (  - A& Aj$ #Ak"$ A+ A" (  ; A& (! Aj#A j(8 Aj9"@@@ ("E ("AL ( !A!@  Atj( F@ A:   :6   Aj"G Aj9" Aj$ #Ak"$ ((! (-! A" (   "( (  )H AF7 A& (! Aj#A j(8 Aj9"@@@ ("E ("AL ( !A!@  Atj( F@   :6  Aj"G Aj9" Aj$ % (! A" (6 A& A: #Ak"$ (! /8E (AqAvr"" ( ( (AqE5@  /8A A j/E A& A" ( ( B0 A& A: Aj$ *#A j("@ 4#A jA6 #A jA6  (- AGq A+ A" (  < A& #A jA6 Z#Ak"$#"A jA:@ A j("E Aj 8 Aj9"E @ A: Aj9" Aj$ m#Ak"$ 6 @#A j("E @  A jAA="E  A:  8 9"E @ A: 9" Aj$ M#Ak"$@#A j("E Aj 8 Aj9"E @ A: Aj9" Aj$ #A k"$  (86#A j( AjA Aj=!@@ -E@ B7 A; B7 B7 A6 B7( B70  -Aq  (>! (?! @! (" A! (B!#A j-E@#A j"(#" (! (6@ ("E@A!  A! (AL@A!  A! @ ( Atj(ACD! Aj"!  (H 6#A jA:# 6 A: (E A6 (0F A6 A60 ($"@ ( ! ( G ( "@ ( ! ( G B7 (,"@ H A! A6, (4"@ I B7 A64 B7@ ("E A! (AL@  AG! @ (!@@ ( Atj("-AF@A! - qAqE  J"( ("AtjAk(!  A!  J!@ (  AjK"E@A!  (A - "!   ! AGA !  (L  (L rAG  E@ - AG   - - r:  - - r:  - - r:  - - r:  H   J" ! A  D! ! Aj" (H  6(@@ - - -AG  #"(!  (6 (4M!#! (4M!   6$   6  6 ((" (8G#! ! (! (4! (4!  (6   AN6,  6 ' ((  >!@@@ E@A!A!A!  A! (AL@A!A!  A!A!A! A! A!A!@ ( Atj(! A:A! A - AA0  (AAO AA3 (( (P"E A3 " A AjQ ! @ -AF@ @ R - r! - r! - r"AqE  AqE  AqE  S S S ((!  @ - AG Aq  TD! @ - AG Aq  TD! @ - AG Aq  TD! R Aj" (H @@@ Aq@ SA! Aq   AqE  SA! AqE   AqE  SA! ((! (4"E@ ((!  (#AjAAA"64   (0AjUV (4! #"(!  6A! A6W! A"A6 A6  (86 (0-s! A6  : Aj X  6  6 A A jY (Z A[60  6 @ (AJ@A!@  ( Atj(\D! Aj" ! (H  ] (^6 @@ (AL@A!  A!A!@  ( Atj(\D! Aj"!  (H  ] (^6 @@ (AL@A!  A!A!@  ( Atj(\D! Aj"!  (H  ] (^6 # 6 ' ((! E  A! (AL A!@A! @ ( Atj("- A:A3 (( (P"E@  A3 A AjQ!@ - (4! (4"E@ ((!  (#AjAAA"64   (0AjUV (4! A!A  _! @ ("AL Aq! Aj!A! AG@ Aq! A!@  Alj" -_E@  -^Ej!  ArAlj" -_E@  -^Ej! Aj! Aj" G E  Alj"-_  -^Ej! ` G FA! R @ Aq@  60  (0 a AA@A (0(D! (0!  6  Aj6#"Aj  A jA Aj #A j A! Aj" (H ' E E E A: A j$  |~#Ak"$ (! /8"E" ( b A:@ E )@! /8A A j/E A& A" ( ( 0 A& Aj$  ( !A! ("-"AF@ (! ! (("@ (! @@ @ ( cE   -  ((" (8G@ "  (0 '   (0 -AF@#"(! #(6  ( d6  6 A:  (4"(AJ@ Aj!@@  Alj"-_ -^ (DAI @ .J eE  A" (  (Df A& Aj" (H A" (  g A& # 8d @PostgreSQLbinaryanyinvalid publication_names syntaxskipped replication of an empty transaction with XID: %ulogical replication output contextlogical replication publication list contextentry private contextlogical replication cache contextpgoutput_column_list_initparse_output_parametersconflicting or redundant optionscannot use different column lists for table "%s.%s" in different publicationspublication_namesmessagesunrecognized pgoutput option: %spgoutput_row_filter_exec_exprclient sent proto_version=%d but server only supports protocol %d or lowerpgoutput_row_filtertable "%s.%s" has row filterclient sent proto_version=%d but server only supports protocol %d or higherrequested proto_version=%d does not support two-phase commit, need %d or higherrequested proto_version=%d does not support streaming, need %d or higherrequested proto_version=%d does not support parallel streaming, need %d or higherpgoutput_startuppgoutput_commit_txninvalid proto_versiontwo-phase commit requested, but not supported by output pluginstreaming requested, but not supported by output pluginoriginoption "%s" missingstreamingtruefalsetwo_phasenonedidn't send DELETE change because of missing oldtuplelogical replication output relation cachepgoutput_change# 149:pg_unreachable():pgoutput.crow filter evaluates to %s (isnull: %s)unrecognized origin value: "%s"#!/bin/sh # install - install a program, script, or datafile scriptversion=2011-11-20.07; # UTC # This originates from X11R5 (mit/util/scripts/install.sh), which was # later released in X11R6 (xc/config/util/install.sh) with the # following copyright and license. # # Copyright (C) 1994 X Consortium # # Permission is hereby granted, free of charge, to any person obtaining a copy # of this software and associated documentation files (the "Software"), to # deal in the Software without restriction, including without limitation the # rights to use, copy, modify, merge, publish, distribute, sublicense, and/or # sell copies of the Software, and to permit persons to whom the Software is # furnished to do so, subject to the following conditions: # # The above copyright notice and this permission notice shall be included in # all copies or substantial portions of the Software. # # THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR # IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, # FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE # X CONSORTIUM BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN # AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNEC- # TION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. # # Except as contained in this notice, the name of the X Consortium shall not # be used in advertising or otherwise to promote the sale, use or other deal- # ings in this Software without prior written authorization from the X Consor- # tium. # # # FSF changes to this file are in the public domain. # # Calling this script install-sh is preferred over install.sh, to prevent # 'make' implicit rules from creating a file called install from it # when there is no Makefile. # # This script is compatible with the BSD install script, but was written # from scratch. nl=' ' IFS=" "" $nl" # set DOITPROG to echo to test this script # Don't use :- since 4.3BSD and earlier shells don't like it. doit=${DOITPROG-} if test -z "$doit"; then doit_exec=exec else doit_exec=$doit fi # Put in absolute file names if you don't have them in your path; # or use environment vars. chgrpprog=${CHGRPPROG-chgrp} chmodprog=${CHMODPROG-chmod} chownprog=${CHOWNPROG-chown} cmpprog=${CMPPROG-cmp} cpprog=${CPPROG-cp} mkdirprog=${MKDIRPROG-mkdir} mvprog=${MVPROG-mv} rmprog=${RMPROG-rm} stripprog=${STRIPPROG-strip} posix_glob='?' initialize_posix_glob=' test "$posix_glob" != "?" || { if (set -f) 2>/dev/null; then posix_glob= else posix_glob=: fi } ' posix_mkdir= # Desired mode of installed file. mode=0755 chgrpcmd= chmodcmd=$chmodprog chowncmd= mvcmd=$mvprog rmcmd="$rmprog -f" stripcmd= src= dst= dir_arg= dst_arg= copy_on_change=false no_target_directory= usage="\ Usage: $0 [OPTION]... [-T] SRCFILE DSTFILE or: $0 [OPTION]... SRCFILES... DIRECTORY or: $0 [OPTION]... -t DIRECTORY SRCFILES... or: $0 [OPTION]... -d DIRECTORIES... In the 1st form, copy SRCFILE to DSTFILE. In the 2nd and 3rd, copy all SRCFILES to DIRECTORY. In the 4th, create DIRECTORIES. Options: --help display this help and exit. --version display version info and exit. -c (ignored) -C install only if different (preserve the last data modification time) -d create directories instead of installing files. -g GROUP $chgrpprog installed files to GROUP. -m MODE $chmodprog installed files to MODE. -o USER $chownprog installed files to USER. -s $stripprog installed files. -t DIRECTORY install into DIRECTORY. -T report an error if DSTFILE is a directory. Environment variables override the default commands: CHGRPPROG CHMODPROG CHOWNPROG CMPPROG CPPROG MKDIRPROG MVPROG RMPROG STRIPPROG " while test $# -ne 0; do case $1 in -c) ;; -C) copy_on_change=true;; -d) dir_arg=true;; -g) chgrpcmd="$chgrpprog $2" shift;; --help) echo "$usage"; exit $?;; -m) mode=$2 case $mode in *' '* | *' '* | *' '* | *'*'* | *'?'* | *'['*) echo "$0: invalid mode: $mode" >&2 exit 1;; esac shift;; -o) chowncmd="$chownprog $2" shift;; -s) stripcmd=$stripprog;; -t) dst_arg=$2 # Protect names problematic for 'test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac shift;; -T) no_target_directory=true;; --version) echo "$0 $scriptversion"; exit $?;; --) shift break;; -*) echo "$0: invalid option: $1" >&2 exit 1;; *) break;; esac shift done if test $# -ne 0 && test -z "$dir_arg$dst_arg"; then # When -d is used, all remaining arguments are directories to create. # When -t is used, the destination is already specified. # Otherwise, the last argument is the destination. Remove it from $@. for arg do if test -n "$dst_arg"; then # $@ is not empty: it contains at least $arg. set fnord "$@" "$dst_arg" shift # fnord fi shift # arg dst_arg=$arg # Protect names problematic for 'test' and other utilities. case $dst_arg in -* | [=\(\)!]) dst_arg=./$dst_arg;; esac done fi if test $# -eq 0; then if test -z "$dir_arg"; then echo "$0: no input file specified." >&2 exit 1 fi # It's OK to call 'install-sh -d' without argument. # This can happen when creating conditional directories. exit 0 fi if test -z "$dir_arg"; then do_exit='(exit $ret); exit $ret' trap "ret=129; $do_exit" 1 trap "ret=130; $do_exit" 2 trap "ret=141; $do_exit" 13 trap "ret=143; $do_exit" 15 # Set umask so as not to create temps with too-generous modes. # However, 'strip' requires both read and write access to temps. case $mode in # Optimize common cases. *644) cp_umask=133;; *755) cp_umask=22;; *[0-7]) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw='% 200' fi cp_umask=`expr '(' 777 - $mode % 1000 ')' $u_plus_rw`;; *) if test -z "$stripcmd"; then u_plus_rw= else u_plus_rw=,u+rw fi cp_umask=$mode$u_plus_rw;; esac fi for src do # Protect names problematic for 'test' and other utilities. case $src in -* | [=\(\)!]) src=./$src;; esac if test -n "$dir_arg"; then dst=$src dstdir=$dst test -d "$dstdir" dstdir_status=$? else # Waiting for this to be detected by the "$cpprog $src $dsttmp" command # might cause directories to be created, which would be especially bad # if $src (and thus $dsttmp) contains '*'. if test ! -f "$src" && test ! -d "$src"; then echo "$0: $src does not exist." >&2 exit 1 fi if test -z "$dst_arg"; then echo "$0: no destination specified." >&2 exit 1 fi dst=$dst_arg # If destination is a directory, append the input filename; won't work # if double slashes aren't ignored. if test -d "$dst"; then if test -n "$no_target_directory"; then echo "$0: $dst_arg: Is a directory" >&2 exit 1 fi dstdir=$dst dst=$dstdir/`basename "$src"` dstdir_status=0 else # Prefer dirname, but fall back on a substitute if dirname fails. dstdir=` (dirname "$dst") 2>/dev/null || expr X"$dst" : 'X\(.*[^/]\)//*[^/][^/]*/*$' \| \ X"$dst" : 'X\(//\)[^/]' \| \ X"$dst" : 'X\(//\)$' \| \ X"$dst" : 'X\(/\)' \| . 2>/dev/null || echo X"$dst" | sed '/^X\(.*[^/]\)\/\/*[^/][^/]*\/*$/{ s//\1/ q } /^X\(\/\/\)[^/].*/{ s//\1/ q } /^X\(\/\/\)$/{ s//\1/ q } /^X\(\/\).*/{ s//\1/ q } s/.*/./; q' ` test -d "$dstdir" dstdir_status=$? fi fi obsolete_mkdir_used=false if test $dstdir_status != 0; then case $posix_mkdir in '') # Create intermediate dirs using mode 755 as modified by the umask. # This is like FreeBSD 'install' as of 1997-10-28. umask=`umask` case $stripcmd.$umask in # Optimize common cases. *[2367][2367]) mkdir_umask=$umask;; .*0[02][02] | .[02][02] | .[02]) mkdir_umask=22;; *[0-7]) mkdir_umask=`expr $umask + 22 \ - $umask % 100 % 40 + $umask % 20 \ - $umask % 10 % 4 + $umask % 2 `;; *) mkdir_umask=$umask,go-w;; esac # With -d, create the new directory with the user-specified mode. # Otherwise, rely on $mkdir_umask. if test -n "$dir_arg"; then mkdir_mode=-m$mode else mkdir_mode= fi posix_mkdir=false case $umask in *[123567][0-7][0-7]) # POSIX mkdir -p sets u+wx bits regardless of umask, which # is incompatible with FreeBSD 'install' when (umask & 300) != 0. ;; *) tmpdir=${TMPDIR-/tmp}/ins$RANDOM-$$ trap 'ret=$?; rmdir "$tmpdir/d" "$tmpdir" 2>/dev/null; exit $ret' 0 if (umask $mkdir_umask && exec $mkdirprog $mkdir_mode -p -- "$tmpdir/d") >/dev/null 2>&1 then if test -z "$dir_arg" || { # Check for POSIX incompatibilities with -m. # HP-UX 11.23 and IRIX 6.5 mkdir -m -p sets group- or # other-writable bit of parent directory when it shouldn't. # FreeBSD 6.1 mkdir -m -p sets mode of existing directory. ls_ld_tmpdir=`ls -ld "$tmpdir"` case $ls_ld_tmpdir in d????-?r-*) different_mode=700;; d????-?--*) different_mode=755;; *) false;; esac && $mkdirprog -m$different_mode -p -- "$tmpdir" && { ls_ld_tmpdir_1=`ls -ld "$tmpdir"` test "$ls_ld_tmpdir" = "$ls_ld_tmpdir_1" } } then posix_mkdir=: fi rmdir "$tmpdir/d" "$tmpdir" else # Remove any dirs left behind by ancient mkdir implementations. rmdir ./$mkdir_mode ./-p ./-- 2>/dev/null fi trap '' 0;; esac;; esac if $posix_mkdir && ( umask $mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir" ) then : else # The umask is ridiculous, or mkdir does not conform to POSIX, # or it failed possibly due to a race condition. Create the # directory the slow way, step by step, checking for races as we go. case $dstdir in /*) prefix='/';; [-=\(\)!]*) prefix='./';; *) prefix='';; esac eval "$initialize_posix_glob" oIFS=$IFS IFS=/ $posix_glob set -f set fnord $dstdir shift $posix_glob set +f IFS=$oIFS prefixes= for d do test X"$d" = X && continue prefix=$prefix$d if test -d "$prefix"; then prefixes= else if $posix_mkdir; then (umask=$mkdir_umask && $doit_exec $mkdirprog $mkdir_mode -p -- "$dstdir") && break # Don't fail if two instances are running concurrently. test -d "$prefix" || exit 1 else case $prefix in *\'*) qprefix=`echo "$prefix" | sed "s/'/'\\\\\\\\''/g"`;; *) qprefix=$prefix;; esac prefixes="$prefixes '$qprefix'" fi fi prefix=$prefix/ done if test -n "$prefixes"; then # Don't fail if two instances are running concurrently. (umask $mkdir_umask && eval "\$doit_exec \$mkdirprog $prefixes") || test -d "$dstdir" || exit 1 obsolete_mkdir_used=true fi fi fi if test -n "$dir_arg"; then { test -z "$chowncmd" || $doit $chowncmd "$dst"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dst"; } && { test "$obsolete_mkdir_used$chowncmd$chgrpcmd" = false || test -z "$chmodcmd" || $doit $chmodcmd $mode "$dst"; } || exit 1 else # Make a couple of temp file names in the proper directory. dsttmp=$dstdir/_inst.$$_ rmtmp=$dstdir/_rm.$$_ # Trap to clean up those temp files at exit. trap 'ret=$?; rm -f "$dsttmp" "$rmtmp" && exit $ret' 0 # Copy the file name to the temp name. (umask $cp_umask && $doit_exec $cpprog "$src" "$dsttmp") && # and set any options; do chmod last to preserve setuid bits. # # If any of these fail, we abort the whole thing. If we want to # ignore errors from any of these, just make sure not to ignore # errors from the above "$doit $cpprog $src $dsttmp" command. # { test -z "$chowncmd" || $doit $chowncmd "$dsttmp"; } && { test -z "$chgrpcmd" || $doit $chgrpcmd "$dsttmp"; } && { test -z "$stripcmd" || $doit $stripcmd "$dsttmp"; } && { test -z "$chmodcmd" || $doit $chmodcmd $mode "$dsttmp"; } && # If -C, don't bother to copy if it wouldn't change the file. if $copy_on_change && old=`LC_ALL=C ls -dlL "$dst" 2>/dev/null` && new=`LC_ALL=C ls -dlL "$dsttmp" 2>/dev/null` && eval "$initialize_posix_glob" && $posix_glob set -f && set X $old && old=:$2:$4:$5:$6 && set X $new && new=:$2:$4:$5:$6 && $posix_glob set +f && test "$old" = "$new" && $cmpprog "$dst" "$dsttmp" >/dev/null 2>&1 then rm -f "$dsttmp" else # Rename the file to the real destination. $doit $mvcmd -f "$dsttmp" "$dst" 2>/dev/null || # The rename failed, perhaps because mv can't rename something else # to itself, or perhaps because mv is so ancient that it does not # support -f. { # Now remove or move aside any old file at destination location. # We try this two ways since rm can't unlink itself on some # systems and the destination file might be busy for other # reasons. In this case, the final cleanup might fail but the new # file should still install successfully. { test ! -f "$dst" || $doit $rmcmd -f "$dst" 2>/dev/null || { $doit $mvcmd -f "$dst" "$rmtmp" 2>/dev/null && { $doit $rmcmd -f "$rmtmp" 2>/dev/null; :; } } || { echo "$0: cannot unlink or rename $dst" >&2 (exit 1); exit 1 } } && # Now rename the file to the real destination. $doit $mvcmd "$dsttmp" "$dst" } fi || exit 1 trap '' 0 fi done # Local variables: # eval: (add-hook 'write-file-hooks 'time-stamp) # time-stamp-start: "scriptversion=" # time-stamp-format: "%:y-%02m-%02d.%02H" # time-stamp-time-zone: "UTC" # time-stamp-end: "; # UTC" # End: #! /bin/sh # config/missing # This is *not* the GNU `missing' script, although it is similar in # concept. You can call it from the makefiles to get consistent # behavior when certain utility programs are missing. case $1 in flex|bison) # `missing flex|bison ' input=$2 output=$3 if test -f "$output"; then echo "\ *** WARNING: \`$1' is missing on your system. You should only need it if you changed the file \`$input'; these changes will not take effect. You can get $1 from a GNU mirror site. ***" >&2 echo "touch $output" touch "$output" exit 0 else # ! test -f $output echo "\ *** ERROR: \`$1' is missing on your system. It is needed to create the file \`$output'. You can either get $1 from a GNU mirror site or download an official distribution of PostgreSQL, which contains pre-packaged $1 output. ***" >&2 exit 1 fi ;; perl) # `missing perl' echo "\ *** ERROR: Perl is missing on your system. It is needed unless you are building from an unmodified official distribution of PostgreSQL. ***" >&2 exit 1 ;; *) # `missing something-or-other' echo "\ *** ERROR: \`$1' is missing on your system. ***" >&2 exit 1 ;; esac # -*-makefile-*- # src/Makefile.global.in # src/Makefile.global. Generated from Makefile.global.in by configure. #------------------------------------------------------------------------------ # All PostgreSQL makefiles include this file and use the variables it sets, # which in turn are put here by the configure script. There is no need for # users to edit this file -- if it turns out to be necessary then that's a # bug. # # A makefile that includes this file needs to set the variable `subdir' to # the relative path from the top to itself and `top_builddir' to the relative # path from itself to the top before including this file. (The "top" is the # parent directory of the directory this file is in.) #------------------------------------------------------------------------------ ########################################################################## # # Meta configuration standard_targets = all install installdirs uninstall clean distclean coverage check checkprep installcheck init-po update-po # these targets should recurse even into subdirectories not being built: standard_always_targets = clean distclean .PHONY: $(standard_targets) maintainer-clean install-strip html man installcheck-parallel update-unicode # make `all' the default target all: # Delete target files if the command fails after it has # started to update the file. .DELETE_ON_ERROR: # Never delete any intermediate files automatically. .SECONDARY: maintainer-clean: distclean # PostgreSQL version number VERSION = 17.5 MAJORVERSION = 17 VERSION_NUM = 170005 PACKAGE_URL = https://www.postgresql.org/ # Set top_srcdir, srcdir, and VPATH. ifdef PGXS top_srcdir = $(top_builddir) # If VPATH is set or Makefile is not in current directory we are building # the extension with VPATH so we set the variable here. ifdef VPATH srcdir = $(VPATH) else ifeq ($(CURDIR),$(dir $(firstword $(MAKEFILE_LIST)))) srcdir = . else srcdir = $(dir $(firstword $(MAKEFILE_LIST))) endif endif else # not PGXS vpath_build = no abs_top_builddir = /home/runner/work/pglite/pglite/postgres-pglite abs_top_srcdir = /home/runner/work/pglite/pglite/postgres-pglite ifneq ($(vpath_build),yes) top_srcdir = $(top_builddir) srcdir = . else # vpath_build = yes top_srcdir = $(abs_top_srcdir) srcdir = $(top_srcdir)/$(subdir) endif endif # not PGXS ########################################################################## # # Installation directories # # These are set by the equivalent --xxxdir configure options. We # append "postgresql" to some of them, if the string does not already # contain "pgsql" or "postgres", in order to avoid directory clutter. # # In a PGXS build, we cannot use the values inserted into Makefile.global # by configure, since the installation tree may have been relocated. # Instead get the path values from pg_config. ifndef PGXS # Note that prefix, exec_prefix, and datarootdir aren't defined in a PGXS build; # makefiles may only use the derived variables such as bindir. prefix := /install/pglite exec_prefix := ${prefix} datarootdir := ${prefix}/share bindir := ${exec_prefix}/bin datadir := ${datarootdir} ifeq "$(findstring pgsql, $(datadir))" "" ifeq "$(findstring postgres, $(datadir))" "" override datadir := $(datadir)/postgresql endif endif sysconfdir := ${prefix}/etc ifeq "$(findstring pgsql, $(sysconfdir))" "" ifeq "$(findstring postgres, $(sysconfdir))" "" override sysconfdir := $(sysconfdir)/postgresql endif endif libdir := ${exec_prefix}/lib pkglibdir = $(libdir) ifeq "$(findstring pgsql, $(pkglibdir))" "" ifeq "$(findstring postgres, $(pkglibdir))" "" override pkglibdir := $(pkglibdir)/postgresql endif endif includedir := ${prefix}/include pkgincludedir = $(includedir) ifeq "$(findstring pgsql, $(pkgincludedir))" "" ifeq "$(findstring postgres, $(pkgincludedir))" "" override pkgincludedir := $(pkgincludedir)/postgresql endif endif mandir := ${datarootdir}/man docdir := ${datarootdir}/doc/${PACKAGE_TARNAME} ifeq "$(findstring pgsql, $(docdir))" "" ifeq "$(findstring postgres, $(docdir))" "" override docdir := $(docdir)/postgresql endif endif htmldir := ${docdir} localedir := ${datarootdir}/locale else # PGXS case # Extension makefiles should set PG_CONFIG, but older ones might not ifndef PG_CONFIG PG_CONFIG = pg_config endif bindir := $(shell $(PG_CONFIG) --bindir) datadir := $(shell $(PG_CONFIG) --sharedir) sysconfdir := $(shell $(PG_CONFIG) --sysconfdir) libdir := $(shell $(PG_CONFIG) --libdir) pkglibdir := $(shell $(PG_CONFIG) --pkglibdir) includedir := $(shell $(PG_CONFIG) --includedir) pkgincludedir := $(shell $(PG_CONFIG) --pkgincludedir) mandir := $(shell $(PG_CONFIG) --mandir) docdir := $(shell $(PG_CONFIG) --docdir) localedir := $(shell $(PG_CONFIG) --localedir) endif # PGXS # These derived path variables aren't separately configurable. includedir_server = $(pkgincludedir)/server includedir_internal = $(pkgincludedir)/internal pgxsdir = $(pkglibdir)/pgxs bitcodedir = $(pkglibdir)/bitcode ########################################################################## # # Features # # Records the choice of the various --enable-xxx and --with-xxx options. with_icu = no with_perl = no with_python = no with_tcl = no with_ssl = no with_readline = no with_selinux = no with_systemd = no with_gssapi = no with_krb_srvnam = postgres with_ldap = no with_libxml = yes with_libxslt = yes with_llvm = no with_system_tzdata = with_uuid = ossp with_zlib = yes enable_rpath = yes enable_nls = no enable_debug = no enable_dtrace = no enable_coverage = no enable_injection_points = no enable_tap_tests = no python_includespec = python_libdir = python_libspec = python_additional_libs = python_majorversion = python_version = krb_srvtab = ICU_CFLAGS = ICU_LIBS = TCLSH = TCL_LIBS = TCL_LIB_SPEC = TCL_INCLUDE_SPEC = TCL_SHARED_BUILD = PTHREAD_CFLAGS = -pthread -D_REENTRANT -D_THREAD_SAFE PTHREAD_LIBS = LLVM_BINPATH = CLANG = BITCODE_CFLAGS = -O2 BITCODE_CXXFLAGS = -O2 ########################################################################## # # Programs and flags # Compilers CPP = /emsdk/upstream/emscripten/emcc -E CPPFLAGS = -D_GNU_SOURCE -D_GNU_SOURCE -D_GNU_SOURCE -D_GNU_SOURCE -I/install/libs/include -I/install/libs/include/libxml2 -I/home/runner/work/pglite/pglite/postgres-pglite/pglite/includes PG_SYSROOT = override CPPFLAGS := $(ICU_CFLAGS) $(CPPFLAGS) ifdef PGXS override CPPFLAGS := -I$(includedir_server) -I$(includedir_internal) $(CPPFLAGS) else # not PGXS override CPPFLAGS := -I$(top_srcdir)/src/include $(CPPFLAGS) ifdef VPATH override CPPFLAGS := -I$(top_builddir)/src/include $(CPPFLAGS) endif endif # not PGXS CC = /emsdk/upstream/emscripten/emcc GCC = yes SUN_STUDIO_CC = no CXX = /emsdk/upstream/emscripten/em++ CFLAGS = -Wall -Wmissing-prototypes -Wpointer-arith -Wdeclaration-after-statement -Werror=vla -Werror=unguarded-availability-new -Wendif-labels -Wmissing-format-attribute -Wcast-function-type -Wformat-security -fno-strict-aliasing -fwrapv -fexcess-precision=standard -Wno-unused-command-line-argument -Wno-compound-token-split-by-macro -Wno-format-truncation -Wno-cast-function-type-strict -O2 -sWASM_BIGINT -fpic -sENVIRONMENT=node,web,worker -sSUPPORT_LONGJMP=emscripten -Wno-declaration-after-statement -Wno-macro-redefined -Wno-unused-function -Wno-missing-prototypes -Wno-incompatible-pointer-types CFLAGS_SL = -fPIC # *_MODULE are for flags applied to extension libraries CFLAGS_SL_MODULE = -fvisibility=hidden CXXFLAGS_SL_MODULE = -fvisibility=hidden -fvisibility-inlines-hidden CFLAGS_UNROLL_LOOPS = -funroll-loops CFLAGS_VECTORIZE = -ftree-vectorize CFLAGS_POPCNT = CFLAGS_CRC = CFLAGS_XSAVE = PERMIT_DECLARATION_AFTER_STATEMENT = -Wno-declaration-after-statement CXXFLAGS = -Wall -Wpointer-arith -Werror=unguarded-availability-new -Wendif-labels -Wmissing-format-attribute -Wcast-function-type -Wformat-security -fno-strict-aliasing -fwrapv -fexcess-precision=standard -O2 LLVM_CPPFLAGS = LLVM_CFLAGS = LLVM_CXXFLAGS = # Kind-of compilers BISON = /usr/bin/bison BISONFLAGS = -Wno-deprecated $(YFLAGS) FLEX = /usr/bin/flex FLEXFLAGS = $(LFLAGS) DTRACE = DTRACEFLAGS = ZIC = # Linking AR = /emsdk/upstream/emscripten/emar AROPT = crs LIBS = -lxslt -lxml2 -lz -lm LDAP_LIBS_FE = LDAP_LIBS_BE = UUID_LIBS = -lossp-uuid LLVM_LIBS= # It's critical that within LDFLAGS, all -L switches pointing to build-tree # directories come before any -L switches pointing to external directories. # Otherwise it's possible for, e.g., a platform-provided copy of libpq.so # to get linked in place of the one we've built. Therefore we adopt the # convention that the first component of LDFLAGS is an extra variable # LDFLAGS_INTERNAL, and -L and -l switches for PG's own libraries must be # put into LDFLAGS_INTERNAL, so they will appear ahead of those for external # libraries. # # We need LDFLAGS and LDFLAGS_INTERNAL to be "recursively expanded" variables, # else adjustments to, e.g., rpathdir don't work right. So we must NOT do # "LDFLAGS := something" anywhere, ditto for LDFLAGS_INTERNAL. # These initial assignments must be "=" type, and elsewhere we must only do # "LDFLAGS += something" or "LDFLAGS_INTERNAL += something". ifdef PGXS LDFLAGS_INTERNAL = -L$(libdir) else LDFLAGS_INTERNAL = -L$(top_builddir)/src/port -L$(top_builddir)/src/common endif LDFLAGS = $(LDFLAGS_INTERNAL) -sWASM_BIGINT -sUSE_PTHREADS=0 -L/install/libs/lib LDFLAGS_EX = -sWASM_BIGINT -sSUPPORT_LONGJMP=emscripten -sFORCE_FILESYSTEM=1 -sNO_EXIT_RUNTIME=0 -sENVIRONMENT=node,web,worker -sMAIN_MODULE=2 -sMODULARIZE=1 -sEXPORT_ES6=1 -sEXPORT_NAME=Module -sALLOW_TABLE_GROWTH -sALLOW_MEMORY_GROWTH -sERROR_ON_UNDEFINED_SYMBOLS=0 -sEXPORTED_RUNTIME_METHODS=addFunction,removeFunction,FS,MEMFS -sTOTAL_MEMORY=32MB --embed-file /home/runner/work/pglite/pglite/postgres-pglite/other/PGPASSFILE@/home/web_user/.pgpass LDFLAGS_EX_BE = -Wl,--export-dynamic # LDFLAGS_SL might have already been assigned by calling makefile LDFLAGS_SL += -sSIDE_MODULE=1 WINDRES = X = .js # Perl # quoted to protect pathname with spaces PERL = '/usr/bin/perl' perl_archlibexp = perl_privlibexp = perl_includespec = perl_embed_ccflags = perl_embed_ldflags = # Miscellaneous AWK = mawk LN_S = ln -s MSGFMT = MSGFMT_FLAGS = MSGMERGE = OPENSSL = /usr/bin/openssl PYTHON = TAR = /usr/bin/tar XGETTEXT = GZIP = gzip BZIP2 = bzip2 LZ4 = ZSTD = DOWNLOAD = wget -O $@ --no-use-server-timestamps #DOWNLOAD = curl -o $@ # Unicode data information # Before each major release, update these and run make update-unicode. # Pick a release from here: . Note # that the most recent release listed there is often a pre-release; # don't pick that one, except for testing. UNICODE_VERSION = 15.1.0 # Pick a release from here: CLDR_VERSION = 45 # Tree-wide build support # Just about every code subdirectory wants to have the generated headers # available before building, but we don't want parallel makes all trying # to build the same headers. These rules, together with the recursion rules # below, ensure that we update the generated headers once, if needed, # at the top level of any "make all/install/check/installcheck" request. # If a particular subdirectory knows this isn't needed in itself or its # children, it can set NO_GENERATED_HEADERS. all install check installcheck: submake-generated-headers .PHONY: submake-generated-headers submake-generated-headers: ifndef NO_GENERATED_HEADERS ifeq ($(MAKELEVEL),0) $(MAKE) -C $(top_builddir)/src/backend generated-headers endif endif # Testing # In much the same way as above, these rules ensure that we build a temp # install tree just once in any recursive "make check". The additional test # on abs_top_builddir prevents doing anything foolish to the root directory. check: temp-install .PHONY: temp-install # prepend to path if already set, else just set it define add_to_path $(1)="$(if $($(1)),$(2):$$$(1),$(2))" endef # platform-specific environment variable to set shared library path # individual ports can override this later, this is the default name ld_library_path_var = LD_LIBRARY_PATH # with_temp_install_extra is for individual ports to define if they # need something more here. If not defined then the expansion does # nothing. with_temp_install = \ PATH="$(abs_top_builddir)/tmp_install$(bindir):$(CURDIR):$$PATH" \ $(call add_to_path,$(strip $(ld_library_path_var)),$(abs_top_builddir)/tmp_install$(libdir)) \ INITDB_TEMPLATE='$(abs_top_builddir)'/tmp_install/initdb-template \ $(with_temp_install_extra) temp-install: | submake-generated-headers ifndef NO_TEMP_INSTALL ifneq ($(abs_top_builddir),) ifeq ($(MAKELEVEL),0) rm -rf '$(abs_top_builddir)'/tmp_install $(MKDIR_P) '$(abs_top_builddir)'/tmp_install/log $(MAKE) -C '$(top_builddir)' DESTDIR='$(abs_top_builddir)'/tmp_install install >'$(abs_top_builddir)'/tmp_install/log/install.log 2>&1 $(MAKE) -j1 $(if $(CHECKPREP_TOP),-C $(CHECKPREP_TOP),) checkprep >>'$(abs_top_builddir)'/tmp_install/log/install.log 2>&1 $(with_temp_install) initdb --auth trust --no-sync --no-instructions --lc-messages=C --no-clean '$(abs_top_builddir)'/tmp_install/initdb-template >>'$(abs_top_builddir)'/tmp_install/log/initdb-template.log 2>&1 endif endif endif # Tasks to run serially at the end of temp-install. Some EXTRA_INSTALL # entries appear more than once in the tree, and parallel installs of the same # file can fail with EEXIST. checkprep: $(if $(EXTRA_INSTALL),for extra in $(EXTRA_INSTALL); do $(MAKE) -C '$(top_builddir)'/$$extra DESTDIR='$(abs_top_builddir)'/tmp_install install || exit; done) PROVE = # There are common routines in src/test/perl, and some test suites have # extra perl modules in their own directory. PG_PROVE_FLAGS = -I $(top_srcdir)/src/test/perl/ -I $(srcdir) # User-supplied prove flags such as --verbose can be provided in PROVE_FLAGS. PROVE_FLAGS = ifeq ($(enable_tap_tests),yes) ifndef PGXS define prove_installcheck echo "# +++ tap install-check in $(subdir) +++" && \ rm -rf '$(CURDIR)'/tmp_check && \ $(MKDIR_P) '$(CURDIR)'/tmp_check && \ cd $(srcdir) && \ TESTLOGDIR='$(CURDIR)/tmp_check/log' \ TESTDATADIR='$(CURDIR)/tmp_check' \ PATH="$(bindir):$(CURDIR):$$PATH" \ PGPORT='6$(DEF_PGPORT)' top_builddir='$(CURDIR)/$(top_builddir)' \ PG_REGRESS='$(CURDIR)/$(top_builddir)/src/test/regress/pg_regress' \ $(PROVE) $(PG_PROVE_FLAGS) $(PROVE_FLAGS) $(if $(PROVE_TESTS),$(PROVE_TESTS),t/*.pl) endef else # PGXS case define prove_installcheck echo "# +++ tap install-check in $(subdir) +++" && \ rm -rf '$(CURDIR)'/tmp_check && \ $(MKDIR_P) '$(CURDIR)'/tmp_check && \ cd $(srcdir) && \ TESTLOGDIR='$(CURDIR)/tmp_check/log' \ TESTDATADIR='$(CURDIR)/tmp_check' \ PATH="$(bindir):$(CURDIR):$$PATH" \ PGPORT='6$(DEF_PGPORT)' \ PG_REGRESS='$(top_builddir)/src/test/regress/pg_regress' \ $(PROVE) $(PG_PROVE_FLAGS) $(PROVE_FLAGS) $(if $(PROVE_TESTS),$(PROVE_TESTS),t/*.pl) endef endif # PGXS define prove_check echo "# +++ tap check in $(subdir) +++" && \ rm -rf '$(CURDIR)'/tmp_check && \ $(MKDIR_P) '$(CURDIR)'/tmp_check && \ cd $(srcdir) && \ TESTLOGDIR='$(CURDIR)/tmp_check/log' \ TESTDATADIR='$(CURDIR)/tmp_check' \ $(with_temp_install) \ PGPORT='6$(DEF_PGPORT)' top_builddir='$(CURDIR)/$(top_builddir)' \ PG_REGRESS='$(CURDIR)/$(top_builddir)/src/test/regress/pg_regress' \ $(PROVE) $(PG_PROVE_FLAGS) $(PROVE_FLAGS) $(if $(PROVE_TESTS),$(PROVE_TESTS),t/*.pl) endef else prove_installcheck = @echo "TAP tests not enabled. Try configuring with --enable-tap-tests" prove_check = $(prove_installcheck) endif # Installation. install_bin = /usr/bin/install -c install_sh = $(SHELL) $(top_srcdir)/config/install-sh -c INSTALL = $(if $(use_install_sh),$(install_sh),$(if $(install_bin),$(install_bin),$(install_sh))) INSTALL_SCRIPT_MODE = 755 INSTALL_DATA_MODE = 644 INSTALL_PROGRAM = $(INSTALL_PROGRAM_ENV) $(INSTALL) $(INSTALL_STRIP_FLAG) INSTALL_SCRIPT = $(INSTALL) -m $(INSTALL_SCRIPT_MODE) INSTALL_DATA = $(INSTALL) -m $(INSTALL_DATA_MODE) INSTALL_STLIB = $(INSTALL_STLIB_ENV) $(INSTALL_DATA) $(INSTALL_STRIP_FLAG) INSTALL_SHLIB = $(INSTALL_SHLIB_ENV) $(INSTALL) $(INSTALL_SHLIB_OPTS) $(INSTALL_STRIP_FLAG) # Override in Makefile.port if necessary INSTALL_SHLIB_OPTS = -m 755 MKDIR_P = /usr/bin/mkdir -p missing = $(SHELL) $(top_srcdir)/config/missing STRIP = strip STRIP_STATIC_LIB = strip --strip-unneeded STRIP_SHARED_LIB = strip --strip-unneeded # Documentation DBTOEPUB = FOP = XMLLINT = XSLTPROC = # Code coverage GCOV = LCOV = GENHTML = # Feature settings DEF_PGPORT = 5432 WANTED_LANGUAGES = ########################################################################## # # Additional platform-specific settings # # Name of the "template" PORTNAME= emscripten build_os = linux-gnu host_tuple = aarch64-unknown-linux-gnu host_os = linux-gnu host_cpu = aarch64 # Backend stack size limit has to be hard-wired on Windows (it's in bytes) WIN32_STACK_RLIMIT=4194304 DLSUFFIX = .so # Pull in platform-specific magic include $(top_builddir)/src/Makefile.port # Set up rpath if enabled. By default it will point to our libdir, # but individual Makefiles can force other rpath paths if needed. rpathdir = $(libdir) ifeq ($(enable_rpath), yes) LDFLAGS += $(rpath) endif # Show the DLSUFFIX to build scripts (e.g. buildfarm) .PHONY: show_dl_suffix show_dl_suffix: @echo $(DLSUFFIX) ########################################################################## # # Some variables needed to find some client interfaces ifdef PGXS # some contribs assumes headers and libs are in the source tree... libpq_srcdir = $(includedir) libpq_builddir = $(libdir) else libpq_srcdir = $(top_srcdir)/src/interfaces/libpq libpq_builddir = $(top_builddir)/src/interfaces/libpq endif # How to link to libpq. (This macro may be used as-is by backend extensions. # Client-side code should go through libpq_pgport or libpq_pgport_shlib, # instead.) libpq = -L$(libpq_builddir) -lpq # libpq_pgport is for use by client executables (not libraries) that use libpq. # We used to use this to force libpgport and libpgcommon to be linked before # libpq, ensuring that clients would pull symbols from those libraries rather # than possibly getting them from libpq (and thereby having an unwanted # dependency on which symbols libpq uses). However, now that we can prevent # libpq from exporting those symbols on all platforms of interest, we don't # worry about that anymore. The previous technique resulted in duplicate # libraries in link commands, since those libraries also appear in $(LIBS). # Some platforms warn about that, so avoiding those warnings is now more # important. Hence, $(libpq_pgport) is now equivalent to $(libpq), but we # still recommend using it for client executables in case some other reason # appears to handle them differently. libpq_pgport = $(libpq) # libpq_pgport_shlib is the same idea, but for use in client shared libraries. # We need those clients to use the shlib variants. (Ideally, users of this # macro would strip libpgport and libpgcommon from $(LIBS), but no harm is # done if they don't, since they will have satisfied all their references # from these libraries.) ifdef PGXS libpq_pgport_shlib = -L$(libdir) -lpgcommon_shlib -lpgport_shlib $(libpq) else libpq_pgport_shlib = -L$(top_builddir)/src/common -lpgcommon_shlib -L$(top_builddir)/src/port -lpgport_shlib $(libpq) endif # Cygwin seems to need ldap libraries to be mentioned here, too ifeq ($(PORTNAME),cygwin) libpq_pgport += $(LDAP_LIBS_FE) endif ########################################################################## # # Commonly used submake targets submake-libpq: | submake-generated-headers $(MAKE) -C $(libpq_builddir) all submake-libpgport: | submake-generated-headers $(MAKE) -C $(top_builddir)/src/port all $(MAKE) -C $(top_builddir)/src/common all submake-libpgfeutils: | submake-generated-headers $(MAKE) -C $(top_builddir)/src/port all $(MAKE) -C $(top_builddir)/src/common all $(MAKE) -C $(top_builddir)/src/fe_utils all .PHONY: submake-libpq submake-libpgport submake-libpgfeutils ########################################################################## # # Testing support ifneq ($(USE_MODULE_DB),) PL_TESTDB = pl_regression_$(NAME) ifneq ($(MODULE_big),) CONTRIB_TESTDB=contrib_regression_$(MODULE_big) ISOLATION_TESTDB=isolation_regression_$(MODULE_big) else ifneq ($(MODULES),) CONTRIB_TESTDB=contrib_regression_$(word 1,$(MODULES)) ISOLATION_TESTDB=isolation_regression_$(word 1,$(MODULES)) else CONTRIB_TESTDB=contrib_regression_$(word 1,$(REGRESS)) ISOLATION_TESTDB=isolation_regression_$(word 1,$(ISOLATION)) endif endif else PL_TESTDB = pl_regression CONTRIB_TESTDB = contrib_regression ISOLATION_TESTDB = isolation_regression endif ifdef NO_LOCALE NOLOCALE += --no-locale endif # file with extra config for temp build TEMP_CONF = ifdef TEMP_CONFIG TEMP_CONF += --temp-config=$(TEMP_CONFIG) endif pg_regress_locale_flags = $(if $(ENCODING),--encoding=$(ENCODING)) $(NOLOCALE) pg_regress_clean_files = results/ regression.diffs regression.out tmp_check/ tmp_check_iso/ log/ output_iso/ pg_regress_check = \ echo "\# +++ regress check in $(subdir) +++" && \ $(with_temp_install) \ $(top_builddir)/src/test/regress/pg_regress \ --temp-instance=./tmp_check \ --inputdir=$(srcdir) \ --bindir= \ $(TEMP_CONF) \ $(pg_regress_locale_flags) $(EXTRA_REGRESS_OPTS) pg_regress_installcheck = \ echo "\# +++ regress install-check in $(subdir) +++" && \ $(top_builddir)/src/test/regress/pg_regress \ --inputdir=$(srcdir) \ --bindir='$(bindir)' \ $(pg_regress_locale_flags) $(EXTRA_REGRESS_OPTS) pg_isolation_regress_check = \ echo "\# +++ isolation check in $(subdir) +++" && \ $(with_temp_install) \ $(top_builddir)/src/test/isolation/pg_isolation_regress \ --temp-instance=./tmp_check_iso \ --inputdir=$(srcdir) --outputdir=output_iso \ --bindir= \ $(TEMP_CONF) \ $(pg_regress_locale_flags) $(EXTRA_REGRESS_OPTS) pg_isolation_regress_installcheck = \ echo "\# +++ isolation install-check in $(subdir) +++" && \ $(top_builddir)/src/test/isolation/pg_isolation_regress \ --inputdir=$(srcdir) --outputdir=output_iso \ --bindir='$(bindir)' \ $(pg_regress_locale_flags) $(EXTRA_REGRESS_OPTS) ########################################################################## # # Customization # # This includes your local customizations if Makefile.custom exists # in the source directory. This file doesn't exist in the original # distribution so that it doesn't get overwritten when you upgrade. # # NOTE: Makefile.custom is from the pre-Autoconf days of PostgreSQL. # You are liable to shoot yourself in the foot if you use it without # knowing exactly what you're doing. The preferred (and more # reliable) method is to communicate what you want to do to the # configure script, and leave the makefiles alone. -include $(top_srcdir)/src/Makefile.custom ifneq ($(CUSTOM_INSTALL),) INSTALL= $(CUSTOM_INSTALL) endif ifneq ($(CUSTOM_CC),) CC= $(CUSTOM_CC) endif ifneq ($(CUSTOM_COPT),) COPT= $(CUSTOM_COPT) endif # # These variables are meant to be set in the environment of "make" # to add flags to whatever configure picked. Unlike the ones above, # they are documented. # ifdef COPT CFLAGS += $(COPT) LDFLAGS += $(COPT) endif ifdef PROFILE CFLAGS += $(PROFILE) LDFLAGS += $(PROFILE) endif ########################################################################## # # substitute implementations of C library routines (see src/port/) # note we already included -L.../src/port in LDFLAGS above LIBOBJS = ${LIBOBJDIR}getpeereid$U.o # files needed for the chosen CRC-32C implementation PG_CRC32C_OBJS = pg_crc32c_sb8.o # files needed for the chosen popcount implementation PG_POPCNT_OBJS = LIBS := -lpgcommon -lpgport $(LIBS) # to make ws2_32.lib the last library ifeq ($(PORTNAME),win32) LIBS += -lws2_32 endif # Not really standard libc functions, used by the backend. TAS = ########################################################################## # # Global targets and rules %.c: %.l $(FLEX) $(if $(FLEX_NO_BACKUP),-b) $(FLEXFLAGS) -o'$@' $< @$(if $(FLEX_NO_BACKUP),if [ `wc -l &2; exit 1; fi) $(if $(FLEX_FIX_WARNING),$(PERL) $(top_srcdir)/src/tools/fix-old-flex-code.pl '$@') %.c: %.y $(if $(BISON_CHECK_CMD),$(BISON_CHECK_CMD)) $(BISON) $(BISONFLAGS) -o $@ $< %.i: %.c $(CPP) $(CPPFLAGS) -o $@ $< %.gz: % $(GZIP) --best -c $< >$@ %.bz2: % $(BZIP2) -c $< >$@ # Direct builds of foo.c -> foo are disabled to avoid generating # *.dSYM junk on Macs. All builds should normally go through the # foo.c -> foo.o -> foo steps. This also ensures that dependency # tracking (see below) is used. %: %.c # Replace gmake's default rule for linking a single .o file to produce an # executable. The main point here is to put LDFLAGS after the .o file, # since we put -l switches into LDFLAGS and those are order-sensitive. # In addition, include CFLAGS and LDFLAGS_EX per project conventions. %: %.o $(CC) $(CFLAGS) $^ $(LDFLAGS) $(LDFLAGS_EX) $(LIBS) -o $@$(X) ifndef PGXS # Remake Makefile.global from Makefile.global.in if the latter # changed. In order to trigger this rule, the including file must # write `include $(top_builddir)/src/Makefile.global', not some # shortcut thereof. $(top_builddir)/src/Makefile.global: $(top_srcdir)/src/Makefile.global.in $(top_builddir)/config.status cd $(top_builddir) && ./config.status src/Makefile.global # Remake pg_config.h from pg_config.h.in if the latter changed. # config.status will not change the timestamp on pg_config.h if it # doesn't change, so as to avoid recompiling the entire tree # unnecessarily. Therefore we make config.status update a timestamp file # stamp-h every time it runs, so that we don't trigger this rule every time. # (We do trigger the null rule for stamp-h to pg_config.h every time; so it's # important for that rule to be empty!) # # Of course you need to turn on dependency tracking to get any # dependencies on pg_config.h. $(top_builddir)/src/include/pg_config.h: $(top_builddir)/src/include/stamp-h ; $(top_builddir)/src/include/stamp-h: $(top_srcdir)/src/include/pg_config.h.in $(top_builddir)/config.status cd $(top_builddir) && ./config.status src/include/pg_config.h # Also remake pg_config_ext.h from pg_config_ext.h.in, same logic as above. $(top_builddir)/src/include/pg_config_ext.h: $(top_builddir)/src/include/stamp-ext-h ; $(top_builddir)/src/include/stamp-ext-h: $(top_srcdir)/src/include/pg_config_ext.h.in $(top_builddir)/config.status cd $(top_builddir) && ./config.status src/include/pg_config_ext.h # Also remake ecpg_config.h from ecpg_config.h.in if the latter changed, same # logic as above. $(top_builddir)/src/interfaces/ecpg/include/ecpg_config.h: $(top_builddir)/src/interfaces/ecpg/include/stamp-h ; $(top_builddir)/src/interfaces/ecpg/include/stamp-h: $(top_builddir)/src/interfaces/ecpg/include/ecpg_config.h.in $(top_builddir)/config.status cd $(top_builddir) && ./config.status src/interfaces/ecpg/include/ecpg_config.h # When configure changes, rerun configure with the same options as # last time. To change configure, you need to run autoconf manually. $(top_builddir)/config.status: $(top_srcdir)/configure cd $(top_builddir) && ./config.status --recheck endif # not PGXS install-strip: # install-strip always uses install-sh, so that strip options can be # passed. $(MAKE) use_install_sh=yes \ INSTALL_PROGRAM_ENV="STRIPPROG='$(STRIP)'" \ INSTALL_STLIB_ENV="STRIPPROG='$(STRIP_STATIC_LIB)'" \ INSTALL_SHLIB_ENV="STRIPPROG='$(STRIP_SHARED_LIB)'" \ INSTALL_STRIP_FLAG=-s \ install ########################################################################## # # Recursive make support # ---------------------- # Instead of recursing through subdirectories with a for loop or # repeated $(MAKE) -C whatever calls, this is a little smarter: it # allows parallel make across directories and lets make -k and -q work # correctly. # We need the ability to export target-specific variables, which was # added in GNU make 3.81. That also happens to be the version # where the .FEATURES variable was introduced, so this is a simple check. ifndef .FEATURES $(error GNU make 3.81 or newer is required. You are using version $(MAKE_VERSION)) endif # This function is only for internal use below. It should be called # using $(eval). It will set up a target so that it recurses into a # given subdirectory. For the tree-wide all/install/check/installcheck cases, # ensure we do our one-time tasks before recursing (see targets above). # Note that to avoid a nasty bug in make 3.80, # this function was written to not use any complicated constructs (like # multiple targets on a line) and also not contain any lines that expand # to more than about 200 bytes. This is why we make it apply to just one # subdirectory at a time, rather than to a list of subdirectories. # $1: target name, e.g., all # $2: subdir name # $3: target to run in subdir, usually same as $1 define _create_recursive_target .PHONY: $(1)-$(2)-recurse $(1): $(1)-$(2)-recurse $(1)-$(2)-recurse: $(if $(filter all install check installcheck, $(3)), submake-generated-headers) $(if $(filter check, $(3)), temp-install) $$(MAKE) -C $(2) $(3) endef # Note that the use of $$ on the last line above is important; we want # $(MAKE) to be evaluated when the rule is run, not when the $(eval) is run # to create the rule. This is necessary to get make -q working. # Call this function in a makefile that needs to recurse into subdirectories. # In the normal case all arguments can be defaulted. # $1: targets to make recursive (defaults to list of standard targets) # $2: list of subdirs (defaults to SUBDIRS variable) # $3: target to run in subdir (defaults to current element of $1) recurse = $(foreach target,$(if $1,$1,$(standard_targets)),$(foreach subdir,$(if $2,$2,$(SUBDIRS)),$(eval $(call _create_recursive_target,$(target),$(subdir),$(if $3,$3,$(target)))))) # If a makefile's list of SUBDIRS varies depending on configuration, then # any subdirectories excluded from SUBDIRS should instead be added to # ALWAYS_SUBDIRS, and then it must call recurse_always as well as recurse. # This ensures that distclean, etc will apply to all subdirectories. # In the normal case all arguments will be defaulted. # $1: targets to make recursive (defaults to standard_always_targets) # $2: list of subdirs (defaults to ALWAYS_SUBDIRS variable) # $3: target to run in subdir (defaults to current element of $1) recurse_always = $(foreach target,$(if $1,$1,$(standard_always_targets)),$(foreach subdir,$(if $2,$2,$(ALWAYS_SUBDIRS)),$(eval $(call _create_recursive_target,$(target),$(subdir),$(if $3,$3,$(target)))))) ########################################################################## # # Automatic dependency generation # ------------------------------- # When we configure with --enable-depend then we override the default # compilation rule with the magic below. While or after creating the # actual output file we also create a dependency list for the .c file. # Next time we invoke make we will have top-notch information about # whether this file needs to be updated. The dependency files are kept # in the .deps subdirectory of each directory. autodepend = ifeq ($(autodepend), yes) ifndef COMPILE.c COMPILE.c = $(CC) $(CFLAGS) $(CPPFLAGS) -c endif ifndef COMPILE.cc COMPILE.cc = $(CXX) $(CXXFLAGS) $(CPPFLAGS) -c endif DEPDIR = .deps ifeq ($(GCC), yes) # GCC allows us to create object and dependency file in one invocation. %.o : %.c @if test ! -d $(DEPDIR); then mkdir -p $(DEPDIR); fi $(COMPILE.c) -o $@ $< -MMD -MP -MF $(DEPDIR)/$(*F).Po %.o : %.cpp @if test ! -d $(DEPDIR); then mkdir -p $(DEPDIR); fi $(COMPILE.cc) -o $@ $< -MMD -MP -MF $(DEPDIR)/$(*F).Po endif # GCC # Include all the dependency files generated for the current # directory. Note that make would complain if include was called with # no arguments. Po_files := $(wildcard $(DEPDIR)/*.Po) ifneq (,$(Po_files)) include $(Po_files) endif # hook for clean-up clean distclean: clean-deps .PHONY: clean-deps clean-deps: @rm -rf $(DEPDIR) endif # autodepend ########################################################################## # # Native language support ifeq ($(enable_nls), yes) ifneq (,$(wildcard $(srcdir)/nls.mk)) include $(top_srcdir)/src/nls-global.mk endif # nls.mk endif # enable_nls ########################################################################## # # Coverage # Explanation of involved files: # foo.c source file # foo.o object file # foo.gcno gcov graph (a.k.a. "notes") file, created at compile time # (by gcc -ftest-coverage) # foo.gcda gcov data file, created when the program is run (for # programs compiled with gcc -fprofile-arcs) # foo.c.gcov gcov output file with coverage information, created by # gcov from foo.gcda (by "make coverage") # foo.c.gcov.out stdout captured when foo.c.gcov is created, mildly # interesting # lcov_test.info # lcov tracefile, built from gcda files in one directory, # later collected by "make coverage-html" # lcov_base.info # tracefile for zero counters for every file, so that # even files that are not touched by tests are counted # for the overall coverage rate ifeq ($(enable_coverage), yes) # make coverage -- text output local_gcda_files = $(wildcard *.gcda) coverage: $(local_gcda_files:.gcda=.c.gcov) %.c.gcov: %.gcda $(GCOV) -b -f -p -o . $(GCOVFLAGS) $*.c >$*.c.gcov.out # make coverage-html -- HTML output via lcov .PHONY: coverage-html coverage-html: coverage-html-stamp GENHTML_FLAGS = -q --legend GENHTML_TITLE = PostgreSQL $(VERSION) coverage-html-stamp: lcov_base.info lcov_test.info rm -rf coverage $(GENHTML) $(GENHTML_FLAGS) -o coverage --title='$(GENHTML_TITLE)' --num-spaces=4 $(if $(filter no,$(vpath_build)),--prefix='$(abs_top_srcdir)') $^ touch $@ LCOV += --gcov-tool $(GCOV) LCOVFLAGS = -q --no-external all_gcno_files = $(shell find . -name '*.gcno' -print) lcov_base.info: $(all_gcno_files) $(LCOV) $(LCOVFLAGS) -c -i -d . -d $(srcdir) -o $@ all_gcda_files = $(shell find . -name '*.gcda' -print) lcov_test.info: $(all_gcda_files) $(LCOV) $(LCOVFLAGS) -c -d . -d $(srcdir) -o $@ # hook for clean-up clean distclean: clean-coverage .PHONY: clean-coverage clean-coverage: rm -rf coverage coverage-html-stamp rm -f *.gcda *.gcno lcov*.info *.gcov .*.gcov *.gcov.out # User-callable target to reset counts between test runs coverage-clean: rm -f `find . -name '*.gcda' -print` endif # enable_coverage ########################################################################## # # LLVM support # ifndef COMPILE.c.bc # -Wno-ignored-attributes added so gnu_printf doesn't trigger # warnings, when the main binary is compiled with C. COMPILE.c.bc = $(CLANG) -Wno-ignored-attributes $(BITCODE_CFLAGS) $(CPPFLAGS) -flto=thin -emit-llvm -c endif ifndef COMPILE.cxx.bc COMPILE.cxx.bc = $(CLANG) -xc++ -Wno-ignored-attributes $(BITCODE_CXXFLAGS) $(CPPFLAGS) -flto=thin -emit-llvm -c endif %.bc : %.c $(COMPILE.c.bc) -o $@ $< %.bc : %.cpp $(COMPILE.cxx.bc) -o $@ $< # Install LLVM bitcode module (for JITing). # # The arguments are: # $(1) name of the module (e.g. an extension's name or postgres for core code) # $(2) source objects, with .o suffix # # The many INSTALL_DATA invocations aren't particularly fast, it'd be # good if we could coalesce them, but I didn't find a good way. # # Note: blank line at end of macro is necessary to let it be used in foreach define install_llvm_module $(MKDIR_P) '$(DESTDIR)${bitcodedir}/$(1)' $(MKDIR_P) $(sort $(dir $(addprefix '$(DESTDIR)${bitcodedir}'/$(1)/, $(2)))) $(foreach obj, ${2}, $(INSTALL_DATA) $(patsubst %.o,%.bc, $(obj)) '$(DESTDIR)${bitcodedir}'/$(1)/$(dir $(obj)) ) cd '$(DESTDIR)${bitcodedir}' && $(LLVM_BINPATH)/llvm-lto -thinlto -thinlto-action=thinlink -o $(1).index.bc $(addprefix $(1)/,$(patsubst %.o,%.bc, $(2))) endef # Uninstall LLVM bitcode module. # # The arguments are: # $(1) name of the module (e.g. an extension's name or postgres for core code) # # This intentionally doesn't use the explicit installed file list, # seems too likely to change regularly. define uninstall_llvm_module rm -rf '$(DESTDIR)${bitcodedir}/$(1)/' rm -f '$(DESTDIR)${bitcodedir}/$(1).index.bc' endef # Use --enable-new-dtags to generate DT_RUNPATH instead of DT_RPATH. # This allows LD_LIBRARY_PATH to still work when needed. rpath = AROPT = crs # Rule for building a shared library from a single .o file %.so: %.o $(CC) $(CFLAGS) $< $(LDFLAGS) $(LDFLAGS_SL) -shared -o $@ # Use --enable-new-dtags to generate DT_RUNPATH instead of DT_RPATH. # This allows LD_LIBRARY_PATH to still work when needed. rpath = AROPT = crs # Rule for building a shared library from a single .o file %.so: %.o $(CC) $(CFLAGS) $< $(LDFLAGS) $(LDFLAGS_SL) -shared -o $@ emscripten_include_dir := $(pkgincludedir)/emscripten emscripten_base_dir := $(emscripten_include_dir)/base emscripten_imports_dir := $(emscripten_base_dir)/imports emscripten_extension_dir := $(emscripten_include_dir)/extension emscripten_extension_imports_dir := $(emscripten_extension_dir)/imports#------------------------------------------------------------------------- # # Makefile.shlib # Common rules for building shared libraries # # Copyright (c) 1998, Regents of the University of California # # IDENTIFICATION # src/Makefile.shlib # #------------------------------------------------------------------------- # This file should be included by any Postgres module Makefile that # wants to build a shared library (if possible for the current # platform). A static library is also built from the same object # files. Only one library can be built per makefile. # # Before including this file, the module Makefile must define these # variables: # # NAME Name of library to build (no suffix nor "lib" prefix) # OBJS List of object files to include in library # SHLIB_LINK Stuff to append to library's link command # (typically, -L and -l switches for external libraries) # SHLIB_LINK_INTERNAL -L and -l switches for Postgres-supplied libraries # SHLIB_PREREQS Order-only prerequisites for library build target # SHLIB_EXPORTS (optional) Name of file containing list of symbols to # export, in the format "function_name number" # # Don't use SHLIB_LINK for references to files in the build tree, or the # wrong things will happen --- use SHLIB_LINK_INTERNAL for those! # # When building a shared library, the following version information # must also be set. It should be omitted when building a dynamically # loadable module. # # SO_MAJOR_VERSION Major version number to use for shared library # SO_MINOR_VERSION Minor version number to use for shared library # (If you want a patchlevel, include it in SO_MINOR_VERSION, e.g., "6.2".) # # The module Makefile must also include # $(top_builddir)/src/Makefile.global before including this file. # (Makefile.global sets PORTNAME and other needed symbols.) # # This makefile provides the following (phony) targets: # # all-lib build the static and shared (if applicable) libraries # install-lib install the libraries into $(libdir) # installdirs-lib create installation directory $(libdir) # uninstall-lib remove the libraries from $(libdir) # clean-lib delete the static and shared libraries from the build dir # # Typically you would add `all-lib' to the `all' target so that `make all' # builds the libraries. In the most simple case it would look like this: # # all: all-lib # # Similarly, the install rule might look like # # install: install-lib # # plus any additional things you want to install. Et cetera. # # Got that? Look at src/interfaces/libpq/Makefile for an example. # COMPILER = $(CC) $(CFLAGS) LINK.static = $(AR) $(AROPT) LDFLAGS_INTERNAL += $(SHLIB_LINK_INTERNAL) ifdef SO_MAJOR_VERSION # Default library naming convention used by the majority of platforms shlib = lib$(NAME)$(DLSUFFIX).$(SO_MAJOR_VERSION).$(SO_MINOR_VERSION) shlib_major = lib$(NAME)$(DLSUFFIX).$(SO_MAJOR_VERSION) shlib_bare = lib$(NAME)$(DLSUFFIX) # Testing the soname variable is a reliable way to determine whether a # linkable library is being built. soname = $(shlib_major) pkgconfigdir = $(libdir)/pkgconfig else # Naming convention for dynamically loadable modules shlib = $(NAME)$(DLSUFFIX) endif stlib = lib$(NAME).a ifndef soname # additional flags for backend modules SHLIB_LINK += $(BE_DLLLIBS) endif # For each platform we support shared libraries on, set shlib to the # name of the library (if default above is not right), set # LINK.shared to the command to link the library, # and adjust SHLIB_LINK if necessary. # Try to keep the sections in some kind of order, folks... override CFLAGS += $(CFLAGS_SL) override CXXFLAGS += $(CFLAGS_SL) ifdef SO_MAJOR_VERSION # libraries ought to use this to refer to versioned gettext domain names override CPPFLAGS += -DSO_MAJOR_VERSION=$(SO_MAJOR_VERSION) endif ifeq ($(PORTNAME), darwin) ifdef soname # linkable library ifneq ($(SO_MAJOR_VERSION), 0) version_link = -compatibility_version $(SO_MAJOR_VERSION) -current_version $(SO_MAJOR_VERSION).$(SO_MINOR_VERSION) endif LINK.shared = $(COMPILER) -dynamiclib -install_name '$(libdir)/lib$(NAME).$(SO_MAJOR_VERSION)$(DLSUFFIX)' $(version_link) $(exported_symbols_list) shlib = lib$(NAME).$(SO_MAJOR_VERSION)$(DLSUFFIX) shlib_major = lib$(NAME).$(SO_MAJOR_VERSION)$(DLSUFFIX) else # loadable module LINK.shared = $(COMPILER) -bundle endif BUILD.exports = $(AWK) '/^[^\#]/ {printf "_%s\n",$$1}' $< >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) exported_symbols_list = -exported_symbols_list $(exports_file) endif endif ifeq ($(PORTNAME), openbsd) LINK.shared = $(COMPILER) -shared ifdef soname LINK.shared += -Wl,-x,-soname,$(soname) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) LINK.shared += -Wl,--version-script=$(exports_file) endif SHLIB_LINK += -lc endif ifeq ($(PORTNAME), freebsd) ifdef SO_MAJOR_VERSION shlib = lib$(NAME)$(DLSUFFIX).$(SO_MAJOR_VERSION) endif LINK.shared = $(COMPILER) -shared ifdef soname LINK.shared += -Wl,-x,-soname,$(soname) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) LINK.shared += -Wl,--version-script=$(exports_file) endif endif ifeq ($(PORTNAME), netbsd) LINK.shared = $(COMPILER) -shared ifdef soname LINK.shared += -Wl,-x,-soname,$(soname) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) LINK.shared += -Wl,--version-script=$(exports_file) endif endif ifeq ($(PORTNAME), linux) LINK.shared = $(COMPILER) -shared ifdef soname ifneq (,$(findstring linux-android,$(host_os))) # Android uses unversioned shared libraries shlib = $(shlib_bare) soname = $(shlib_bare) endif LINK.shared += -Wl,-soname,$(soname) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) LINK.shared += -Wl,--version-script=$(exports_file) endif endif ifeq ($(PORTNAME), solaris) LINK.shared = $(COMPILER) -shared ifdef soname LINK.shared += -Wl,-soname,$(soname) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) ifneq (,$(exports_file)) LINK.shared += -Wl,-M$(exports_file) endif endif ifeq ($(PORTNAME), cygwin) LINK.shared = $(CC) -shared ifdef SO_MAJOR_VERSION shlib = cyg$(NAME)$(DLSUFFIX) endif haslibarule = yes endif ifeq ($(PORTNAME), win32) ifdef SO_MAJOR_VERSION shlib = lib$(NAME)$(DLSUFFIX) endif haslibarule = yes endif # If the shared library doesn't have an export file, mark all symbols not # explicitly exported using PGDLLEXPORT as hidden. We can't pass these flags # when building a library with explicit exports, as the symbols would be # hidden before the linker script / exported symbol list takes effect. # # This is duplicated in pgxs.mk for MODULES style libraries. ifeq ($(SHLIB_EXPORTS),) # LDFLAGS_SL addition not strictly needed, CFLAGS used everywhere, but ... override LDFLAGS_SL += $(CFLAGS_SL_MODULE) override CFLAGS += $(CFLAGS_SL_MODULE) override CXXFLAGS += $(CXXFLAGS_SL_MODULE) endif ifeq ($(PORTNAME), emscripten) LINK.shared = $(COMPILER) -shared -sSIDE_MODULE=1 -Wno-unused-function ifdef soname # emscripten uses unversioned shared libraries shlib = $(shlib_bare) soname = $(shlib_bare) endif BUILD.exports = ( $(AWK) '/^[^\#]/ {printf "%s\n",$$1}' $< ) | sort -u >$@ # BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) # ifneq (,$(exports_file)) # LINK.shared += -Wl,--version-script=$(exports_file) # endif endif ifeq ($(PORTNAME), wasi) LINK.shared = wasi-shared ifdef soname # emscripten uses unversioned shared libraries shlib = $(shlib_bare) soname = $(shlib_bare) endif BUILD.exports = ( echo '{ global:'; $(AWK) '/^[^\#]/ {printf "%s;\n",$$1}' $<; echo ' local: *; };' ) >$@ exports_file = $(SHLIB_EXPORTS:%.txt=%.list) # ifneq (,$(exports_file)) # LINK.shared += -Wl,--version-script=$(exports_file) # endif endif ## ## BUILD ## .PHONY: all-lib all-static-lib all-shared-lib all-lib: all-shared-lib ifdef soname # no static library when building a dynamically loadable module all-lib: all-static-lib all-lib: lib$(NAME).pc endif all-static-lib: $(stlib) ifdef wasi all-shared-lib: all-static-lib else all-shared-lib: $(shlib) endif # In this rule, "touch $@" works around a problem on some platforms wherein # ar updates the library file's mod time with a value calculated to # seconds precision. If the filesystem has sub-second timestamps, this can # cause the library file to appear older than its input files, triggering # parallel-make problems. ifndef haslibarule $(stlib): $(OBJS) | $(SHLIB_PREREQS) rm -f $@ $(LINK.static) $@ $^ touch $@ endif #haslibarule ifeq (,$(filter cygwin win32,$(PORTNAME))) # Normal case $(shlib): $(OBJS) | $(SHLIB_PREREQS) $(LINK.shared) -o $@ $(OBJS) $(LDFLAGS) $(LDFLAGS_SL) $(SHLIB_LINK) ifdef shlib_major # If we're using major and minor versions, then make a symlink to major-version-only. ifneq ($(shlib), $(shlib_major)) rm -f $(shlib_major) $(LN_S) $(shlib) $(shlib_major) endif # Make sure we have a link to a name without any version numbers ifneq ($(shlib), $(shlib_bare)) rm -f $(shlib_bare) $(LN_S) $(shlib) $(shlib_bare) endif # shlib_bare endif # shlib_major # Where possible, restrict the symbols exported by the library to just the # official list, so as to avoid unintentional ABI changes. On recent macOS # this also quiets multiply-defined-symbol warnings in programs that use # libpgport along with libpq. ifneq (,$(SHLIB_EXPORTS)) ifdef BUILD.exports $(shlib): $(exports_file) $(exports_file): $(SHLIB_EXPORTS) $(BUILD.exports) endif endif else # PORTNAME == cygwin || PORTNAME == win32 ifeq ($(PORTNAME), cygwin) # Cygwin case $(shlib): $(OBJS) | $(SHLIB_PREREQS) $(CC) $(CFLAGS) -shared -o $@ -Wl,--out-implib=$(stlib) $(OBJS) $(LDFLAGS) $(LDFLAGS_SL) $(SHLIB_LINK) $(LIBS) $(LDAP_LIBS_BE) # see notes in src/backend/parser/Makefile about use of this type of rule $(stlib): $(shlib) touch $@ else # Win32 case # See notes in src/backend/parser/Makefile about the following two rules $(stlib): $(shlib) touch $@ # XXX A backend that loads a module linked with libgcc_s_dw2-1.dll will exit # uncleanly, hence -static-libgcc. (Last verified with MinGW-w64 compilers # from i686-4.9.1-release-win32-dwarf-rt_v3-rev1.) Shared libgcc has better # support for C++/Java exceptions; while core PostgreSQL does not use them, it # would be nice to support shared libgcc for the benefit of extensions. # # If SHLIB_EXPORTS is set, the rules below will build a .def file from that. # Else we just use --export-all-symbols. ifeq (,$(SHLIB_EXPORTS)) $(shlib): $(OBJS) | $(SHLIB_PREREQS) $(CC) $(CFLAGS) -shared -static-libgcc -o $@ $(OBJS) $(LDFLAGS) $(LDFLAGS_SL) $(SHLIB_LINK) $(LIBS) -Wl,--export-all-symbols -Wl,--out-implib=$(stlib) else DLL_DEFFILE = lib$(NAME)dll.def $(shlib): $(OBJS) $(DLL_DEFFILE) | $(SHLIB_PREREQS) $(CC) $(CFLAGS) -shared -static-libgcc -o $@ $(OBJS) $(DLL_DEFFILE) $(LDFLAGS) $(LDFLAGS_SL) $(SHLIB_LINK) $(LIBS) -Wl,--out-implib=$(stlib) UC_NAME = $(shell echo $(NAME) | tr 'abcdefghijklmnopqrstuvwxyz' 'ABCDEFGHIJKLMNOPQRSTUVWXYZ') $(DLL_DEFFILE): $(SHLIB_EXPORTS) echo 'LIBRARY LIB$(UC_NAME).dll' >$@ echo 'EXPORTS' >>$@ sed -e '/^#/d' -e 's/^\(.*[ ]\)\([0-9][0-9]*\)/ \1@ \2/' $< >>$@ endif endif # PORTNAME == cygwin endif # PORTNAME == cygwin || PORTNAME == win32 %.pc: $(MAKEFILE_LIST) echo 'prefix=$(prefix)' >$@ echo 'exec_prefix=$(patsubst $(prefix),$${prefix},$(exec_prefix))' >>$@ echo 'libdir=$(patsubst $(exec_prefix)/%,$${exec_prefix}/%,$(libdir))' >>$@ echo 'includedir=$(patsubst $(prefix)/%,$${prefix}/%,$(includedir))' >>$@ echo >>$@ echo 'Name: lib$(NAME)' >>$@ echo 'Description: PostgreSQL lib$(NAME) library' >>$@ echo 'URL: $(PACKAGE_URL)' >>$@ echo 'Version: $(VERSION)' >>$@ echo 'Requires: ' >>$@ echo 'Requires.private: $(PKG_CONFIG_REQUIRES_PRIVATE)' >>$@ echo 'Cflags: -I$${includedir}' >>$@ echo 'Libs: -L$${libdir} -l$(NAME)' >>$@ # Record -L flags that the user might have passed in to the PostgreSQL # build to locate third-party libraries (e.g., ldap, ssl). Filter out # those that point inside the build or source tree. Use sort to # remove duplicates. Also record the -l flags necessary for static # linking, but not those already covered by Requires.private. echo 'Libs.private: $(sort $(filter-out -L.% -L$(top_srcdir)/%,$(filter -L%,$(LDFLAGS) $(SHLIB_LINK)))) $(filter-out $(PKG_CONFIG_REQUIRES_PRIVATE:lib%=-l%),$(filter -l%,$(SHLIB_LINK_INTERNAL:%_shlib=%) $(SHLIB_LINK)))' >>$@ ## ## INSTALL ## .PHONY: install-lib install-lib-static install-lib-shared installdirs-lib install-lib: install-lib-shared ifdef soname install-lib: install-lib-static install-lib: install-lib-pc endif install-lib-pc: lib$(NAME).pc installdirs-lib $(INSTALL_DATA) $< '$(DESTDIR)$(pkgconfigdir)/lib$(NAME).pc' install-lib-static: $(stlib) installdirs-lib $(INSTALL_STLIB) $< '$(DESTDIR)$(libdir)/$(stlib)' install-lib-shared: $(shlib) installdirs-lib ifdef soname $(INSTALL_SHLIB) $< '$(DESTDIR)$(libdir)/$(shlib)' ifneq ($(PORTNAME), cygwin) ifneq ($(PORTNAME), win32) ifneq ($(shlib), $(shlib_major)) cd '$(DESTDIR)$(libdir)' && \ rm -f $(shlib_major) && \ $(LN_S) $(shlib) $(shlib_major) endif ifneq ($(shlib), $(shlib_bare)) cd '$(DESTDIR)$(libdir)' && \ rm -f $(shlib_bare) && \ $(LN_S) $(shlib) $(shlib_bare) endif endif # not win32 endif # not cygwin ifneq (,$(findstring $(PORTNAME),win32 cygwin)) $(INSTALL_SHLIB) $< '$(DESTDIR)$(bindir)/$(shlib)' endif else # no soname $(INSTALL_SHLIB) $< '$(DESTDIR)$(pkglibdir)/$(shlib)' endif installdirs-lib: ifdef soname $(MKDIR_P) '$(DESTDIR)$(libdir)' '$(DESTDIR)$(pkgconfigdir)' $(if $(findstring $(PORTNAME),win32 cygwin),'$(DESTDIR)$(bindir)') else $(MKDIR_P) '$(DESTDIR)$(pkglibdir)' endif ## ## UNINSTALL ## .PHONY: uninstall-lib uninstall-lib: ifdef soname rm -f '$(DESTDIR)$(libdir)/$(stlib)' rm -f '$(DESTDIR)$(libdir)/$(shlib_bare)' \ '$(DESTDIR)$(libdir)/$(shlib_major)' \ '$(DESTDIR)$(libdir)/$(shlib)' $(if $(findstring $(PORTNAME),win32 cygwin),'$(DESTDIR)$(bindir)/$(shlib)') \ '$(DESTDIR)$(pkgconfigdir)/lib$(NAME).pc' else # no soname rm -f '$(DESTDIR)$(pkglibdir)/$(shlib)' endif # no soname ## ## CLEAN ## .PHONY: clean-lib clean-lib: rm -f $(shlib) $(shlib_bare) $(shlib_major) $(stlib) $(exports_file) lib$(NAME).pc ifneq (,$(DLL_DEFFILE)) rm -f $(DLL_DEFFILE) endif # PGXS: PostgreSQL extensions makefile # src/makefiles/pgxs.mk # This file contains generic rules to build many kinds of simple # extension modules. You only need to set a few variables and include # this file, the rest will be done here. # # Use the following layout for your Makefile: # # [variable assignments, see below] # # PG_CONFIG = pg_config # PGXS := $(shell $(PG_CONFIG) --pgxs) # include $(PGXS) # # [custom rules, rarely necessary] # # Set one of these three variables to specify what is built: # # MODULES -- list of shared-library objects to be built from source files # with same stem (do not include library suffixes in this list) # MODULE_big -- a shared library to build from multiple source files # (list object files in OBJS) # PROGRAM -- an executable program to build (list object files in OBJS) # # The following variables can also be set: # # EXTENSION -- name of extension (there must be a $EXTENSION.control file) # MODULEDIR -- subdirectory of $PREFIX/share into which DATA and DOCS files # should be installed (if not set, default is "extension" if EXTENSION # is set, or "contrib" if not) # DATA -- random files to install into $PREFIX/share/$MODULEDIR # DATA_built -- random files to install into $PREFIX/share/$MODULEDIR, # which need to be built first # DATA_TSEARCH -- random files to install into $PREFIX/share/tsearch_data # DOCS -- random files to install under $PREFIX/doc/$MODULEDIR # SCRIPTS -- script files (not binaries) to install into $PREFIX/bin # SCRIPTS_built -- script files (not binaries) to install into $PREFIX/bin, # which need to be built first # HEADERS -- files to install into $(includedir_server)/$MODULEDIR/$MODULE_big # HEADERS_built -- as above but built first (but NOT cleaned) # HEADERS_$(MODULE) -- files to install into # $(includedir_server)/$MODULEDIR/$MODULE; the value of $MODULE must be # listed in MODULES or MODULE_big # HEADERS_built_$(MODULE) -- as above but built first (also NOT cleaned) # REGRESS -- list of regression test cases (without suffix) # REGRESS_OPTS -- additional switches to pass to pg_regress # TAP_TESTS -- switch to enable TAP tests # ISOLATION -- list of isolation test cases # ISOLATION_OPTS -- additional switches to pass to pg_isolation_regress # NO_INSTALL -- don't define an install target, useful for test modules # that don't need their build products to be installed # NO_INSTALLCHECK -- don't define an installcheck target, useful e.g. if # tests require special configuration, or don't use pg_regress # EXTRA_CLEAN -- extra files to remove in 'make clean' # PG_CPPFLAGS -- will be prepended to CPPFLAGS # PG_CFLAGS -- will be appended to CFLAGS # PG_CXXFLAGS -- will be appended to CXXFLAGS # PG_LDFLAGS -- will be prepended to LDFLAGS # PG_LIBS -- will be added to PROGRAM link line # PG_LIBS_INTERNAL -- same, for references to libraries within build tree # SHLIB_LINK -- will be added to MODULE_big link line # SHLIB_LINK_INTERNAL -- same, for references to libraries within build tree # PG_CONFIG -- path to pg_config program for the PostgreSQL installation # to build against (typically just "pg_config" to use the first one in # your PATH) # # Better look at some of the existing uses for examples... ifndef PGXS ifndef NO_PGXS $(error pgxs error: makefile variable PGXS or NO_PGXS must be set) endif endif ifdef PGXS # External extensions must assume generated headers are available NO_GENERATED_HEADERS=yes # The temp-install rule won't work, either NO_TEMP_INSTALL=yes # We assume that we are in src/makefiles/, so top is ... top_builddir := $(dir $(PGXS))../.. include $(top_builddir)/src/Makefile.global # These might be set in Makefile.global, but if they were not found # during the build of PostgreSQL, supply default values so that users # of pgxs can use the variables. ifeq ($(BISON),) BISON = bison endif ifeq ($(FLEX),) FLEX = flex endif endif # PGXS override CPPFLAGS := -I. -I$(srcdir) $(CPPFLAGS) # See equivalent block in Makefile.shlib ifdef MODULES override LDFLAGS_SL += $(CFLAGS_SL_MODULE) override CFLAGS += $(CFLAGS_SL) $(CFLAGS_SL_MODULE) override CXXFLAGS += $(CFLAGS_SL) $(CXXFLAGS_SL_MODULE) endif ifdef MODULEDIR datamoduledir := $(MODULEDIR) docmoduledir := $(MODULEDIR) incmoduledir := $(MODULEDIR) else ifdef EXTENSION datamoduledir := extension docmoduledir := extension incmoduledir := extension else datamoduledir := contrib docmoduledir := contrib incmoduledir := contrib endif endif ifdef PG_CPPFLAGS override CPPFLAGS := $(PG_CPPFLAGS) $(CPPFLAGS) endif ifdef PG_CFLAGS override CFLAGS := $(CFLAGS) $(PG_CFLAGS) endif ifdef PG_CXXFLAGS override CXXFLAGS := $(CXXFLAGS) $(PG_CXXFLAGS) endif ifdef PG_LDFLAGS override LDFLAGS := $(PG_LDFLAGS) $(LDFLAGS) endif # logic for HEADERS_* stuff # get list of all names used with or without built_ prefix # note that use of HEADERS_built_foo will get both "foo" and "built_foo", # we cope with that later when filtering this list against MODULES. # If someone wants to name a module "built_foo", they can do that and it # works, but if they have MODULES = foo built_foo then they will need to # force building of all headers and use HEADERS_built_foo and # HEADERS_built_built_foo. HEADER_alldirs := $(patsubst HEADERS_%,%,$(filter HEADERS_%, $(.VARIABLES))) HEADER_alldirs += $(patsubst HEADERS_built_%,%,$(filter HEADERS_built_%, $(.VARIABLES))) # collect all names of built headers to use as a dependency HEADER_allbuilt := ifdef MODULE_big # we can unconditionally add $(MODULE_big) here, because we will strip it # back out below if it turns out not to actually define any headers. HEADER_dirs := $(MODULE_big) HEADER_unbuilt_$(MODULE_big) = $(HEADERS) HEADER_built_$(MODULE_big) = $(HEADERS_built) HEADER_allbuilt += $(HEADERS_built) # treat "built" as an exclusion below as well as "built_foo" HEADER_xdirs := built built_$(MODULE_big) else # not MODULE_big, so check MODULES # HEADERS is an error in the absence of MODULE_big to provide a dir name ifdef HEADERS $(error HEADERS requires MODULE_big to be set) endif # make list of modules that have either HEADERS_foo or HEADERS_built_foo HEADER_dirs := $(foreach m,$(MODULES),$(if $(filter $(m) built_$(m),$(HEADER_alldirs)),$(m))) # make list of conflicting names to exclude HEADER_xdirs := $(addprefix built_,$(HEADER_dirs)) endif # MODULE_big or MODULES # HEADERS_foo requires that "foo" is in MODULES as a sanity check ifneq (,$(filter-out $(HEADER_dirs) $(HEADER_xdirs),$(HEADER_alldirs))) $(error $(patsubst %,HEADERS_%,$(filter-out $(HEADER_dirs) $(HEADER_xdirs),$(HEADER_alldirs))) defined with no module) endif # assign HEADER_unbuilt_foo and HEADER_built_foo, but make sure # that "built" takes precedence in the case of conflict, by removing # conflicting module names when matching the unbuilt name $(foreach m,$(filter-out $(HEADER_xdirs),$(HEADER_dirs)),$(eval HEADER_unbuilt_$(m) += $$(HEADERS_$(m)))) $(foreach m,$(HEADER_dirs),$(eval HEADER_built_$(m) += $$(HEADERS_built_$(m)))) $(foreach m,$(HEADER_dirs),$(eval HEADER_allbuilt += $$(HEADERS_built_$(m)))) # expand out the list of headers for each dir, attaching source prefixes header_file_list = $(HEADER_built_$(1)) $(addprefix $(srcdir)/,$(HEADER_unbuilt_$(1))) $(foreach m,$(HEADER_dirs),$(eval HEADER_files_$(m) := $$(call header_file_list,$$(m)))) # note that the caller's HEADERS* vars have all been expanded now, and # later changes will have no effect. # remove entries in HEADER_dirs that produced an empty list of files, # to ensure we don't try and install them HEADER_dirs := $(foreach m,$(HEADER_dirs),$(if $(strip $(HEADER_files_$(m))),$(m))) # Functions for generating install/uninstall commands; the blank lines # before the "endef" are required, don't lose them # $(call install_headers,dir,headers) define install_headers $(MKDIR_P) '$(DESTDIR)$(includedir_server)/$(incmoduledir)/$(1)/' $(INSTALL_DATA) $(2) '$(DESTDIR)$(includedir_server)/$(incmoduledir)/$(1)/' endef # $(call uninstall_headers,dir,headers) define uninstall_headers rm -f $(addprefix '$(DESTDIR)$(includedir_server)/$(incmoduledir)/$(1)'/, $(notdir $(2))) endef # end of HEADERS_* stuff all: $(PROGRAM) $(DATA_built) $(HEADER_allbuilt) $(SCRIPTS_built) $(addsuffix $(DLSUFFIX), $(MODULES)) $(addsuffix .control, $(EXTENSION)) ifeq ($(with_llvm), yes) all: $(addsuffix .bc, $(MODULES)) $(patsubst %.o,%.bc, $(OBJS)) endif ifdef MODULE_big # shared library parameters NAME = $(MODULE_big) include $(top_srcdir)/src/Makefile.shlib all: all-lib endif # MODULE_big ifndef NO_INSTALL install: all installdirs ifneq (,$(EXTENSION)) $(INSTALL_DATA) $(addprefix $(srcdir)/, $(addsuffix .control, $(EXTENSION))) '$(DESTDIR)$(datadir)/extension/' endif # EXTENSION ifneq (,$(DATA)$(DATA_built)) $(INSTALL_DATA) $(addprefix $(srcdir)/, $(DATA)) $(DATA_built) '$(DESTDIR)$(datadir)/$(datamoduledir)/' endif # DATA ifneq (,$(DATA_TSEARCH)) $(INSTALL_DATA) $(addprefix $(srcdir)/, $(DATA_TSEARCH)) '$(DESTDIR)$(datadir)/tsearch_data/' endif # DATA_TSEARCH ifdef MODULES $(INSTALL_SHLIB) $(addsuffix $(DLSUFFIX), $(MODULES)) '$(DESTDIR)$(pkglibdir)/' ifeq ($(with_llvm), yes) $(foreach mod, $(MODULES), $(call install_llvm_module,$(mod),$(mod).bc)) endif # with_llvm ifeq ($(PORTNAME), emscripten) $(LLVM_NM) -u *.o | awk '{print $$2}' | sed '/^$$/d' | sort -u > undef.txt $(LLVM_NM) *.o | awk '$$2 ~ /^[TDB]$$/ {print $$3}' | sed '/^$$/d' | sort -u > defs.txt comm -23 undef.txt defs.txt > '$(emscripten_extension_imports_dir)/$(MODULES).imports' rm -f undef.txt defs.txt endif # PORTNAME=emscripten endif # MODULES ifdef DOCS ifdef docdir $(INSTALL_DATA) $(addprefix $(srcdir)/, $(DOCS)) '$(DESTDIR)$(docdir)/$(docmoduledir)/' endif # docdir endif # DOCS ifdef PROGRAM $(INSTALL_PROGRAM) $(PROGRAM)$(X) '$(DESTDIR)$(bindir)' endif # PROGRAM ifdef SCRIPTS $(INSTALL_SCRIPT) $(addprefix $(srcdir)/, $(SCRIPTS)) '$(DESTDIR)$(bindir)/' endif # SCRIPTS ifdef SCRIPTS_built $(INSTALL_SCRIPT) $(SCRIPTS_built) '$(DESTDIR)$(bindir)/' endif # SCRIPTS_built ifneq (,$(strip $(HEADER_dirs))) $(foreach dir,$(HEADER_dirs),$(call install_headers,$(dir),$(HEADER_files_$(dir)))) endif # HEADERS ifdef MODULE_big ifeq ($(with_llvm), yes) $(call install_llvm_module,$(MODULE_big),$(OBJS)) endif # with_llvm ifeq ($(PORTNAME), emscripten) $(LLVM_NM) -u $(OBJS) | awk '{print $$2}' | sed '/^$$/d' | sort -u > undef.txt $(LLVM_NM) $(OBJS) | awk '$$2 ~ /^[TDB]$$/ {print $$3}' | sed '/^$$/d' | sort -u > defs.txt comm -23 undef.txt defs.txt > '$(emscripten_extension_imports_dir)/$(MODULE_big).imports' rm -f undef.txt defs.txt endif # PORTNAME=emscripten install: install-lib endif # MODULE_big installdirs: ifneq (,$(EXTENSION)) $(MKDIR_P) '$(DESTDIR)$(datadir)/extension' endif ifneq (,$(DATA)$(DATA_built)) $(MKDIR_P) '$(DESTDIR)$(datadir)/$(datamoduledir)' endif ifneq (,$(DATA_TSEARCH)) $(MKDIR_P) '$(DESTDIR)$(datadir)/tsearch_data' endif ifneq (,$(MODULES)) $(MKDIR_P) '$(DESTDIR)$(pkglibdir)' endif ifdef DOCS ifdef docdir $(MKDIR_P) '$(DESTDIR)$(docdir)/$(docmoduledir)' endif # docdir endif # DOCS ifneq (,$(PROGRAM)$(SCRIPTS)$(SCRIPTS_built)) $(MKDIR_P) '$(DESTDIR)$(bindir)' endif ifdef MODULE_big installdirs: installdirs-lib endif # MODULE_big ifeq ($(PORTNAME), emscripten) $(MKDIR_P) '$(DESTDIR)$(emscripten_extension_imports_dir)' endif uninstall: ifneq (,$(EXTENSION)) rm -f $(addprefix '$(DESTDIR)$(datadir)/extension'/, $(notdir $(addsuffix .control, $(EXTENSION)))) endif ifneq (,$(DATA)$(DATA_built)) rm -f $(addprefix '$(DESTDIR)$(datadir)/$(datamoduledir)'/, $(notdir $(DATA) $(DATA_built))) endif ifneq (,$(DATA_TSEARCH)) rm -f $(addprefix '$(DESTDIR)$(datadir)/tsearch_data'/, $(notdir $(DATA_TSEARCH))) endif ifdef MODULES rm -f $(addprefix '$(DESTDIR)$(pkglibdir)'/, $(addsuffix $(DLSUFFIX), $(MODULES))) ifeq ($(with_llvm), yes) $(foreach mod, $(MODULES), $(call uninstall_llvm_module,$(mod))) endif # with_llvm ifeq ($(PORTNAME), emscripten) rm -f '$(DESTDIR)$(emscripten_extension_imports_dir)/$(MODULES).imports' endif endif # MODULES ifdef DOCS rm -f $(addprefix '$(DESTDIR)$(docdir)/$(docmoduledir)'/, $(DOCS)) endif ifdef PROGRAM rm -f '$(DESTDIR)$(bindir)/$(PROGRAM)$(X)' endif ifdef SCRIPTS rm -f $(addprefix '$(DESTDIR)$(bindir)'/, $(SCRIPTS)) endif ifdef SCRIPTS_built rm -f $(addprefix '$(DESTDIR)$(bindir)'/, $(SCRIPTS_built)) endif ifneq (,$(strip $(HEADER_dirs))) $(foreach dir,$(HEADER_dirs),$(call uninstall_headers,$(dir),$(HEADER_files_$(dir)))) endif # HEADERS ifdef MODULE_big ifeq ($(with_llvm), yes) $(call uninstall_llvm_module,$(MODULE_big)) endif # with_llvm ifeq ($(PORTNAME), emscripten) rm -f '$(DESTDIR)$(emscripten_extension_imports_dir)/$(MODULE_big).imports' endif uninstall: uninstall-lib endif # MODULE_big else # NO_INSTALL # Need this so that temp-install builds artifacts not meant for # installation (Normally, check should depend on all, but we don't do # that because of parallel make risk (dbf2ec1a1c0).) install: all endif # NO_INSTALL clean: ifdef MODULES rm -f $(addsuffix $(DLSUFFIX), $(MODULES)) $(addsuffix .o, $(MODULES)) $(if $(PGFILEDESC),$(WIN32RES)) \ $(addsuffix .bc, $(MODULES)) endif ifdef DATA_built rm -f $(DATA_built) endif ifdef SCRIPTS_built rm -f $(SCRIPTS_built) endif ifdef PROGRAM rm -f $(PROGRAM)$(X) endif ifdef OBJS rm -f $(OBJS) $(patsubst %.o,%.bc, $(OBJS)) endif ifdef EXTRA_CLEAN rm -rf $(EXTRA_CLEAN) endif ifdef REGRESS # things created by various check targets rm -rf $(pg_regress_clean_files) ifeq ($(PORTNAME), win) rm -f regress.def endif endif # REGRESS ifdef TAP_TESTS rm -rf tmp_check/ endif ifdef ISOLATION rm -rf output_iso/ tmp_check_iso/ endif ifdef MODULE_big clean: clean-lib endif distclean: clean ifdef REGRESS REGRESS_OPTS += --dbname=$(CONTRIB_TESTDB) # When doing a VPATH build, must copy over the data files so that the # driver script can find them. We have to use an absolute path for # the targets, because otherwise make will try to locate the missing # files using VPATH, and will find them in $(srcdir), but the point # here is that we want to copy them from $(srcdir) to the build # directory. ifdef VPATH abs_builddir := $(shell pwd) test_files_src := $(wildcard $(srcdir)/data/*.data) test_files_build := $(patsubst $(srcdir)/%, $(abs_builddir)/%, $(test_files_src)) all: $(test_files_build) $(test_files_build): $(abs_builddir)/%: $(srcdir)/% $(MKDIR_P) $(dir $@) ln -s $< $@ endif # VPATH endif # REGRESS .PHONY: submake submake: ifndef PGXS $(MAKE) -C $(top_builddir)/src/test/regress pg_regress$(X) $(MAKE) -C $(top_builddir)/src/test/isolation all endif ifdef ISOLATION ISOLATION_OPTS += --dbname=$(ISOLATION_TESTDB) endif # Standard rules to run regression tests including multiple test suites. # Runs against an installed postmaster. ifndef NO_INSTALLCHECK installcheck: submake $(REGRESS_PREP) ifdef REGRESS $(pg_regress_installcheck) $(REGRESS_OPTS) $(REGRESS) endif ifdef ISOLATION $(pg_isolation_regress_installcheck) $(ISOLATION_OPTS) $(ISOLATION) endif ifdef TAP_TESTS $(prove_installcheck) endif endif # NO_INSTALLCHECK # Runs independently of any installation ifdef PGXS check: @echo '"$(MAKE) check" is not supported.' @echo 'Do "$(MAKE) install", then "$(MAKE) installcheck" instead.' else check: submake $(REGRESS_PREP) ifdef REGRESS $(pg_regress_check) $(REGRESS_OPTS) $(REGRESS) endif ifdef ISOLATION $(pg_isolation_regress_check) $(ISOLATION_OPTS) $(ISOLATION) endif ifdef TAP_TESTS $(prove_check) endif endif # PGXS ifndef NO_TEMP_INSTALL checkprep: EXTRA_INSTALL+=$(subdir) endif # STANDARD RULES ifneq (,$(MODULES)$(MODULE_big)) %.sql: %.sql.in sed 's,MODULE_PATHNAME,$$libdir/$*,g' $< >$@ endif ifdef PROGRAM $(PROGRAM): $(OBJS) $(CC) $(CFLAGS) $(OBJS) $(PG_LIBS_INTERNAL) $(LDFLAGS) $(LDFLAGS_EX) $(PG_LIBS) $(LIBS) -o $@$(X) endif # src/nls-global.mk # Common rules for Native Language Support (NLS) # # If some subdirectory of the source tree wants to provide NLS, it # needs to contain a file 'nls.mk' with the following make variable # assignments: # # CATALOG_NAME -- name of the message catalog (xxx.po); probably # name of the program # GETTEXT_FILES -- list of source files that contain message strings # GETTEXT_TRIGGERS -- (optional) list of functions that contain # translatable strings # GETTEXT_FLAGS -- (optional) list of gettext --flag arguments to mark # function arguments that contain C format strings # (functions must be listed in TRIGGERS and FLAGS) # # Also, provide a text file 'po/LINGUAS' with a space-separated list # of languages that are provided/supported. # # That's all, the rest is done here, if --enable-nls was specified. # # The only user-visible targets here are 'init-po', to make an initial # "blank" catalog from program sources, and 'update-po', which is to # be called if the messages in the program source have changed, in # order to merge the changes into the existing .po files. # existence checked by Makefile.global; otherwise we won't get here include $(srcdir)/nls.mk AVAIL_LANGUAGES := $(shell cat $(srcdir)/po/LINGUAS) # If user specified the languages he wants in --enable-nls=LANGUAGES, # filter out the rest. Else use all available ones. ifdef WANTED_LANGUAGES LANGUAGES = $(filter $(WANTED_LANGUAGES), $(AVAIL_LANGUAGES)) else LANGUAGES = $(AVAIL_LANGUAGES) endif PO_FILES = $(addprefix po/, $(addsuffix .po, $(LANGUAGES))) ALL_PO_FILES = $(addprefix po/, $(addsuffix .po, $(AVAIL_LANGUAGES))) MO_FILES = $(addprefix po/, $(addsuffix .mo, $(LANGUAGES))) ifdef XGETTEXT XGETTEXT += -ctranslator --copyright-holder='PostgreSQL Global Development Group' --msgid-bugs-address=pgsql-bugs@lists.postgresql.org --no-wrap --sort-by-file --package-name='$(CATALOG_NAME) (PostgreSQL)' --package-version='$(MAJORVERSION)' endif ifdef MSGMERGE MSGMERGE += --no-wrap --previous --sort-by-file endif # _ is defined in c.h, so it's global GETTEXT_TRIGGERS += _ GETTEXT_FLAGS += _:1:pass-c-format # common settings that apply to backend and all backend modules BACKEND_COMMON_GETTEXT_TRIGGERS = \ $(FRONTEND_COMMON_GETTEXT_TRIGGERS) \ errmsg errmsg_plural:1,2 \ errdetail errdetail_log errdetail_plural:1,2 \ errhint errhint_plural:1,2 \ errcontext \ XactLockTableWait:4 \ MultiXactIdWait:6 \ ConditionalMultiXactIdWait:6 BACKEND_COMMON_GETTEXT_FLAGS = \ $(FRONTEND_COMMON_GETTEXT_FLAGS) \ errmsg:1:c-format errmsg_plural:1:c-format errmsg_plural:2:c-format \ errdetail:1:c-format errdetail_log:1:c-format errdetail_plural:1:c-format errdetail_plural:2:c-format \ errhint:1:c-format errhint_plural:1:c-format errhint_plural:2:c-format \ errcontext:1:c-format FRONTEND_COMMON_GETTEXT_FILES = $(top_srcdir)/src/common/logging.c FRONTEND_COMMON_GETTEXT_TRIGGERS = \ pg_log_error pg_log_error_detail pg_log_error_hint \ pg_log_warning pg_log_warning_detail pg_log_warning_hint \ pg_log_info pg_log_info_detail pg_log_info_hint \ pg_fatal pg_log_generic:3 pg_log_generic_v:3 FRONTEND_COMMON_GETTEXT_FLAGS = \ pg_log_error:1:c-format pg_log_error_detail:1:c-format pg_log_error_hint:1:c-format \ pg_log_warning:1:c-format pg_log_warning_detail:1:c-format pg_log_warning_hint:1:c-format \ pg_log_info:1:c-format pg_log_info_detail:1:c-format pg_log_info_hint:1:c-format \ pg_fatal:1:c-format pg_log_generic:3:c-format pg_log_generic_v:3:c-format all-po: $(MO_FILES) %.mo: %.po $(MSGFMT) $(MSGFMT_FLAGS) -o $@ $< ifeq ($(word 1,$(GETTEXT_FILES)),+) po/$(CATALOG_NAME).pot: $(word 2, $(GETTEXT_FILES)) $(MAKEFILE_LIST) ifdef XGETTEXT $(XGETTEXT) -D $(srcdir) -D . -n $(addprefix -k, $(GETTEXT_TRIGGERS)) $(addprefix --flag=, $(GETTEXT_FLAGS)) -f $< else @echo "You don't have 'xgettext'."; exit 1 endif else # GETTEXT_FILES po/$(CATALOG_NAME).pot: $(GETTEXT_FILES) $(MAKEFILE_LIST) # Change to srcdir explicitly, don't rely on $^. That way we get # consistent #: file references in the po files. ifdef XGETTEXT $(XGETTEXT) -D $(srcdir) -D . -n $(addprefix -k, $(GETTEXT_TRIGGERS)) $(addprefix --flag=, $(GETTEXT_FLAGS)) $(GETTEXT_FILES) else @echo "You don't have 'xgettext'."; exit 1 endif endif # GETTEXT_FILES @$(MKDIR_P) $(dir $@) sed -e '1,18 { s/SOME DESCRIPTIVE TITLE./LANGUAGE message translation file for $(CATALOG_NAME)/;s/PACKAGE/PostgreSQL/g;s/VERSION/$(MAJORVERSION)/g;s/YEAR/'`date +%Y`'/g; }' messages.po >$@ rm messages.po # catalog name extensions must match behavior of PG_TEXTDOMAIN() in c.h install-po: all-po installdirs-po ifneq (,$(LANGUAGES)) for lang in $(LANGUAGES); do \ $(INSTALL_DATA) po/$$lang.mo '$(DESTDIR)$(localedir)'/$$lang/LC_MESSAGES/$(CATALOG_NAME)$(SO_MAJOR_VERSION)-$(MAJORVERSION).mo || exit 1; \ done endif installdirs-po: $(if $(LANGUAGES),$(MKDIR_P) $(foreach lang, $(LANGUAGES), '$(DESTDIR)$(localedir)'/$(lang)/LC_MESSAGES),:) uninstall-po: $(if $(LANGUAGES),rm -f $(foreach lang, $(LANGUAGES), '$(DESTDIR)$(localedir)'/$(lang)/LC_MESSAGES/$(CATALOG_NAME)$(SO_MAJOR_VERSION)-$(MAJORVERSION).mo),:) clean-po: $(if $(MO_FILES),rm -f $(MO_FILES)) @$(if $(wildcard po/*.po.new),rm -f po/*.po.new) rm -f po/$(CATALOG_NAME).pot init-po: po/$(CATALOG_NAME).pot # For performance reasons, only calculate these when the user actually # requested update-po or a specific file. ifneq (,$(filter update-po %.po.new,$(MAKECMDGOALS))) ALL_LANGUAGES := $(shell find $(top_srcdir) -name '*.po' -print | sed 's,^.*/\([^/]*\).po$$,\1,' | LC_ALL=C sort -u) all_compendia := $(shell find $(top_srcdir) -name '*.po' -print | LC_ALL=C sort) else ALL_LANGUAGES = $(AVAIL_LANGUAGES) all_compendia = FORCE FORCE: endif ifdef WANTED_LANGUAGES ALL_LANGUAGES := $(filter $(WANTED_LANGUAGES), $(ALL_LANGUAGES)) endif update-po: $(ALL_LANGUAGES:%=po/%.po.new) $(AVAIL_LANGUAGES:%=po/%.po.new): po/%.po.new: po/%.po po/$(CATALOG_NAME).pot $(all_compendia) $(MSGMERGE) --lang=$* $(word 1, $^) $(word 2,$^) -o $@ $(addprefix --compendium=,$(filter %/$*.po,$(wordlist 3,$(words $^),$^))) # For languages not yet available, merge against oneself, to pick # up translations from the compendia. (Merging against /dev/null # doesn't work so well; it inserts the headers from the first-named # compendium.) po/%.po.new: po/$(CATALOG_NAME).pot $(all_compendia) $(MSGMERGE) --lang=$* $(word 1,$^) $(word 1,$^) -o $@ $(addprefix --compendium=,$(filter %/$*.po,$(wordlist 2,$(words $^),$^))) all: all-po install: install-po installdirs: installdirs-po uninstall: uninstall-po clean distclean: clean-po .PHONY: all-po install-po installdirs-po uninstall-po clean-po \ init-po update-po asmdylink.0!``````````````` ` ````~`~` <envSearchSysCache1env errstart_coldenverrmsg_internalenv errfinishenvputsenv hash_searchenvItemPointerEqualsenverrstartenvSysCacheGetAttrNotNullenvtext_to_cstringenvpstrdupenvMemoryContextAllocZeroenvmemsetenvAllocSetContextCreateInternal envformat_procedureenvMemoryContextSetIdentifierenvMemoryContextAllocenvget_func_arg_infoenvpallocenv pg_snprintfenverrcodeenvformat_type_beenverrmsgenvpalloc0envCreateTemplateTupleDescenvTupleDescInitEntry envTupleDescInitEntryCollationenvrepallocenvget_fn_expr_rettypeenverrhintenvtype_is_rowtypeenvReleaseSysCacheenvpfreeenvmemcpyenvfunction_parse_error_transposeenvset_errcontext_domainenverrcontext_msgenvlist_make1_implenvlappendenvNameListToStringenv errdetailenvparser_errpositionenvbms_add_memberenv makeStringenvlist_make2_implenvstrcmpenvlist_make3_implenv makeRangeVarenv list_copyenvlist_delete_lastenvmakeRangeVarFromNameListenvRangeVarGetRelidExtended envSearchSysCacheAttNameenvget_base_element_typeenvlookup_type_cacheenvRelnameGetRelidenvget_rel_type_idenv makeTypeNameenvmakeTypeNameFromNameListenvget_array_typeenvstrlenenvstrspnenv hash_createenvresolve_polymorphic_argtypesenvget_call_expr_argtypeenv expand_arrayenvSPI_freetuptableenvMemoryContextResetenvTransferExpandedObjectenvProcessInterruptsenvCreateTupleDescCopyenvSPI_datumTransferenvget_call_result_typeenv domain_check envFreeExprContextenv makeParamListenvdetoast_external_attrenv datumCopyenvDeleteExpandedObjectenv DatumGetEOHPenvexpanded_record_set_tuple envMemoryContextSetParentenvdeconstruct_expanded_recordenvpg_detoast_datumenv make_expanded_record_from_typeidenvlookup_rowtype_tupdescenvDecrTupleDescRefCountenvexpanded_record_fetch_tupdescenv!make_expanded_record_from_tupdescenvheap_deform_tuple envconvert_tuples_by_positionenvexpanded_record_get_tupleenvexecute_attr_map_tupleenvSPI_returntupleenvEOH_get_flat_sizeenv SPI_pallocenvEOH_flatten_intoenvFreeCachedExpressionenvget_typcollationenvcoerce_to_target_typeenvGetCachedExpressionenv ExecInitExprenv#make_expanded_record_from_exprecordenv"expanded_record_set_field_internal envSPI_register_trigger_dataenv SPI_copytupleenvexpanded_record_lookup_fieldenvFreeExecutorStateenvReleaseAllPlanCacheRefsInOwnerenv invoke_vienv__wasm_setjmp_testenv setTempRet0env getTempRet0envinvoke_viiiiiienv invoke_viii env invoke_viiii env invoke_iiiiii env invoke_iiienv invoke_iienv __wasm_setjmpenvget_typlenbyvalenv datumTransferenv invoke_iiiienvinvoke_venvinvoke_ienv ReThrowErrorenvunpack_sql_stateenvcstring_to_textenv invoke_viiiii envMemoryContextGetParentenvemscripten_longjmpenvCreateExecutorStateenvResourceOwnerCreateenvCreateExprContextenvGetCurrentSubTransactionIdenvSPI_plan_get_cached_planenvReleaseCachedPlanenvSPI_execute_plan_extendedenvSPI_result_code_stringenvGetErrorContextStackenv Int64GetDatumenvSPI_cursor_closeenvSPI_cursor_findenvSPI_cursor_open_with_paramlistenvget_element_typeenvpg_detoast_datum_copyenvarray_create_iteratorenv array_iterateenv"MakeExpandedObjectReadOnlyInternalenvtuplestore_putvalues envtuplestore_puttupleenvtuplestore_tuple_countenvCreateDestReceiverenvSetTuplestoreDestReceiverParams envgetTypeOutputInfoenvOidOutputFunctionCallenvMemoryContextStrdupenvSPI_execute_extendedenvinitStringInfoenvappendStringInfoCharenvappendStringInfoStringenverrdetail_internalenvSPI_scroll_cursor_fetchenvSPI_scroll_cursor_moveenvSPI_commit_and_chainenv SPI_commitenvSPI_rollback_and_chainenv SPI_rollbackenverr_generic_stringenvSPI_prepare_extendedenv SPI_keepplanenvSPI_plan_get_plan_sourcesenv#CachedPlanAllowsSimpleValidityCheckenvEnsurePortalSnapshotExistsenvCachedPlanIsSimplyValidenvExecInitExprWithParamsenvCommandCounterIncrementenvGetTransactionSnapshotenvPushActiveSnapshotenvPopActiveSnapshotenv errmsg_pluralenv SPI_getbinvalenvexprTypeenv exprTypmodenvcontain_mutable_functionsenv bms_is_memberenvget_typsubscriptenvSPI_execute_plan_with_paramlistenv PinPortalenvSPI_cursor_fetchenv UnpinPortalenvDirectFunctionCall1Collenvget_namespace_nameenvconstruct_md_arrayenvGetCommandTagNameenvBlessTupleDescenvexpanded_record_fetch_fieldenvHeapTupleHeaderGetDatumenvheap_form_tupleenvtuplestore_begin_heapenvbms_next_memberenvappendStringInfoenvappendStringInfoStringQuotedenvSPI_cursor_parse_openenvExprEvalPushStepenvexpanded_record_set_fields envtypenameTypeIdAndMod envstrcpyenv SPI_freeplanenvMemoryContextDeleteenv pg_printfenvfflushenvget_collation_oidenvmemmoveenv list_freeenvtypeStringToTypeNameenv raw_parserenvquote_identifierenvappendStringInfoSpacesenvscanner_isspaceenvgeterrpositionenvgetinternalerrpositionenvinternalerrpositionenv errpositionenvpg_bindtextdomainenvDefineCustomEnumVariableenvDefineCustomBoolVariableenvDefineCustomStringVariableenvMarkGUCPrefixReservedenvRegisterXactCallbackenvRegisterSubXactCallbackenvfind_rendezvous_variableenv pg_strcasecmpenvSplitIdentifierStringenv__errno_locationenvpre_format_elog_stringenvformat_elog_stringenv guc_mallocenv invoke_viienvinvoke_iiiiiiienv SPI_finishenvCheckFunctionValidatorAccessenv get_typtypeenv SPI_connectenvScanKeywordLookupenv core_yylexenvappendBinaryStringInfoenvpg_mbstrlen_with_lenenvinternalerrqueryenvstrchrenv scanner_initenvscanner_finishenv__stack_pointerenv __memory_baseenv __table_baseGOT.memerror_context_stackGOT.memTopMemoryContextGOT.memCurrentMemoryContextGOT.memcheck_function_bodiesGOT.memInterruptPendingGOT.memCurrentResourceOwnerGOT.funcplpgsql_parser_setupGOT.mem __THREW__GOT.funcDeleteExpandedObjectGOT.mem __threwValueGOT.funcpfreeGOT.funcAllocSetContextCreateInternalGOT.func errstart_coldGOT.funcerrmsg_internalGOT.func errfinishGOT.funcputsGOT.funcBeginInternalSubTransactionGOT.memPG_exception_stackGOT.funcget_typlenbyvalGOT.func datumTransferGOT.funcReleaseCurrentSubTransactionGOT.func CopyErrorDataGOT.funcFlushErrorStateGOT.func'RollbackAndReleaseCurrentSubTransactionGOT.funcMemoryContextDeleteChildrenGOT.funcMemoryContextResetGOT.funcstrcmpGOT.func ReThrowErrorGOT.funcunpack_sql_stateGOT.funccstring_to_textGOT.funcMemoryContextGetParentGOT.memMyProcGOT.memTopTransactionContextGOT.memTopTransactionResourceOwnerGOT.mem SPI_processedGOT.mem SPI_tuptableGOT.mem SPI_resultGOT.funcnameinGOT.memwork_memGOT.memstdoutGOT.memGUC_check_errdetail_stringGOT.funcSPI_connect_extGOT.funcSPI_result_code_stringGOT.funcplpgsql_compileGOT.funcResourceOwnerCreateGOT.funcReleaseAllPlanCacheRefsInOwnerGOT.funcResourceOwnerDeleteGOT.func pg_re_throwGOT.func SPI_finishGOT.funcCreateExecutorStateGOT.funcFreeExecutorStateGOT.funcGetCurrentSubTransactionIdenvmemoryenv__indirect_function_tablep!               A A A A A A A A A A A A A A A A A A A A A A A __wasm_call_ctorsplpgsql_compileplpgsql_build_datatypeplpgsql_parser_setupplpgsql_ns_lookupplpgsql_recognize_err_conditionplpgsql_stmt_typenameplpgsql_exec_get_datum_type Pg_magic_func_PG_initpg_finfo_plpgsql_call_handlerplpgsql_call_handlerpg_finfo_plpgsql_inline_handlerplpgsql_inline_handlerpg_finfo_plpgsql_validatorplpgsql_validator__wasm_apply_data_relocs H# !  $#Aj#Aj6#Aj#A1j6#Aj#Aj6#Aj#Aj6#Aj#A9j6#Aj#A9j6#Aj#A/j6#Aj#A?j6#Aj#A1j6#Aj#Aj6#Aj#Aj6#Aj#A1j6#Aj#Aj6#Aj#A%j6#Aj#Aj6#Aj#A2j6#Aj#A&j6#Aj#Aj6#Aj#Aj6#Aj#A.j6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A7j6#Aj#A6j6#Aj#A5j6#Aj#A5j6#Aj#Aj6#Aj#Aj6#Aj#A*j6#Aj#Aj6#Aj#Aj6#Aj#A)j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#A)j6#Aj#Aj6#Aj#Aj6#Aj#A(j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A'j6#Aj#A&j6#Aj#Aj6#Aj#Aj6#Aj#A0j6#Aj#Aj6#Aj#A?j6#Aj#A?j6#Aj#A>j6#Aj#A@k6#Aj#A?j6#Aj#A?j6#Aj#Aj6#Aj#Aj6#Aj#A:j6#Aj#Aj6#Aj#Aj6#Aj#A;j6#Aj#A;j6#Aj#A:j6#Aj#A:j6#Aj#Aj6#Aj#A:j6#Aj#A:j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A=j6#Aj#A1j6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A2j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A1j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A0j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A>j6#Aj#Aj6#Aj#A/j6#Aj#Aj6#Aj#Aj6#Aj#A&j6#Aj#Aj6#Aj#Aj6#Aj#A'j6#Aj#A'j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A7j6#Aj#Aj6#Aj#A)j6#Aj#Aj6#Aj#Aj6#Aj#A%j6#Aj#Aj6#Aj#A6j6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A5j6#Aj#A(j6#Aj#Aj6#Aj#Aj6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A3j6#Aj#A2j6#Aj#A4j6#Aj#A3j6#Aj#A2j6#Aj#A?j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A2j6#Aj#Aj6#Aj#A/j6#Aj#A/j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A&j6#Aj#A&j6#Aj#Aj6#Aj#Aj6#Aj#A'j6#Aj#Aj6#Aj#A&j6#Aj#Aj6#Aj#Aj6#Aj#A'j6#Aj#A>j6#Aj#Aj6#Aj#Aj6#Aj#A-j6#Aj#Aj6#Aj#Aj6#Aj#A,j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A(j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A/j6#Aj#Aj6#Aj#A:j6#Aj#A'j6#Aj#A1j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A'j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AЖj6#Aj#Aj6#Aj#A–j6#Aj#Aj6#Aj#Aޖj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AŃj6#Aj#Aj6#Aj#Aуj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A(j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A j6 #Aj$7#Aj$8#Aj$9#Aj$:#Aj$;#Aj$<#Aj$=#Aj$>#Aj$?#Aj$@#Aj$A#Aj$B#Aj$C#Aj$D#Aj$E#Aj$F#Aj$G#Aj$H#Aj$I#Aj$J#Aj$K#Aj$L#Aj$M ,~#Ak"$A- (("" E@A#Aj@  6#"Aj  AjA Aj #Aj Aj! (" -j! (("!@@ E@  Aj A!#Aj( AjAA"E  ("E  (! @ ( (G A j E !  ("@@#Aj( AA A#AjE #"AjA AjA Aj A6 A! (E@  (E! @ E   Aj A!#Aj( AjAA"E  ("E @ ( ((G A j E !  ("@@#Aj( AA A#AjE #"AjA AjA Aj A6 (  A  (!  A ! E  Aj  (" -j! ("AA ("AFA AGA ! A- A "#"Aj Aj"  6 Aj :  A 6 #6#"(!  Aj6  6@ E@#(A !  AA  #"Aj 6#!A!#( A8jAAA ! Aj" (6  6  (("6    ((6  ((6  (6  /; ( !  6 A6  6 #7(6 #8-: #9(A 6#:(!  6  A 6 -`! A: A6  :1 A AjA6 AjA: AjA6 (A! AjA6 Aj 6@@@@@@@@@@ ( #"#"Aj(6 Aj Aj Aj" ( ( ((  Aj( At"! !  6@ AL@A!  A! A!@ At" (j(! ("  j,A !  Aj"6 AjA #Aj Aj A (A" (AF@A#Aj@A  6 #"Aj A j AjA Aj #Aj @ ("@  j("-  Aj! A A"(! @ Ak"AK A tAqE  Atj (6 Aj! AA ! @ AK A tAqE  Atj 6 Aj! ( Aj@ ("E  j("-E (   G @ AL@ AG  -1AG  A("A6 #Aj6 A6 !  6  6  At"6  6$A!@@@@  At" j("( Aj! A!A  A#Aj@  (60#"Aj A0j AjA Aj #Aj (" Aj! (! ( ! (! ( j (6 ($ j (6 ( Aj"" ( A (   G #"Aj(! Aj(" Aj(F@#"Aj At6 Aj At" 6 Aj(!  6#Aj Aj6 Atj 6 Aj  (Aj !  (6 @ (l"AL@@ "Ak  AF  AF  A'kAI A#kAI AF ! @A! A'J  AF AF  A#G A"! (" A#Aj@A #"Aj(6p Aj Aj AjA Aj #Aj A6, A6$ /h@A#Aj@A#"AjA AjA AjA Aj #Aj A("A6#"Aj ! B7 B7 A6  6 Aj(! Aj(" Aj(F@#"Aj At6 Aj  At"6 Aj(!  6#"Aj" Aj6  Atj 6A ( (  (6A("A6 Aj ! B7 B7A! A6  6 Aj(! (" Aj(F@#"Aj At6 Aj At" 6 Aj(!  6#"Aj Aj6 Atj 6A ( (  (6 AjAAA (AA"A60 A6 AjAAA (AA"A60 A6 AjAAA (AA"A60 A6 A.jAAA (AA"A60 A6 AjAAAAAA"A60 A6 AjAAA (AA"A60 A6 AjAAA (AA"A60 A6 AjAAA (AA"A60 A6 AjAAAAAA"A60 A6 AjAAA (AA"A 60 A6  A6, A6$ /hE A#Aj@A#"AjA AjA Aj #Aj A#Aj@  (6#"Aj Aj AjA Aj #Aj A!#"A jAAA (AA"A 60 A6 AjAAA (AA"A 60 A6 A  A'k A!  A!  6$  -d:/A "E@A#Aj@  6@#"Aj A@k AjA Aj #Aj @ (" -j"-OAG @@@ Ak AF  AG  A#Aj@A#"AjA AjA Aj #Aj A#Aj@A  6P#"A j Aj AjA Aj #Aj  :-  -OAF:.  -N:,  .L6(@@@@ (l"AL@@ Ak AF  AG   A'kAI  AF  A#F    A#G     #AjA A (AA  AJ !  -eAG:0 #AjAAAAAA(6"@A#Aj@  6`#"Aj Aj AjA Aj #Aj #Aj(6  @@  ($AF -/AG    .h"64 AJ@ A8j!A!@  At"j  j(6 Aj" (4H #Aj"("6  At"6A!@ (AL@A!  A!@  At"j#Aj( j(6@@@ (" j(( A8j!  A(j! Aj"#Aj(H  6#Aj-AF@A!#Ak"$  (6#"Aj Aj AjA (AJ@@ ( Atj(!  6#Aj Aj@@@@@@ (" (! (")!  (6|  7t  6p#Aڙj Aj -AF@#AΚjA -AF@#AɛjA (@#"AjA  ((6` Aj Aj AjA (@ ( "AN@  6P#Aj Aj #"AғjA  ((6@ Aj A@k AjA (0"E   60#Aj A0j   (6#Aj Aj (AJ@A!@ At" ( j(!  ($ j(6  6#Aj Aj Aj" (H #AjA  (!  (6  6#Aj Aj -AF@#AΚjA -AF@#AɛjA (E #"AjA  ((6 Aj Aj AjA   )7#Aj Aj   6 #Aj A j Aj" (H #"AjA AjA6  ((6 Aj Aj (  (6 A֝j #*( Aj$ #Aj( AjA Aj!@ -AG A#AjE #"AjA AjA A j  6  6#"AjA6 AjA:# (6 Aj"(! A6# 6  ( 6 Aj$  @ AqE@  Aj"O  A As  Aj"  KjA|qAj   AA   ((6A!A! ("@ (AF!  :  (" (AF  :@  As  (((6  ( 6 .h"AJ@ Aj Aj At!! .h A ((  Aj ~#Ak"$@@ @#! "  Aj(   #Aj(E  #"Aj# Aj(! #Aj(6  6 Aj $ Aj$ #Ak"$@@ @ AL  Aq!A! AG@ Aq!@A!@@@@  Atj"("AL@@ Ak AF  AF   @ A'k AF  A#G A"!  A!  A!  6 A!@@@ Aj"("AL@@ Ak AF  AF   @@ A'k AF A#G A"!  A!  A! 6 Aj! Aj" G E A!@@  Atj"("AL@@ Ak AF  AF   @@ A'k AF A#G A"!  A!  A!  6    ?E  AL A!A!@@@ E  j-Ak @  Atj"("AG AGq  @"E  6 Aj! Aj" G Aj$ A#Aj@A  6#"A׏j  AjA Aj #Aj s#Ak"$A "E@A#Aj@  6#"Aj  AjA Aj #Aj    !  Aj$ #A k"$@@@@@ ( A4"A6  ! A;, A6(  6  6  6#"Aj(! Aj(" Aj(F@#"Aj At6 Aj  At"6 Aj(!  6#Aj Aj6  Atj 6 E A (   A#Aj@A  (6  6#"Aj Aj AjA Aj #Aj A#Aj@  (6#"Aj  AjA Aj #Aj   ( ! A j$  x#Ak"$A AAA@A#Aj@A  6#"Aj  AjA Aj #Aj   Aj$ ~#A0k"$ (" -j"-RE@A#Aj@A   Aj6 #"Aj A j AjA Aj #Aj A0" Aj 6 ("6@@@@@@ -OAk (  A  AG  A  A#Aj@  ,O6#"Aj  AjA Aj #Aj A ! 6 /L; -N: -O:  ("   6@@@@ -OAk A!@ (\E (XA0G -AG! :  A!@ /LAG -AF (5AG! (! :  A: 6~@ AG ("AF A"6"- AF@ (A6! (E@A#Aj@A  (6#"Aj Aj AjA Aj #Aj 6 6 )  B7B ! 7( A0j$ #Ak"$@ ("(E@ ( E  A "A6 (Aj"6  6  ("6  6 A Aj%6 6 @ ("@ ( (AtjAk((A F  A"A 6 (Aj"6 A6  6  (6 (( &! ( 6 Aj$ #Ak"$ #"Aj Aj"6 Aj#-:  6 #6#"(! Aj6  6 AjA"6#"( AjAAA ! Aj" (6 6  ! A6  6 B7  6 #7(6#8-! A: A6 B7  : A AjA6 AjA: AjA6 (A! AjA6 Aj 6 B摀7$ A6, A;0  AjAAAAAA(6"@A#Aj@  6#"Aj  AjA Aj #Aj #Aj(6 ($AF@  A64 #Aj"("6  At"6A! (AJ@A!@  At"j#Aj( j(6@@@ (" j(( A8j!  A(j! Aj"#Aj(H  6#"AjA6 AjA:# (6 Aj"(! A6# 6 Aj$  A("A6  ! B7  6  6  6  6#"Aj(! Aj(" Aj(F@#"Aj At6 Aj  At"6 Aj(!  6#Aj Aj6  Atj 6 @A ( (  ) 6t #"Aj6l Aj6h Aj6d #A0k"$ (t!  (6 AjA #Aj A! (A AjAAA"@ ("("(D ("Atj(! (!#"(! ( 6  ( *6 6A" Aj6 B7   A j Aj Aj 6 A0j$ #Ak"$@ (t"(("AF A AF   E! E E A#Aj@A  ('6#"Aj  AjA( () AjA Aj #Aj Aj$  & (t"((AF  A   #A k"$@ ("E ((!@@@@ (Ak ( ((!A! A! A  #! ( "((! ("(AF@ Aj! A!  A! A! ! A! ("  #! ( "((! ((! ("(AF@ Aj!A!  A! (" !A  A ! !A! (A    Aj"E @@@@@@ (Ak (" F   G  (D" (Atj(( "AH @  Atj("( -E  ("AN  A#Aj@  (6#"Aj  AjA Aj #Aj ( G  (! ("("(D Atj(! (!#"(!  ( 6  ( *6  6A" Aj6 B7  A j Aj Aj  6  E A#Aj@A  6  6#"Aj Aj () AjA Aj #Aj A j$  #Ak"$#;!@@ E ( A AAA"E A! (AkAM@#Aj( (Atj(!  6  6 -! A6  A"F:  A#Aj@  (6#"Aj  AjA Aj #Aj  6  -A"F:A! Aj$  #A k"$  +6  +"6  6  (6#;!A Aj A j,!@@ (AF A A Aj"E @@ (Ak #Aj( (Atj(!  6 A: A6  6A!  #Aj( (Atj(!A! (AF@  !  6 A: A6  6   6A! A j$ @ ( "AN@#Aj(!@  Atj("( -E  ("AN A0"A6   6 (! B7  6 #"Aj(! Aj(" Aj(F@#"Aj At6 Aj  At"6 Aj(!  6#Aj Aj6  Atj 6  ( 6 (6  #Ak"$@A AAA"@ (AkAI  A#Aj@A   6#"Aj  AjA Aj #Aj #Aj( (Atj((! Aj$  #A k"$ 7"E@A#Aj@A  6#"Aj  AjA Aj #Aj 8"E@A#Aj@A  6#"Aj Aj AjA Aj #Aj AA 9! A j$ #"Aj(! Aj(" Aj(F@#"Aj At6 Aj  At"6 Aj(! 6#Aj Aj6  Atj 6 #Ak"$ -E@ (;"E@A#Aj@A   (6#"A j  AjA Aj #Aj  ( (A! Aj$ #Ak"$@@ E 6 @ @ 6P B7 #(6(#AjA A>!  #"Aj(6P Aj(" B7#"Aj AjA A(>"6 6\#Aj(! A6` A6X   6T#(! B7p A6h 6d B7x B7 A6 @#<("("E #"Aj6 ( Aj6 ( Aj6 ( A j6 ( A j6$ (("E   A0j$ #A@j"$@@@@ ("@ A j  (|"E  Aj (! (@ AL #"Aj# ((!  (68  64  60 A!j A0j$  (|E  AL #"Aj# ((!  (|6(  6$  6 Aj A j$  (  #"Aj#  ((6 Aj $  #"Aj# ((!  (6  6 Aj Aj$ A@k$ #Ak"$ (@"At6D (! AJ@ (D! (!A! !@@@@@  At"j("(  )7  ) 7  )7  )7  )7 A(j  A#Aj@  (6#"Aj  AjA Aj #Aj  )7  (060  )(7(  ) 7  )7  )7  )7 A8j ! !  j 6 ! Aj" G Aj$ @  -Aq (/ AG -AG -AqAF #"(!  (x(6 L!  6 @  A! AAM! @ --AG @ -, (/ AG (("-AG -AG N  (( A60  :-  :,  6( #A k"$@@@ -AG -AqAG O! (AG@ (!A!   ($F  @ -AG -AG (" ( G@ AG  -Aq     @ ($"E -AqE ($" ($G AF@ (("AH   ((G   (TA -AsAqP   !@ ("AqE ("AG@  ($G   (TA -AsAqP ( (HQ ($"@ A jN  6$  Aq  R    #"(!  (x(6 S!  6 (!  6 A6 A; A6  Av6 (! (!@ (AG @ ($"E  ($G AF@ AH   ((G   A jA -AsAqP  ("AG  Gq   (x(T" A jA -AsAqP ( (HQ ($"@ A jN  6$   A j  U" ( AH  V  AqE@ A (,"  W   R   (8 (< (,"  W  A j$  #Ak"$@@ (AG E@@ ("E -AG  ($"AAAP ( (HQ ($"@ A jN  6$  ($"@ A jN A6$  (x(! (AG@  (A T   X !@@@ ("AF E  (F (,"E@ W! (" (G  AL  Aj! Aj! A!@ Al"j"-_"  j"-_G @ E@ (D (DG  (P"AH   (PF   /H /HG  -W -WG  Aj" G  R   A -AsAqP ( (HQ ($"@ A jN  6$  @ E E @ ("AI@ "A@k!  (x( Al" Atj!    Y        AAA Aj$ "#Ak"$ A6 #A ?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ #> Ak(6  #?A:  @ ("-AG -AG - #@(A:  #Aj-E@#@(A:  A#Aj@  (6#"Aj  AjA Aj #Aj #@(A6  #@(A6  #@(A6   (6   ( 6  A "A6  Ak(6#@(" (Aj"6  6  Ak"(6  Ak(6  Ak(6  A0k(6  A k(6 ( ( (  6  #;A6 (! B7  6  #;A6 Ak(! B7  6  #;A6  A k(6  6  A#;A6  A#Aj@A#"A(jA Ak( AjA Aj #Aj A k("@ A0k"("(E@A#Aj@A   ((6 #"Aj A j Ak( AjA Aj #Aj  6 Ak( Ak( A0k(A" A@j-:  Ak-":  ("6 AG   A#Aj@A   (6#"Aj Aj Ak( AjA Aj #Aj Ak("( ( A@j(  A k(A   Ak( Ak(A AAAA" (6 A k(" (A 6 Ak(Ar6$  A6  A6  A6  6  A6  A("#Aj6 A6A! Ak(! A6  6 A! Ak" ("@ (!  6  At6  (At6$ ("E A! (AL @ At" ( j ( j("(6 ($ j (6 Aj" (H   ("6,  6 A A,j%6   A k( (&6   Ak( A k( (A6  A (AAA"E@A#Aj@A   (60#"Aj A0j ( AjA Aj #Aj  6  A (AAA"E@A#Aj@A   (6@#"Aj A@k ( AjA Aj #Aj  6  @@ ("E @@ (Ak A (( "(( ((AA  A (( "(( (( ((A "  A#Aj@A   ('6P#"Aj Aj ( AjA Aj #Aj  6   (6  (6A (AAA #@("-AqE@ -AqE  A (AAAE #@((AqAj#AjE A  (6`#"Aj Aj ( AjA Aj   ( 6  (6A (AAA #@("-AqE@ -AqE  A (AAAE #@((AqAj#AjE A  (6p#"Aj Aj ( AjA Aj  A:  A:  #Aj"(!#A0k" $ A~F@! #Aj(!@@@ AF@#Aj(!"A%G "!@@@@ Ak  A! AG@ !  #Aj- #Aj(" E  #Aj-  !   #Aj-  !   @#Aj( !"A%G "!@@@@ Ak  A! AG@ !  #Aj- #Aj(" E  #Aj-  !   #Aj-  !   AG #Aj(!"A%G "!@@@@ Ak  A! AG@ !  #Aj- #Aj(" E  #Aj-  #A k" $#"(! #Aj(6@@ E (AG @A ( "(( ((A Aj"E ("AF@#Aj( (Atj((!  AG (AG #Aj( (Atj((!  A ( ((A/! ( Aj  012! ( (AtjAk ((! AAAA3 4"E@A#Aj@A ( 6 6#"Aj  AjA Aj #Aj A (" -j"(D"E@A#Aj@ (D6#"Aj Aj AjA Aj #Aj #" 6  (P (dA! #Aj(6   # 6 A j$   #Aj-  #Ak"$#"(! #Aj(6 2"AAAA38"E@A#Aj@A  ( 6#"Aj  AjA Aj #Aj # 6 AA :! Aj$  !  !   A!@@@@@@ AL@@ A;k AF  E   Ak  #A=j AG   #Aj A,G A)Gq rE AAA A)F A(F j!!  Aj Aj #Aj( ("-@#"(!  Aj6 6$ #Aj6 6 A$j6 A A" A,j A(j  (6 (, ((#@(( ! (   #A=j A!@@@@@"Ak #Aj- #Aj("E  #Aj-  A!! AF@@"AF  AG "AF  !   E  !  A  #Aj A0j$ A~6  6  A6   (+"6x  6 A Aj%A6   ( +"6|  6 A Aj%A6   (A6  A:  A:  A6  A;AA#AjAAAAA6  A6  Ak(! ("E@  6   &6   Ak(6   (6   (6   (6   (6   (6   (6   (6   (6   (6   (6 ~  (6 }  (6 |  (6 {  (6 z  (6 y  (6 x  (6 w  (6 v  (6 u  (6 t  (6 s  (6 r  (6 q A"A6  (6#@(" (Aj"6  6A A;AA#"AjAAA AjA"6 (" Aj"(6  (6 ( (" Aj < ( "( ( (Aj  6 p A"A6  (6#@"(" (Aj"6  6A! A:  6 (A:  6 o A"A6  (6#@"(" (Aj"6  6A! A:  6 (A:  6 n A! (E@@ ( "@ ("AkAI  A#Aj@#"AjA AjA Aj #Aj Aj! ( (A"A6  (6#@(" (Aj"6  6  ((6 A A;AA#Aj AAAA6  6 m A" A6 Ak"(6#@(" (Aj"6 6 A0k-": Ak("6@ E ("AL A! A AJ! ( !@@@  Atj(" ("AkA O@@  AqE A#Aj@A  (6#"Aj Aj ( AjA Aj #Aj Aq A#Aj@A  (6#"Aj Aj ( AjA Aj #Aj A#Aj@  (6#"Aj Aj AjA Aj #Aj Aj" G  6 l A: k A: j A: i  A k( (&6 h  ("6  6 A Aj%6 g A" A k((6 (6  6 f "A#A j@ A6 f A#Aj@ A6 f A#Aj@ A6 f A#Aj@ A6 f A#A j@ A6 f A#Aj@ A6 f A#Aj@ A6 f A#Aj@ A6 f A#Aj@ A 6 f A#Aj@ A 6 f A#Aj@ A 6 f A#Aj@ A 6 f A#Aj@ A6 f #Aj @ ((AkAO@AG  A#Aj@A  ("  ( ' 6#"Aj Aj ( AjA Aj #Aj ( (  (6 d  (  ( A"A6  Ak(6#@(" (Aj"6  6  Ak(6  Ak(6  A@j(6  A0k(6  6 a A6 ` A " Ak(6  Ak(6  (6  A0k( &6 _ A6 ^  (6 ] Ak(! Ak(! A@j(! A0k(! #Ak" $A "A6  6#@(" (Aj"6  AG:  6 A6  6  6@ E (AG ( ( A!  6@ E #D(6 A0jA #Aj AjA!  A0j (AAAAA(6 E (AL @ ( Atj((! A j (6 A0j6 A j#Aj  ( (  6 6 (  Aj" (H Aj$  6 \ A!"AG@ AAA#AjAAAAA! A  6 [  Ak( (&6 Z  ("6  6 A Aj%6 Y A " Ak(6  Ak(6  (6  6 X A6 W ("@  6 W A6 A6 A Aj%6 V A"A6  Ak(6#@(" (Aj"6  6  A k"(6  (6 ( ( (  6 U A"A6  Ak(6#@(" (Aj"6  6  A0k"(6  Ak(6  (6 ( ( (  6 T Ak("(!  Ak(6  A0k"(6 A$A AFj (6  6 ( ( ( S "6#Aj(!@ AG@ AG AAA#AƀjAAAA Aj!A "A6#@(" (Aj"6  6 Ak"("@  6 ( Ak( R Ak("@  Ak(  A k( Ak(6 R A#Aj@A #"AjA Ak( AjA Aj #Aj #Aj("( ((A G A "A6#@(" (Aj"6  6  (6@ Ak(E Ak(E A#Aj@A#"AjA Ak( AjA Aj #Aj (E@A#Aj@A#"AjA  AjA Aj #Aj  A6  Ak( A k(AAA6  6 S @@ A#Aj"@AAA#AjAAA Aj Aj! (AF A#Aj@A#"A-jA  AjA Aj #Aj AAA#AjAAA Aj Aj! (AG  A6 (A (A!AAA#AjAAAA Aj! (AF@AAA#AjAAAAA! @ Ak(E Ak(E A#Aj@A#"AjA Ak( AjA Aj #Aj Ak( A k(AAAAA! A("A6#@(" (Aj" 6 6 6 6 6 6 6  6 S ( ( (A"A6#@(" (Aj"6  6 Ak"("@  6 ( Ak( O Ak("@  Ak(  A k( Ak(6 O A#Aj@A#"AjA Ak( AjA Aj #Aj  ("  ( ' 6  (6 ("(AkAM@ A6  (6 R A6  6" A,G Q  ( ( (6 Q  (6 (! B7  6" A,G P  (  ( A "A 6  Ak(6#@(" (Aj"6  6  Ak"(6  A@j(6  Ak(6  (6@ Ak"(" Ak"(" A#Aj@A#"AjA Ak( AjA Aj #Aj  (6 ( Ak( ( ( (  6 N A6 M  (6 L A"A 6#@(" (Aj"6  6  A k-:  Ak" (6  Ak"(6  (6 (!!@ @ (! @@@ ( A j -   (" A "E@A#Aj@A  (6#"A j Aj Ak( AjA Aj #Aj (AF  - A#Aj@A  (6#"Aj Aj Ak( AjA Aj #Aj  @@@ ( (AG   (" A A#Aj@A#"Aj A-j - A ( AjA Aj #Aj  6 K A: J A: I "E 3 A#Aj@  (!#@(-/E@A#Aj@A #"A8jA  AjA A j #Aj A"A 6  6#@(" (Aj"6 Bp7  6 (!! AN@ A;G@A#Aj@A #"AjA Aj( AjA A j #Aj #@((6   @ AG A;G #Aj("("AK AF  (6    A;AA#AjAAAAA6  6 I A#Aj@ (!#Ak"$#@(-/E@A#Aj@A #"A8jA  AjA A j #Aj A"A 6 6#@(" (Aj"6 6@"AG@  A;AA#AjAAAAA6  A;AA#AـjAAAA A j6 ( AG @A,A;A#A݄jAAAA A j! ( &6 ( A,F Aj$  6 I   (!A"A 6  6#@(" (Aj"6 Bp7  6@ -/AF@A;F A#Aj@A #"AjA AjA Aj( AjA A j #Aj ($AF@A;F #@(-1!A#Aj! AF@ @A#"AjA Aj( AjA A j #Aj @A #"AjA Aj( AjA A j #Aj (!! AN@ A;G@A#Aj@A #"AjA Aj( AjA A j #Aj #@((6   @ AG A;G #Aj("("AK AF  (6    A;AA#AjAAAAA6  6 H A "A6  (6#@(" (Aj"6 B7 A6  6 B7 "6@ A;F E 4@ A A#A2j A A#Aj A A#Aj A A#A/j A A#Aj  A#AjE A 6 "6 @@@@ AG@ AF  #A4j #Aj(6 "6@@ A,k AF  #A'j Aj!@ A#Aj@AG :#Aj(" A k(! AjAA;G 3 -!AF@A#Aj@A#"AjA A k( AjA Aj #Aj  A k(6  (6 Ak((! A:  6  6 = A k(" A k(6 Ak((! A:  6  6 < #Ak"$ A:A$"A6#@(" (Aj"6 A:! A6 B7  6@@@@@@@@@@@@"Ak)   @@ Ak  #A4j #Aj- #Aj("E #Aj-E #A(j-  A6 #Aj("E  #Aj-  A6  #Aj-  Bp7  #Aj("E  #Aj-  A6 AAA#AjAAAAA6 A:  #Aj-  A6 AAA#AjAAAAA6 A:  A#Aj@ A:! A6  A#Aj@  Aj  A#Aj@ A6  Aj  @@@@ Ak A:  AF  AAA#AjAAAAA! A:!  6 A:  A A: @ -AG @Ak #Aj Aj$  6 ; A"A6  Ak(6#@(" (Aj"6  6  Ak((6  6 : A6 9 A"A6  Ak(6#@(" (Aj"6  6  Ak(AG:  6 8 A"A6  Ak(6#@(" (Aj"6  6  Ak(AG:  6 7 A6 6 A6 5 A6 4 @ ((E@AG  A#Aj@A #"AjA ( AjA Aj #Aj ("((A G@A#Aj@A   ((6#"A%j Aj ( AjA Aj #Aj  6 3  (  ( A6 0 #@! (!A !#"Aj AA ((AA"A: (6 Aj AA ((AA"A: (6  6 / Ak(" (6  6 .  Ak( (&6 -  ("6  6 A Aj%6 , A " A k(6  A k(6  (6  6 + A k"(!@ "("  (6  (6 *  (6 ) ("#Aj-@A!A!#Ak" $@ #"Aj-@ Aj! Aj!@  -E@A " 6 6 (6 ! #Aj Aj"Atj" ("  A#Aj@A  6#"Aj  AjA A4j #Aj A "A6  6 A6 Aj$  6 ) AG #Aj("6 A0j$#EA#FA Aj! AjA: Aj 6 #A k"$@ (#AjE@A!  (#AjE@  ( "A, AjE@(#"Aj#+ AjA6  (A  @ ("E@  (AL A!@A!@ ( Atj("#AjE #AjE@A!  #A jE@A!  @ #Aj@ #Aj  (#"Aj  6#+ Aćj 6  (A  (#"Aj  6#+ Aj Aj6  (A   r! Aj" (H  ( AAA"E  6  6A ! A j$ #Aj (6 #Aj (6 #Aj #Ak"$ A6A ("E A (AG  -As ! # "A6#, Aqv! (! A6# !A!@@ E ("E  Ajn"E  o p!@ AF AG@# "A6#A#Aju! (! A6# !A!@ E ("E  Ajn"E  o p! AF  @# "A6#- v! (! A6# !A!@ E ("E  Ajn"E  o p! AF # "A6  6##A"j Aju (! A6# !A!@ E ("E  Ajn"E  o p! AF # "A6##"AjA A*jr (! A6# !A!@ E ("E  Ajn"E  o p! AF  # "A6##Ajv (! A6# !@ E ("E  AjnE  o p!  # "A6#. Au! (! A6# !A!@ E ("E  Ajn"E  o p! AF  (Aj6 Aj! Aj! (!A!A!@@ AqE -AG # "A6#/A#Aju! (! A6# !A!@ E ("E  Ajn"E  o p! AF  #(! #(! A jA Ajw  ! @@ " # A j6@ ("E @@ (Ak # "A6#G  u! (! A6# !A!@ E ("E  Ajn"E  o p! AF   6  # "A6#H   (! A6# !A!@ E ("E  Ajn"E  o p! AF   # "A6A!#I  AA  AsAq! (! A6# !@ E ("E  Ajn"E  o p! AF   6 # 6# 6A! (Ak6  6 @# "A6#0 m (! A6# !@ E ("E  Ajn"E  o p! AF # "A6#1 m (! A6# !A!@ E ("E  Ajn"E  o p! AF  @# "A6#2{ (! A6# !@ E ("E  AjnE  o p!  # 6# 6# "A6#3|! (! A6# !A!@ E ("E  Ajn"E  o p! AF @@@ AG@# "A6#A#Aju! (! A6# !A!@ E ("E  Ajn"E  o p! AF  E # "A6#- v! (! A6# !A!@ E ("E  Ajn"E  o p! AF # "A6  6##A"j u (! A6# !A!@ E ("E  Ajn"E  o p! AF # "A6##"AjA A*jr (! A6# !A! E  ("E   Ajn"   (! Aj$  o p! AF  # "A6##Ajv (! A6# !@ E ("E  AjnE  o p!   #Aj  #Ak"$ (" - !# "A6#, Asv! (! A6# !A!@@ E ("E Ajn"E  o p AF  AG@# "A6#A#Aju! (! A6# !A!@ E ("E Ajn"E  o p AF  @# "A6#- v! (! A6# !A!@ E ("E Ajn"E  o p AF # "A6  6##A"j Aju (! A6# !A!@ E ("E Ajn"E  o p AF # "A6##"AjA A+jr (! A6# !A!@ E ("E Ajn"E  o p AF  # "A6##Ajv (! A6# !@ E ("E AjnE  o p  (!# "A6#J v! (! A6# !A!@ E ("E Ajn"E  o p AF   (Aj6 B7 B7 B7 A6# "A6 B7 B7 #(6  Aj6#4|! (! A6# !A!@ E ("E Ajn"E  o Aj!p AF # "A6#/A#Aju! (! A6# !A!@ E ("E Ajn"E  o p AF #(! #(! A jA AjwA !@@@@ E@# A j6 - !# "A6#I  Aj   ! (! A6# !A!@ E ("E Ajn"E  o p! AF # 6# 6# "A6#5 m (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#0 m (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#1 m (! A6# !A!@ E ("E Ajn"E  o p! AF A!  (Ak6# "A6#K m (! A6# !@ E ("E Ajn"E  o p! AF # "A6#3|! (! A6# !A!@ E ("E Ajn"E  o p! AF  AF # "A6#A#Aju! (! A6# !A!@ E ("E Ajn"E  o p! AF  @# "A6#- v! (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6  6##A"j u (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6##"AjA A+jr (! A6# !A!@ E ("E Ajn"E  o p! AF  # "A6##Ajv (! A6# !@ E ("E AjnE  o p!  # 6# 6# "A6#6|! (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#FA AAs (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#5 m (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#0 m (! A6# !A!@ E ("E Ajn"E  o p! AF # "A6#1 m (! A6# !A!@ E ("E Ajn"E  o p! AF A!  (Ak6# "A6#K m (! A6# !@ E ("E Ajn"E  o p! AF # "A6#2{ (! A6# ! E  ("E  Ajn   Aj$  o p!  #Aj #Ak"$@@ (( ("@A- "E@A#Aj@  6#"Aj  AjA A%j #Aj A!@ (" -j"(lAG @ (l"AL@A!@ Ak# AF  AF   A'kAI @@ Ak A  A#kAO  A !A!  Aj Aj Aj"AJ@@@ At" (j(AG @ ( j("AL@ AL@ Ak AF  AG   A'kAI  A#kAI  AF   AG  Aj" G @#-AG "AG@A#Aj@  6@#"A"j A@k AjA A%j #Aj B7 B7 B7x A6 B7p B7  6t #(6  Aj6@  @ B7h B7` B7X B7P B7H A6D Aj  E  A6P B7H A6D Aj 6 AjA"AF A#Aj@  60#"A"j A0j AjA A%j #Aj  Aj$A A#Aj@A  ( Atj(6 #"Aj A j AjA A%j #Aj A#Aj@A  (l6#"A j Aj AjA A%j #Aj  #Ak"$@@ Aj"Ak  Aj"A.F@ A8j"AF@ A j"A.F@ Aj"AF@ Aj! Aj! (h! (8! (! Aj! Aj!#Ak"$@#;(AF A    Aj" E (AG #Aj( (Atj(!  (LAF@  !  +6H  +"6D  6  (H6A Aj Aj,   !  +6@  +6<  +"68  6  (@6(  (<6$A A(j A$j A j. 6 A: A6  6A   +64  +60  +"6,  6  (46  (06 A Aj Aj A j.6A ! Aj$   #Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6 Aj Alj" )7  )7  )7 Aj Aj"6 AF@A#Aj@#"AjA AjA Aj #Aj Aj! Aj!#"Aj AtjA.6 Aj Alj" )07  )(7  ) 7 Aj Aj6 (h (8 Aj Aj ! ( ( (xkj6|AA !  #Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6 Aj Alj" )07  )(7  ) 7 Aj Aj6 (h (8 Aj Aj! (L (H (xkj6|AA !  #Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6 Aj Alj" )H7  A@k)7  )87 Aj Aj"6 AF@A#Aj@#"AjA AjA Aj #Aj #"Aj AtjA.6 Aj Alj" )`7  )X7  )P7 Aj Aj6A! (h Aj( (xjA Aj Aj A! -l  (h#Aj"AH  #"Aj At" Ajj/j6h Aj j/!  #Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6 Aj Alj" )`7  )X7  )P7A! Aj Aj6 Aj( (xj! (h!@@ Aj("AL@ A;F  AF   AF AF AG  A=F AF AF A! A!    Aj Aj A! -l (h#Aj"AH #"Aj At" Ajj/j6h Aj j/! #L" )h7#M (x6#"Aj (|6 Aj 6  )p7 Aj$  #Aj("AJ@#"Aj Ak"6 Aj Atj(! Aj Alj")7 )7 )7  Aj#"Aj(! Aj( (j"<6@@@ Ak A!@@@ ("-A#k -AG AA - AA# -  6A!  ~#Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6#L")! Aj(! )! Aj Alj"#M(6 6 7 7 Aj Aj6 /@ #Aj Atj/F"E@ Aj"AG    #Aj( j  k #A k"$ Aj!#Aj("AN@A#Aj@#"AjA AjA Aj #Aj #"Aj Atj 6 Aj Alj" )7  )7  )7 Aj Aj6 A j$  =#!@ AH Aj("E  Aj#Aj( #A k"$#Aj(#M(j"-E@A#Aj@A  6#"Aj @#M("AH Aj("E  Aj#Aj( #"AjA A&j #Aj #"Aj(jA:A Aj@A  6  6#"Aj Aj@#M("AH Aj("E  Aj#Aj( #"AjA A&j #Aj #!@ AH Aj("E @ j"#Aj(O@#"Aj(! Aj(!  A!#"AjA6 Aj 6 Aj A "6 E O @@ Aj! Aj"A "E I  #"Aj 6 Aj 6 Aj 6   #"Aj Aj Aj! Aj 6 Aj 6 AjA6 AjA6 AjA6 Aj 6 AjA6 Aj A 6 (#"Aj"( AjA6 A6  E@A!A  Aq! AF@A?!A  A~q!A!A!@ -A r" -A r" A?ljA?lj! Al jAl j! Aj! Aj" G A?l! Al ! @  -A r"j! j! Ap! Ap !#Aj" Atj.  Atj.j  E@A!A  Aq! AF@A?!A  A~q!A!A!@ -A r" -A r" A?ljA?lj! Al jAl j! Aj! Aj" G A?l! Al !   -A r"j! j  A1p! A1p #Aj"j,  j,j # during function entryduring statement block entryplpgsql_free_function_memoryfdw_out_of_memoryexec_stmt_return_queryfdw_unable_to_create_replyinvalid_foreign_keyFOREACH over array# 149:pg_unreachable():pl_gram.ystatement_too_complexfdw_invalid_option_indexquery returned more than one rowprocedure call returned more than one rowDO statement returned a rowcannot_connect_nowindicator_overflowinterval_field_overflowdatetime_field_overflownewtg_argvcache lookup failed for function %ucache lookup failed for type %upg_exception_contextpg_contextmaterialize mode required, but it is not allowed in this contextPL/pgSQL inline code contextinvalid_json_textmessage_textexec_stmt_return_next%s at end of inputtransaction_timeoutidle_in_transaction_session_timeoutidle_session_timeoutfirstconnection_does_not_existdependent_objects_still_existdependent_privilege_descriptors_still_existtrying to delete function that does not existcursor "%s" does not existcolumn "%s" of relation "%s" does not existvariable "%s" does not existread_into_scalar_listrecord variable cannot be part of multiple-item INTO listlastinvalid_character_value_for_castexec_stmt_assertplpgsql_HashTableInsertinvalid_sql_json_subscriptrow_countpg_exception_hintconstrainttg_eventinvalid_xml_contentinvalid_tablesample_argumentnot_an_xml_documentinvalid_xml_documenterror_in_assignmentstrict_multi_assignmentinvalid_xml_commentfunction_executed_no_return_statementduplicate_prepared_statementthere is no label "%s" attached to any block or loop enclosing this statementmissing SQL statementmissing "%s" at end of SQL statementFOR over EXECUTE statementmake_return_query_stmtmake_return_next_stmtdump_stmtmake_return_stmtfree_stmtquery for CALL statement is not a CallStmtduring function exitduring statement block exitrecord "%s" is not assigned yetinvalid_escape_octetRETURN cannot have a parameter in function returning setset-valued function called in context that cannot accept a settrigger procedure cannot return a setmake_callstmt_targetread_into_targetread_sql_constructescape_character_conflictplpgsql.variable_conflictexec_run_selectnon_unique_keys_in_a_json_objectduplicate_objectundefined_objectfdw_invalid_string_formatinvalid_datetime_formatbad_copy_file_formatinvalid_tablesample_repeatgenerated_alwaystoo_many_rowsquery returned no rowsFETCH statement cannot return multiple rowsFOR over SELECT rowscolumn reference "%s" is ambiguouslock_file_existstrying to insert a function that already existsplpgsql.check_assertstoo_many_argumentsarguments given for cursor without argumentscursor "%s" has argumentscursor "%s" has no argumentsevent trigger functions cannot have declared argumentstoo_many_json_array_elementsexec_stmtsfdw_invalid_data_type_descriptorsplpgsql.extra_errorscheck_raise_parametersRETURN NEXT cannot have a parameter in function with OUT parametersRETURN cannot have a parameter in function with OUT parametersotherstrigger functions can only be called as triggerstoo_many_json_object_membersbuild_row_from_varstoo_many_connectionsPLpgSQL cast expressionsPL/pgSQL DO block simple expressionsPL/pgSQL simple expressionstoo_many_columnsquery returned %d columnscopy_plpgsql_datumsplpgsql.print_strict_paramsexec_dynquery_with_paramscheck_labelstg_nargsread_cursor_argsplpgsql.extra_warningsmismatched parenthesesplpgsql_resolve_polymorphic_argtypesunexpected number of namesfdw_too_many_handlesshadowed_variablesloop variable of loop over rows must be a record variable or list of scalar variableswhile storing call arguments into local variablesloop variable of FOREACH must be a known variable or list of variablesinsufficient_resourcesPL/pgSQL procedure resourcesexec_move_row_from_fieldsROW %-16s fieldsfdw_no_schemasambiguous_aliasduplicate_aliasPL/pgSQL function %s line %d at %sPL/pgSQL function %s %sunrecognized print_strict_params option %sPL/pgSQL function %svariable "%s" has pseudo-type %scollations are not supported by type %sPL/pgSQL functions cannot accept type %sFOREACH expression must yield an array, not type %sPL/pgSQL functions cannot return type %scould not find array type for data type %sPL/pgSQL function %s line %d %s AS %s{var %d} = %squery: %sparameters: %scould not open cursor: %sSPI_connect failed: %sSPI_finish failed: %sRAISE option already specified: %scould not open implicit cursor for query "%s": %sSPI_execute_plan_with_paramlist failed executing query "%s": %sSPI_execute_plan_extended failed executing query "%s": %sSPI_execute_extended failed executing query "%s": %sSPI_prepare_extended failed for "%s": %sexec_eval_exprexec_save_simple_exprinvalid_grantorplpgsql_validatorvariable "%s" must be of type cursor or refcursorduplicate_cursorarguments required for cursorFOR over cursorplpgsql_yyerrorsyntax_errorfdw_errorarray_subscript_errorio_errortrim_errorsystem_errorplpgsql_errorinternal_errorwindowing_errorsubstring_errorgrouping_errorconfig_file_errorfdw_function_sequence_errorsyntax errorpriorfdw_invalid_use_of_null_pointerblock label must be placed before DECLARE, not afterambiguous_parameternull_value_no_indicator_parameterundefined_parameterRETURN NEXT must have a parameternonstandard_use_of_escape_characterinvalid_use_of_escape_characterinvalid_escape_characteruntranslatable_characterplpgsql_call_handlerstacked_diagnostics_accessed_without_active_handlerplpgsql_inline_handlerRAISE without parameters cannot be used outside an exception handlerGET STACKED DIAGNOSTICS cannot be used outside an exception handlerfdw_invalid_descriptor_field_identifierplpgsql_exec_event_triggerplpgsql_exec_triggerfdw_invalid_column_numberduring exception cleanupCONTINUE cannot be used outside a loopcannot specify REVERSE in query FOR looptg_opdivision_by_zeroBY value of FOR loop must be greater than zeroplpgsql_param_eval_generic_ronoplpgsql_exec_get_datum_type_infotransaction_resolution_unknownstatement_completion_unknownadmin_shutdowncrash_shutdownexec_stmt_returnfdw_unable_to_create_executionunrecognized RAISE statement optionsavepoint_exceptionfloating_point_exceptiondiagnostics_exceptionlocator_exceptionconnection_exceptiontriggered_action_exceptionexternal_routine_invocation_exceptionraise_exceptionsql_routine_exceptionexternal_routine_exceptiondata_exceptionoperator_interventioninvalid_prepared_statement_definitioninvalid_object_definitioninvalid_cursor_definitioninvalid_function_definitioninvalid_column_definitioninvalid_database_definitioninvalid_table_definitioninvalid_schema_definitionunexpected end of function definitionplpgsql_recognize_err_conditionplpgsql_parse_err_conditioninvalid_xml_processing_instructioninvalid_argument_for_width_bucket_functionambiguous_functioninvalid_argument_for_power_functioninvalid_argument_for_nth_value_functionduplicate_functioninvalid_argument_for_sql_json_datetime_functioninvalid_argument_for_ntile_functionundefined_functionplpgsql_exec_functionevent trigger promise is not in an event trigger functiontrigger promise is not in a trigger functionPL/pgSQL functioncannot use RETURN QUERY in a non-SETOF functioncannot use RETURN NEXT in a non-SETOF functionsqlclient_unable_to_establish_sqlconnectionsqlserver_rejected_establishment_of_sqlconnectionfdw_unable_to_establish_connectionread_only_sql_transactionno_active_sql_transactionin_failed_sql_transactionno_active_sql_transaction_for_branch_transactioninappropriate_isolation_level_for_branch_transactioninappropriate_access_mode_for_branch_transactionduring statement block local variable initializationinvalid_binary_representationinvalid_text_representationinvalid_grant_operationduplicate declarationmissing data type declarationincomplete data type declarationinvalid_transaction_terminationfdw_inconsistent_descriptor_informationcardinality_violationforeign_key_violationtransaction_integrity_constraint_violationrestrict_violationwith_check_option_violationexclusion_violationprotocol_violationnot_null_violationcheck_violationunique_violationsyntax_error_or_access_rule_violationtriggered_data_change_violationindeterminate_collationinvalid_transaction_initiationstring_data_right_truncationinvalid_savepoint_specificationinvalid_locator_specificationinvalid_authorization_specificationinvalid_role_specificationinvalid_regular_expressionmissing expressionmissing "%s" at end of SQL expressioninvalid_recursionambiguous_columnduplicate_columnuse_columnundefined_columnquery returned %d columnPLpgSQL_pluginexec_stmt_openpush_back_tokentg_whenexec_prepare_planexec_eval_datumsqlerrminvalid_argument_for_logarithmno_sql_json_itemmore_than_one_sql_json_itemnon_numeric_sql_json_itemunrecognized GET DIAGNOSTICS itemcant_change_runtime_paramplpgsqlexec_stmt_execsqlrelative or absolute cursor position is nullquery string argument of EXECUTE is nullcursor variable "%s" is nullBY value of FOR loop cannot be nulllower bound of FOR loop cannot be nullupper bound of FOR loop cannot be nullRAISE statement option cannot be nullFOREACH expression must not be nulldisk_fullscrolltype "%s" is only a shellexec_stmt_callpg_exception_detailheld_cursor_requires_same_isolation_leveltg_levelEXIT cannot be used outside a loop, unless it has a labelexec_stmt_blockinline_code_blockstatement blockend label "%s" specified for unlabeled blocktransaction_rollbacktoo many tokens pushed backexec_stmt_forifdw_invalid_string_length_or_buffer_lengthunexpected RAISE parameter list lengthPLpgSQL function hashexec_stmt_fetchcollation_mismatchstring_data_length_mismatchdatatype_mismatchmost_specific_type_mismatchnumber of source and target fields in assignment does not matchdebuglogname_too_longzero_length_character_stringunterminated_c_stringwarningtg_tagexec_stmt_getdiagplpgsql_build_datatype_arrayofoffplpgsql_post_column_refresolve_column_refinvalid_preceding_or_following_sizebranch_transaction_already_activerelativeduplicate_json_object_key_valueinvalid_time_zone_displacement_valueinvalid_indicator_parameter_valueinvalid_parameter_valueexec_assign_valuefdw_invalid_attribute_valueabsoluteexec_stmt_dynexecutetype %s is not compositesql_statement_not_yet_completeplpgsql_HashTableDeletereturned_sqlstateinvalid_cursor_stateinvalid_transaction_stateobject_not_in_prerequisite_stateduring initialization of execution statecreateinvalid_row_count_in_limit_clauseinvalid_row_count_in_result_offset_clauseobject_in_usecursor "%s" already in usereverseplpgsql_yyparseexec_stmt_closeplpgsql_fulfill_promiseexec_stmt_raiseexec_stmt_caseduplicate_databaseassert_failureconnection_failureserialization_failureRETURN cannot have a parameter in a procedureexec_init_tuple_storecharacter_not_in_repertoireplpgsql_parse_cwordrowtypeplpgsql_parse_wordrowtypeplpgsql_parse_cwordtypeplpgsql_parse_wordtypeindeterminate_datatypeplpgsql_build_datatypesql_json_item_cannot_be_cast_to_target_typewrong_object_typeplpgsql_exec_get_datum_typefdw_invalid_data_typeFOREACH ... SLICE loop variable must be of an array typeFOREACH loop variable must not be of an array typereturn type must be a row typestructure of query does not match function result typewhile casting return value to function's return typecannot return non-composite value from function returning composite typerelation "%s" does not have a composite typereturned record type does not match expected record typenoneplpgsql_compile_inlinetg_relnameconstraint_nameinvalid_sql_statement_nameinvalid_cursor_nameadd_parameter_namefdw_invalid_option_namefdw_invalid_column_nametg_nameinvalid_catalog_namepg_datatype_nametg_table_nameinvalid_namereserved_nameinvalid_schema_namedo_compileplpgsql_compileduplicate_fileundefined_filefdw_reply_handlefdw_invalid_handleprocedure parameter %d is an output parameter but corresponding argument is not writableprocedure parameter "%s" is an output parameter but corresponding argument is not writableduplicate_tableundefined_tablereturned row structure does not match the structure of the triggering tableexec_check_assignablelock_not_availablecword_is_not_variableuse_variableinstantiate_empty_record_variableplpgsql_build_variablecannot assign non-composite value to a row variablecursor FOR loop must have only one target variableinteger FOR loop must have only one target variablecursor FOR loop must use a bound cursor variable"%s" is not a scalar variableFOR with integer loop variable"%s" is not a known variablecursor variable must be a simple variablecannot assign non-composite value to a record variablevariable "%s" shadows a previously defined variablePLpgSQL private cast cachePLpgSQL cast cachenumeric_value_out_of_rangeinsufficient_privilegeunsafe_new_enum_value_usagemessageerrcodeinvalid SQLSTATE codecannot_coerceparameter name "%s" used more than onceINTO specified more than oncevalue for parameter "%s" of cursor "%s" specified more than onceinvalid_escape_sequenceinvalid_column_referencenoticereplaceinvalid_passwordplpgsql_parse_wordforwardbackwardsql_json_array_not_foundsql_json_object_not_foundsql_json_number_not_foundsql_json_member_not_foundcase_not_foundfdw_option_name_not_foundfdw_column_name_not_foundfdw_table_not_foundfdw_schema_not_foundno_data_foundcase not foundoldplpgsql_param_eval_recfieldRETURN cannot have a parameter in function returning voidpg_routine_oidtg_relidrevalidate_rectypeidnull_value_not_allowedcontaining_sql_not_permittedmodifying_sql_data_not_permittedreading_sql_data_not_permittedmemory exhaustedschema_and_data_statement_mixing_not_supportedfeature_not_supportedindex_corrupteddata_corruptedprohibited_sql_statement_attemptedEXECUTE of transaction commands is not implementedEXECUTE of SELECT ... INTO is not implementeddeadlock_detectedevent_trigger_protocol_violatedsrf_protocol_violatedsql_json_scalar_requiredsingleton_sql_json_item_requireddatabase_droppedinvalid_sqlstate_returnedassertion failedquery_canceledtoo many INTO variables specifiedfdw_dynamic_parameter_value_neededsequence_generator_limit_exceededconfiguration_limit_exceededprogram_limit_exceededRAISE level=%dslice dimension (%d) is out of the valid range 0..%d$%d %s=var %d??? unknown cursor direction %dcompilation of PL/pgSQL function "%s" near line %dvariable %dplpgsql parser returned %dunrecognized raise option: %dunrecognized ttype: %dunrecognized typtype: %dunrecognized plpgsql itemtype: %dunrecognized dtype: %dunrecognized cmd_type: %dunsupported target type: %dunrecognized promise type: %dunexpected plan node type: %dunrecognized data type: %dunrecognized function typecode: %dunrecognized diagnostic item kind: %dunrecognized rc: %drow variable has no tupdescrow not compatible with its own tupdescexec_stmt_forcplpgsql_param_eval_generic# 149:pg_unreachable():pl_funcs.c# 149:pg_unreachable():pl_scanner.c# 149:pg_unreachable():pl_handler.c# 149:pg_unreachable():pl_comp.c# 149:pg_unreachable():pl_exec.cPLpgSQL per-statement dataquery has no destination for result dataINTO used with a command that cannot return dataquery did not return dataduplicate_schematg_table_schemaexec_stmt_foreach_a__Case__Variable_%d__0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZRETURN QUERYROWMESSAGE_TEXTPG_EXCEPTION_CONTEXTPG_CONTEXTwrong result type supplied in RETURN NEXTwrong record type supplied in RETURN NEXTASSERTINSERTROW_COUNTPG_EXCEPTION_HINTCONSTRAINTCURRENTSTATEMENTvariable "%s" is declared CONSTANTEXITCOMMIT STRICTquery is SELECT INTO, but it should be plain SELECTquery is not a SELECTdiagnostics item %s is not allowed in GET CURRENT DIAGNOSTICSGET DIAGNOSTICSdiagnostics item %s is not allowed in GET STACKED DIAGNOSTICSAFTER, or LOOP, or ; or INTODOcontrol reached end of function without RETURNcontrol reached end of trigger procedure without RETURNCOLUMNexpected FROM or INOPENWHENTHENPERFORMcannot COPY to/from client in PL/pgSQLunsupported transaction command in PL/pgSQLvariable "%s" must have a default value, since it's declared NOT NULLnull value cannot be assigned to variable "%s" declared NOT NULLCALLPG_EXCEPTION_DETAILNORMALROLLBACKFETCHLOOP or USING, or ; or USINGunrecognized trigger execution time: not BEFORE, AFTER, or INSTEAD OFIFMOVEblock label "%s" cannot be used in CONTINUEEXECUTEDELETERETURNED_SQLSTATEunrecognized trigger action: not INSERT, DELETE, or UPDATETRUNCATEREVERSECLOSEtoo many parameters specified for RAISEtoo few parameters specified for RAISECASEBEFOREDATATYPECONSTRAINT_NAMECOLUMN_NAMEPG_DATATYPE_NAMETABLE_NAMESCHEMA_NAMEWHILETABLEMESSAGEERRCODEPG_ROUTINE_OIDSTACKEDSCHEMA ENDFOREACHAINTO or USING or ;, or ;%3d:plpgsql-17$0CASE statement is missing ELSE part.Perform checks given in ASSERT statements.Make sure the query returns the exact list of columns.Print information about parameters in the DETAIL part of the error messages generated on INTO ... STRICT failures.Sets handling of conflicts between PL/pgSQL variable names and table column names.Key word "%s" cannot be combined with other key words.List of programming constructs that should produce an error.It could refer to either a PL/pgSQL variable or a table column.List of programming constructs that should produce a warning.%s check of %s is active.The tuple structure of a not-yet-assigned record is indeterminate.List syntax is invalid.The arguments of the trigger can be accessed through TG_NARGS and TG_ARGV instead.You might want to use EXECUTE ... INTO or EXECUTE CREATE TABLE ... AS instead.If you want to discard the results of a SELECT, use PERFORM instead.Use RETURN NEXT or RETURN QUERY.Make sure the query returns a single row, or use LIMIT 1.Unrecognized key word: "%s".*unnamed*(unnamed row)type of parameter %d (%s) does not match that when preparing the plan (%s)"%s" IN (%s)," or ") label='%s' condname='%s' message='%s' query = ' arguments = ' execute = 'too many arguments for cursor "%s"not enough arguments for cursor "%s"%s at or near "%s"unrecognized exception condition "%s"could not determine actual argument type for polymorphic function "%s"could not determine actual return type for polymorphic function "%s"cannot assign to system column "%s"end label "%s" differs from block's label "%s"record "%s" has no field "%s"cursor "%s" has no argument named "%s"syntax error, expected "]"syntax error, expected "FOR"syntax error, expected "="FORS %s FORC %s FOREACHA var %d CASE %d SLICE %d RETURN QUERY RETURN NEXT ASSERT DEFAULT CURSOR IS GET %s DIAGNOSTICS OR RETURN IN EXCEPTION WHEN EXECSQL ELSIF RELATIVE ABSOLUTE FORS %s EXECUTE RETURN QUERY EXECUTE WHILE FORWARD BACKWARD ASSIGN var %d := arguments = %s%s = %s expr = PERFORM expr = lower = upper = step = %s$%d = HINT = CONSTRAINT = COLUMN = DETAIL = DATATYPE = TABLE = MESSAGE = ERRCODE = SCHEMA = parameter $%d: entry %d: parameter %d: , REC %-16s typoid %u FORI %s %s INTO%s target = %d %s target = %d %s END -- %s %ld OPEN curvar=%d FETCH curvar=%d MOVE curvar=%d CLOSE curvar=%d CURSOR argument row %d ??? unknown data type %d VAR %-16s type %s (typoid %u) atttypmod %d PROMISE %d RECFIELD %-16s of REC %d CONSTANT COMMIT ENDFORS ENDLOOP COMMIT AND CHAIN ROLLBACK AND CHAIN THEN NOT NULL ROLLBACK ENDFORI USING ENDIF ELSE ENDCASE ENDWHILE ENDFORC BLOCK <<%s>> Function's statements: Execution tree of successfully compiled PL/pgSQL function %s: Function's data area: ' End of execution tree of function %s ;;;pp;:8UpRp;||If;@V J De[VL^;o;(Cg*-  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~aeg8.$t *"#B%/]) -\N32 <26e8:2>?@y7FHIBCLWWR:UC89QZ[^Burhrj'm "#/%|}+)r&-2|6I:>?@5F$HIMLsJRUXZ[: ^JZQ#:hjHmtC."@ &>C"$%&'()*+,-./012345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|}"$%&'()*+,-./01345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|}"$%&'()*+,-./01345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|}"$%&'()*+,-./01345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|}"$%&'()*+,-./01345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|}"$%&'()*+,-./01345679;<=?@ADFGIKLNOPRSTUVWY[\^_`abcdefghijklmnopqrstuwx{|} "#%)-2689:>?@FHILRUZ[^ "#%hj)m-2689:>?@FHILRUZ[^ "#%hj)m-26:=>?@FHILRUZ[^ "#%hj)m-26:>?@FHILRUZ[^ "#%hj)m-26:>?@FHILRUZ[^ "#%hj)m-26:>?@FHILRUZ[^hjm^l##pxyz{|}x_~/.^c`03_emfah^! "ib.&'yz{|BC>}_~noA_4M$$f )*2+8?@FJHLKxD7;I:9f=Gqxr  s!"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[j\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[q\]  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]yz{|}_~_yz{|}_~_yz{|}_~_kyz{|}_~_yz{|}_~_yz{|}_~_  ;   *,+XVj|W{ZU~}M?@ABCDEFGHIJNOPQRST-.[\;=;/nlzuvt;xp;')( 3;;kbca^grsq021;Y:9`;y".&%48567]_;!$i;#dw?q1.)9~@kdgtuvE,-1w56% <  (  _8d @PostgreSQL!#$%&'()*+,-./02345688:;<>?@CEFHJKMNOQRSTUVXZ[]^_`abcdefghijklmnopqrstvwz{|~ "179=ABDGILPWY\uxy}absolutealiasandarrayassertbackwardcallchainclosecollatecolumncolumn_namecommitconstantconstraintconstraint_namecontinuecurrentcursordatatypedebugdefaultdetaildiagnosticsdodumpelseifelsiferrcodeerrorexceptionexitfetchfirstforwardgethintimportinfoinsertislastlogmergemessagemessage_textmovenextnonoticeopenoptionperformpg_contextpg_datatype_namepg_exception_contextpg_exception_detailpg_exception_hintpg_routine_oidprint_strict_paramspriorqueryraiserelativereturnreturned_sqlstatereverserollbackrow_countrowtypeschemaschema_namescrollslicesqlstatestackedtabletable_nametypeuse_columnuse_variablevariable_conflictwarning  ).4:BIU\ep $',06>KPUX_dks~!)2<DKW^dmu{J]#"N   -  @2P6RE<+_x7F9bD #%1A*HY$0 &13IO2allbeginbycasedeclareelseendexecuteforforeachfromifinintoloopnotnullorstrictthentousingwhenwhile #+/7<?BGLPUX_dgmr   (1K*@$6@o  { !l Z `40B+J*kLE"| `3'(Y'(!U)'w)(% ' C&p5w{27& i&&S_A ,BV#$' Q   u" d" "  >7 3 F4 ,4 4   %7 f+ hPFP PP((BDB}'B~$BBBuB'B5BAB[BBB-7  3iK5Y65-55Y65Cp7Cp5C6C7C6C? -.|.J%\^*6 3`2P2 |! a.`&`n. 1&8+& W + 5 L !p /p!p)*>p,</$pp!ppc 3`Pv0$T 6 08@.8 & )E)E"E#0E2E:7r_7t` .. @ 4 7   9(  .  +  . $.  - % $  P  o4 . 4 !4 " y    4 F <* ( J6( :6( K{KPK$KBK0K^KnKK<=B<<@F=@AAA<AAL0!PmpSrr asmdylink.0"`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_big5_to_utf8pg_finfo_utf8_to_big5 big5_to_utf8 utf8_to_big5 __wasm_apply_data_relocs  "#Aj#A@k6#Aj#Aj6 # #A8j #A??@BABP0oFGDXӡPѡҡDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsDzǴǵǶǷǸǹǺǼǽǾǿ=M M Kk&f"`ZCu/ o / o / o / o - m -m)i)i)i)i)i)i)i)i(g!a!a ` ` ` ` `Z Z !Y!!!"Y"""#Y###$Q$$$%Q%%%&O&&&'O'''(O((()I))) *I*** +G+++,E,,,-E---.E.../E///0E0001C1112A2222<3{333;4{444;5{55596y66697y77798y88869S999:S:::;Q;;;P>>>?O???@O@@@ ALAAA BKBBB CJCCC DIDDD EIEEEE)FiFFFGEGGGHDHHHI)IiIII)JiJJJ)KiKKK)LiLLL&MfMMM&N/NoNNNOUOOOPUPPPQIQQQ R3RrRRRS^SSST]TTTUVUUUVVVuVVV5WuWWWW8XwXXXVXELK¡JK¢ԡۡܡڡݡء١wxz{|}utsrq~bcdefghiponmlkjvy@BCqrmnuvyzijEefâĢŢƢǢȢɢʢˢƦƧƨƩƪƫƬƭƮƯưƱƲƳƴƵƶƷƸƹƺƻƼƽƾƿƣ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ǡǢǣǤǥǦǧǨǩǪǫǬǭǮǯǰtuvwxyz{|}~UVPQRTWSO@BCEVTWUFɣOMɢBA@CèXPcꦱYDd@D[G\EGFĨAAE^]ŨKöܲFƨGH_QɭǨȨE`ɨʨFGHRɱTSɵJKLMIPjfiQahNOHegɮ饱ɶɸɯfBgD[`hdG]Cb^ZeEH@FcAi\_aبШ˨ըΨ֨˼ި٨˵ۨϨԨ˴ӨרҨͨܨݨڨ˲Ѩ̨VJIQ]KYPXT[NWMURZO\SLH׭ѭ֭ĭͭڭέǭܭӭп̭˭ϭ[ƭխԭʭɭҭí­Эŭ٭ۭحȭcW\bԲUԶYRԴVԹgQfXԱSO]PNZ`aԷ[^M_dLTeԼȳ^Wų_UXijYdz]SRɳʳƳ˳Q\ZTóVʶĶͶƶǶŶ˶̶ɶܼȶζܹಹஹହ෹హ൹觾詾訾vwux_lkIaSRJIKߨ^YZ°\[`]^JK@LݭNTUAj`_ðUaޭ߭VBMNkha@LZİͳBɿYWXMNb¤ZkFDEGClmnPOSQRchdgfebѳŰikjlưγϳгжѶ϶ABỹZ@ABDCO\[HUVTWoplkijǰnʰmɰȰԳӳҳҶնֶԶӶCDEyUcäVĤŤ]^Iqm̰˰cbPƤ_ͰCl`KJXo׶EἹǤаΰϰQd͢ʤɤȤcbmnճRˤedrWgfLMsYZoD̤tuppdֳeFόFXhѰSeΤͤϤqOfjytonuslzmixwvkrq{pSYU[XNQTPWZORV\~{g|[]up}_ahxtv\mvsdnowljkq^rfczbei`yOPIKMLEADIRCFHQMSJGB@NHKxt}rCΣOΥyEBwͦJ|LΩs~{@ΡFGzvuDND@BCACFB@GѡEDAw䰧߰|۰v{zᰥsְٰ~ӰڰtԤݰux}ްܰװұذyణհ԰qrj׳ڳuxسq޳䳽n۳v{ofsmyݳ߳ܳzlrthwٳgip޶ܶ߶ڶݶض۶_ٶ͹ȹUQK¹TΌNPSĹ˹ŹIƹǹL̹JOùHɹMRʹGMGDGSTJBLRFIHHCEKAkONP䲾@EB鶾AC輾軾D@QF鷾{}~z|P`VQAY@XWZmonŦI}|_^]ywzxTHIEF밫|ϹιIHGkgYnobfdcea`}{ʬ~|Y[Z@XWV\AUTZX^UY[]WVQRέS\PSRWNQPTXGJOUIJVMHLԯԽԴԼԾԹԲԦذԵﰻԶKةإ}رخKѫ~ذد]йcչ_fW׹ѹ\U[dҹֹZ`eVԹ^bhXaӹgYYKWVMRNQ\[JPZOLXMOJLNþP¾IKSRabcB[hФ_عiSZB`YLi~pgh]ڹ۹ٹjѤӤҤ[ԤqijaC_`^ZabMNOݹܹj]ľklonqpmkʹʸʳʮʻʷʭʺʫgoOHpSDKfEdLPcQJMriTRnlIkGFjhqmeNoθgcsblξpοVvdfmqurknhëjitκe«\b[`PU_\aQ[TRcSWXZY]^d@CDBA@ؽBGCضADغطؼEصB@CD@FAABEnzpvkyx|u޹tm߹{orwqlsUaXWZ\_VT][Y_^c^`b`WVUXQRZSž\[TYƾT\]ClmnդrssUutVī]eEGF}Ǿ^prsvtuwʻWXvxzw{yȫūǫɫƫfwhgc_`bdafeJIHGKFIKHJHIJ~칡fged]Ⱦd_oxʫigNMLLMɾp\֤ty|KqפNLrؤuɧY~Z}Ϋxͫ˫̫jhkij^PQOhiaĨK٤swvzħ§çhb]̣ec\ilg`̥f̦ad[_ķ^j̢ΤΪΣΥ}{ΩyЫΨ|zϫ~έonlknposqpѮrmlmqrSRTXAZV^[UCWB\]YD@QROOPSVNPUTCRDMQegkhcbljjmdikfaf`e^hdic_gjbrDE`rqt{ʵ_uŧtWvwxڤѫSy]x|Ƨn̬m̩o̪ҫԫΰαβδӫtsvubFac`UEVWTZ\E[YXqompnlmklnnz~}FۤիXyzȧɧǧβ֫ιζκ׫yuwwxxvGJKHgfdeIhZ[\]_aHGY`^psrtqtuossqprofFGUʧث{ܤ˧٫|I}ݤޤɢ̧qrsp̸ګzzyiLjM]buvʾtstkJUΧͧ۫{mCnl^vLϧЧwv̻uݫܫޫ߫}|{OorpNuqPtsa_`KdLcwxwu@HIߤ{ҧԧɤӧѧxyا֧էק̢~̮̩©̭㫬éȩƩ|̥ͩ䫦ɩ{ʩ˩ǩ̩z̫ĩ}̡̤ũΡΤ~}|쫡򫢮~뫦﫥ΧvѦѨSլѣxQRѯѭѧywzU^d|e`ժVբ~TbeIcء]a{dYbWXէ[ի_դ\fcZ}ko@QmDqeFSilGHNsTJOC^UrAP]pNMtEjBKMRgLPh\phlnk[j_Z@qXimOfgAWYVo}GF|ECDzn᣼{HyBz~y~ξx娼̾嬼xv}w;姼孼|{˾zо~Ѿ|y{ӾҾ}ϾVgjihaJbAt|ɳڧ٧ϩΩѭur`atvuI宼ԾW¹ѩЩҩѰvQ~}ɷɪɩߧөާۧݧܧ᩾̷ܩ侀̴̺̼̿詸٩⩶שة֩ԩߩթ䩵کݩީ۩A@ѱCBEβDѿfѺѼ}սѾѿѸѵѶѹѻѻî®ѷg˱ʱyurզպwը̱ɱ{jȱiսs±hxqDZtդƱRoոñxnl~հıw|յpűmzvTSkdzjYgw}kn|\ml~Uyi_٥phq٭fec]٤VW{yXox`[٩a^p|ݱݶݪliz{bknoݸjd}ݺݨݩ~ݴݫݵݭehfݰݬSmgcݮQLKObR导T尼NPUJ嵼Zٲ¼M峼üؾپ߾־ݾ۾վܾ׾޾ھY­X^\]Zk[BEFDGlCNdMLKceuũrٯFGĮŮӱϱֱձαѱԱбvͱuxٰswtqVļżƼHyƮرױz{rW礸Hٱ|ٵs_IǮȮ۱ܱݱڱ}~پYXJIO^J餹@PMSKNQLORЮɮ̮Ϯʮήˮͮ߱խޱծ౩٨ݦټ١yvwu{ݻxtz\Z[ȼǼʼɼ澻辳徶`nKmQRfPŪTѮҰ̳|뤳BAҮӮԮ´zagɵɴCGBE@AA@FDWCMNFXHSIVQOJPDRUELTGK[\iVLbJ[EeRADQa`FX_`cZKSfYamVXCjc]@lgIkPHd\T^bGZYO_UWh]NMB^WU߮ծݮ֮ڮۮخ׮ٮܮյչսհղճ鱺շջޮִѴҴδĴǴƴ״ɴŴд̴ٰٵٯ˴ݱϴʴٴʹôٴȴټپ٪ӴմٹԴݦݨݬݡݯݣݰݪ~شݿݥݢݭJH^FX}_B]GUd][@ZoQamI^KYgDkaMCWh`eSfEPLN`_nObTcljAVibR\ͼؼռѼμּ׼ԼټӼмϼ̼Ҽ˼EAHIDJ@GCFBchibfegdQNWVTOrPqSpXRMoLVUUhYZTXSWvVYd۴ܴڴݲpceqdۼڼKjYwBZ[nk\eofp޴ݴfghܼLlZ_qgߴijݼ޼`CHrhsijBAC@@AAB@ݷkM[¥]a~ɻIJ^tklDBråƥťĥD@ŦƦ¦ĦɼEæ[YLQSLMUROQVZXZKM\TWEG^UNJYVHICOP[]PNS\WR]FTKXDjzqKbeBmovhfguGpnsJuycIMO@lk}rux|AF~wi_d`N{taL|ϡwϪϬtv{Iҭϭ{sd~xzϥ}}pϨzmϪxoϫ^H|wvnϬϩyϡqϢrϦy~LCU[WJMFGJV_E@NBOYDhHHEfZgaSb\ecITAG`FQCiPKKX]eRPG[UGDgdXcNOIE@QYBD^F\SHFJhb_]faR`AEWVTLKCMAZIMDJCUVHDBSKQWAGEBCOLT@FGFEPNR@a`F޽_IJǷh·^CȷRHKc޸jbW̷˷ŷi޹ULYeͷTMķ÷PZdGQ޼[ɷN޿ESgVlXfƷO޺ʷD]\⭺}⢺n⯺wmⱺqsuS殺}o⣺u~||vtzwxz~pyx{t⪺⤺sr⥺{y߼vDNMYKOFRTC^W[`UILH_aV\JE嫺AZB@XQP]GI@AHCOBDFEDJGFEB@ANCQSYWZRVU[TXPqopmnsrx_ey\vsgwt^abcf]udh`]j`kh_\^bedg[icfiaxyŭWeƣlǦA^_b_`aXZURTVͣSP͡WQͥYϱϵϵwxyPLnv{QlrkuqMOzjmst|pNmNPLXJWiH[RlSVZOTjkYMI[QUKHIeOYbXL`^_Jc\ZK]aMdpwyޡڷkҷz׷η}m~lܷxϷԷqٷ|ovrnѷطַӷ۷зuշN{st⵺gdpjlfnmkqhocebriJQUSKILMHUVGVQOLPNRRMNOPKTSWXT\b`^a]_wtuvlmzkji{ljkyRݷnb}ϹfP޷|gɦBȦedc`[Ϻϻҡ~S]^o\_RpQkjhilڦޥީާ޹⺺stYZr}qpnolǥCDfbaˬegcfgd_;]deab\ͯ^ͮc`ϽϿϼҥXWUҩTVg֣Ҫbfenyhcmtsadurq`ipwTvsVuoqtrUxS߷ެުᷮ⻺ޯvu~}{zwxy|_\]W[a`^decyx~mnmzȥYvjɥEljkhhimkgjf͵ilh¬ŬϿĬìҫҶҹҺҬҸҵҳҷ_]һҲ^Z\xmklstp{uroynwzqy[xwv|~`ڢZڥ[abX}{ڣz_|ڤڪY^\]W鷷跻޳޺޸޹޵޴⾺@bAifegfZcX\[dhYmzjhknlgBEu@oFD{ACGvtsnŲʥnͼҽ}]{ų˥o`ҿ~ºi^_ropqIH|w̥ƬͥңcdΥϥFjiǬϬХѥҥӥklnmrpqˬɬʬȬ`dcba{z֤feڧBjså|ԥsúopt͸ϬЬͬά̬hinlkjemfg֢֭|~֤֣}kjhlmgiگǺƺźȺECHIFGĺDlksmro`qabpntwuvMN}O~LPJxoKp~}ѬnoեʦGqmҬӬԬoqpJxQqp֥uprKtRrץ׬ج֬լqrs֯ڱsɺʺLducySsإnxwͼvͽy۬ڬ߬ެ٬ܬݬuvwtֲֳִֵַ֭֮֬ھںڻڽtCκFDEAB@̺ͺ˺NQOMP}~vzywfgex{|h@{A|z~}U¥¢T{yztwuvf٥ڥoxuGB|xۥz|~}{Ϳ|zҢyҥ}~{ֵֶַֺvڸwxNQMLHOPJKкԺѺӺIҺTXVϺSURYWjlikFECDVGZW[]\XY~}z}yq{|~rtsܥrªҧҦҬֻּּֿRSTA׺պֺCB@mHI_^áVݥrqpĪêҲ־}|z{yAZX@W\[YIHDغGFٺ^_[]Z\pErqnoJ`¨©ãޥHsƪŪ@ҷ~D]^CBJۺںKLa`sK¬uߥAҸڣEܺMݺvĥ˦ǪBC@BӹDGEFCҺHAƲòDzŲ²IJȲڧڥڬګڭaPSGLFcJHbONKMIR_Q]XNPUTWRQߺSY[VOi޺\bce`hdfgvjtxQyw{zONLPMucagedjkhib­«flðêîïóxwyŢXYm~̦EFDGHIIOMӻKLNJɲ˲ʲگVdTeUfa^`_ka|}WSXTVRUz{A@ͦtȪLJKZǯSYïRXV¯įUӽTȯůɯƯQPWϲֲӲٲزԲвѲҲײͲղ̲ڲڴlڳڶڻβh]_ae[Yj`d\XWbZ^kifgcrjxtxeubwfvpcqshgdlimynokpyurvltswqnzrm{o~꨿ꣿꦿꤿ_Yia]dg\e`Zhc^b[fntwµovq·msurpøô÷õ~}ĭBŹ@BAlΦoʯڲjCIɪuM`[_]˯^\@ijnohkgm@pz|}üDźϦ˪ʪONb̯aܲ۲BCAsmlnrq~꪿yxýüðЦPeίdcͯݲ޲߲Dop~CAB{|}桽歿꫿kz{lѦҦ̪ϯQӦARS@BԦTѯfӯЯүA@qզs˪CUhԯgկCBDFGEtuEDpomnq|¾Ť֦wµvFצئ٦vwwtvyu{zxxѪϪΪӪժҪ֪ͬЪ|Ԫͪ[GH]WZcaIgLd\YIbDeV_FK`OMXJ^NEfگد֯jޯۯlݯkinHomׯٯܯ߯NEGHPLJMQFOKIȵQOʵJۡɵNKŵ˵PǵMGƵL̵ĵõwu{sߢxr{}v~|~yxy}͵|tzLHMJKIAD稽C秽@榽B걿꯿txzwvusry¡}~ôijECDڦתRN{ۦSܦPTUVOݦتhpWۤP|µަ٪RεQEߦϵR঱iQrqWTVSUXYZۦߨSJFIKHG괿F}}X[AJKMNLˣ{ˡ|zy}~~jܪͷ۪ߪͿݪڪ͸ઽ쯻ުb\daqt]kV`cewUYWRo~svХf}^xФuy|mУ{lp_ZSXTgnХ[zAv}~x|ӵӤtsr\ۦz{ӡuӯӶӰӧӢwy^`ey]houbi@wrnj\aYfcsdzlkZ_pvA[gmxqtl`׵}۪ۧյhۣiwsߵt]赡u۬pnzԵrۭkdocaеjۨصݵٵ~ڵvfҵ^ۢ۫e൰qmѵ|xֵܵ޵ӵyg{bۦ_Uߵߩ߱߿߲߰߶߶߱۵߸߯߾߲߫ߴߺߪߧ߭߮`X[YZ]aU^WVTc\b_stgfb紽vu_c]pawZXdni綽Om[RU{\SQNe篽`h穽x|竽WkoTy粽L絽rVjP^Y筽l}zqMI@CEAG븿LFUOF귿JT뿿QDHBVSP빿W뽿MKNS@ERDAMOQIPBRJGUHTKLVCN~³°ĩĦĬīļJKIGHLEFGOhӷ@B|{굸~XZYWЧikjӿAFӽCӻHӾӹGDӺEBLK׫HF~שקפ׬׭ׯװ}Eס׮GIDMJ߽۱쵶ﵺ۸۵ۼ۷۹ۻߺ¸øĸ㻸jeghmilfd߲½k翽绽缽羽繽纽罽da븽kge`oĿ\hi_^lb]cn[mj¿ÿfY]Zag\pj_kfm^`nXldch[bieo¥įBEACDQON@PFMžZn妪GlNŸýĽſЭmIJNMKLPUTRS׻׽׷׾O׵״Q͸ϸǸθʸȸɸ˸Ƹ̸tBAv@nprqsoƽʽŽǽȽɽup|ʿwyȿquxƿɿ{stzrvǿrqwstuxvIKHJRHIKJPnWVиCFED̿˿y{zTS[oCA@BѸDIGH}|}LULqrpTRQXPYVSWUO_Y^`Z[X]\DFEICB@GAH߸ڸոָҸ޸׸ܸӸԸPMEJQٸGOKNLݸFظLx{NM}ϽOK䦻y۸|z~wJֽҽٽڽ˽սԽνͽӽнؽ̽׽۽ҿ~ͿӿϿٿԿпڿۿؿѽοܿտѿֿ׿~AO@BCĴij@NMPQAV[XWZYCB@A@MNgmRPDDZaTSܽݽvƨbHVUWQR䨻ݿ޽޿FE\[IYZX߿Gst]^hfcgedJLQSRUOKMTPN[TSU߽併࿴HIJRBS\ŬEBji\]꽺vu_XWV_b`ae^fcd఻VLNKMTowlk`[^Yl]\_Zhonpmrikgjqs[aYbX]c`_^W\ZAC@EBFDEA@CBDROSQPTľCEVDUa`^]bcF_\QPOpnƭ`UyxcabmnCAEFLHJBIKDGb@acuwv{xtyz|gfde䳻MNIJKLH@GFGHIXYWVZXYWFdeHGd@|GŰdA[д|У~{}zjgnilhekmfpzv~w|roq}uxty{sMeOgiNfjhGO~PEJCBMLKIN}DFHRCASDBQPOEŶUoRSQT˧ˬ˨˷˹мйп׺qprע׷lVWTܣnSYXk\R[PZUmQRnqim»ljpkhoYHJVWUQGZTFIXKLM]\[\ZfŻut@Asפ_a]`o^psUTSsuƻûŻĻtra^_M`[\JK]LOPNR_Q^]HIC]qoƼVĽqBxvzDywCԨBث@תCצAmljbqeovnyuciwhxzkrswutfrvtsdgpaWYeZ\f[db^c`Xg]_xǻz̻лȻɻ~ѻͻ|˻ʻyλ{wvϻ}RZUgPOVeTqcdNXtysowuhb}W~xmkfn{jzSv|rlQpYiDACB@@CEEBAD`YTc[eU_aWX]bjgk^Zhj\dfiSVscqalhrbetmpid`okugnBf@DACafOhIdjNJK`gMeL_cb^implnoijgkhųKMLNJDSRT_U^VruthsrpqwDxܥv{EFج}zyܣ|{~{hһջ׻ֻӻԻ[\MKIJFFNHLGnlmwxEGFPmlkXVYW¨˿˭@ЮЭEԢF~|}IصHKرJثGا}ܬ|~ܡܤjkiػڻٻGHOIoAGLضܦܯnomۻlܻPJptqusyBܧܳsprqݻ]^_`QNKPSLROMwvx~}z{|HISnQRoŵqEGFWCtQRDañSŲMuv޻߻cbdVUTTA@}{~|y@zJKpOPHiCBäqrWDXAçLMTQNصܷz|wx{yge[fYZU[YXVZWEJFIHGDBECèF@ĨAħQNOPrVUtsI`X仾hGíBĬuRStsuHO~}i\kjla_^]`\K^]_NLMRKQTSPOJHICDXWUTYvwWvVwaYPUﻭ`WVLòहࣹnqsrtpmocfdcihgbbaedZ^[]\Y_b`a@XcMïEFĴ`^]ca\Z[_bx~y[šZ}|Y{Xz}~{x|yzRSJvjkƴzluejmfdkNfde\ŤżbIhvwnqpoghfegOüPGgihTUVKcƶxiJ{ƬrzyiSRQ^Ũ]ũL|{}xvwsytru|j{z~jmltosqpnkCBDAuXWUTJKIHloVmsqkvjrnut`_ŴűŬpZ\_[`YW]X^MZ\[yxwzst}~okplmnz{~|vy}EF¦wYZ[MxOPNL}{|x~zwyabŽdſcŻindgkreosjcmlqphbfNOa]^`_ba|{x|}PQGQSRecT³tdHu¶rqLJKI\fvwd}uܶxRe~쪹]gy^ĸ|{zM}fN~hŽĻijTSgjihseÿtJJWY[_`cdghklopstwx{|ơǡʡˡȡɡ\MOQRST}~̡͡ΡޡߡLMNICH]^ϡAСDAGFաס֡HIϢТѢҢӢԢբ֢עآ٢ڢۢܢݢޢߢBġ@ABCaUbNZ@@@ @рasmdylink.0("``` ``kenvcheck_encoding_conversion_argsenv UtfToLocalenv LocalToUtfenv __memory_baseenvmemory  __wasm_call_ctors Pg_magic_funcpg_finfo_utf8_to_koi8rpg_finfo_koi8r_to_utf8pg_finfo_utf8_to_koi8upg_finfo_koi8u_to_utf8 utf8_to_koi8r koi8r_to_utf8 utf8_to_koi8u koi8u_to_utf8 __wasm_apply_data_relocs   >#A&j#Aj6#A'j#A j6#A'j#Aj6#A'j#Aj6 # #A8j #AXr.Hb|8 R!!"l""(###C$$$]%%&w&&3'''M(( )g))#***=+++W,,-q-𨘠𝦠𭹠𗋡𢵡𜶡𳸡𐭢𦮢𶆣𒏣𤏣𕏣𑑣𚕣𺘣𧟣𹷣𓷣𴞥𣫥𤱥𖹥𥹥𔿥𻿥𶿦𷿦𚏧𔘧𻦨𩨨𝫨𯯨🸨𱊩𽸩PN B/n̢ޡ©éĩũƩǩȩɩʩ˩̩ͩߡΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩɪ˪٪ߪ̪ϪЪͪΪڪ۪ܪʪѪªҪêӪȪĪԪݪǪתުŪժƪ֪ūë«ӫԫի֫تܫګ߫۫׫٫ޫݫҫ¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦ٦ҦӦԦզ֦צئѧҧӧԧէ֧ا٧ڧۧܧݧާߧק=}=}<{/C.n* e ~ 3 s  S - c " b "\|5tK8s (^?z+N2a!a6N(LY HX">c"S4][ Z !Z!!!"Y"""#T###$S$$$%R%%%&R&&&'Q'''(Q((()Q))) *L*** +J+++ ,J,,, -J---.B....?////?0000<1|111;2z22293y33374w44415o555/6n666.7n777.8n888.9n999+:k:::+;k;;;'<g<<<'=f===&>f>>>"?b???"@b@@@!A`AAABWBBBCVCCCDSDDDEQEEEFQFFFGPGGGHOHHH ILIII JKJJJ KKKKK LJLLL MIMMM NINNNOGOdOOO"PbPPPQ]QQQR\RRRS\SSST[TTTUXUUUVWVVVWRWWWXQXXXYPYYYZPZZZ [M[[[[+\i\\\]C]]]^?^^^^$_d___#`b```a^aaab^bbbcXcccdd^dddeAeeef?f~fff1gqggghZhhhiFiiij@jjjj8kxkkk5lTlllmSmmmmnGnnnoAooƫǫЫѫ¡ơǡȡɡšġثݣߣܣ׭͢΢ϢߢТǢƢݡۣܢԢբʢˢ¢âĢŢѢҢӢݢȢɢޢ§çħŧƧǧȧɧʧ˧̧ͧΧϧЧ¬ìĬŬƬǬȬɬʬˬ̬ͬάϬЬѬҬӬԬլ֬׬ج٬ڬڦۦܦݦަߦҡӡԡա֡סء١ڡ̡ۡ͡ڢۢآ٢¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥ¨èĨŨƨǨȨɨʨ˨̨ͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨި۬ܬݬެ߬ƭʭĭ­̭˭ŭͭǭϭέíȭɭ߭ӭԭЭѭҭ֭խޣޡ֡Ӯۮȣݣޣᣏ磏¤ʤåץ֨٨ܨި﨏Ƭʬଏۭ߭宏ȯݯֵݴ׵ø߸޸ͿοصƻŻʰĶ˰ٵ¡ǻá̰ġš²ǡȡɡʡȻˡ̡͡ΡͰСѡҡӽӡԡաϡסءĸ١ڡۡܡڼݡ®îߡࡏΰᡏ⡏㡏䡏塏桏硏ż顏ꡏ롏Į졏衏źĺ϶ŮǮȮƮˮʮ̮ͮήϮѮҮ߱ƺ̼Ԯծڽ֮Ŷ׮خٮнڮϿܮݮɻޮ߮޺ijò£ãģţƣǣɣжˣۼ̣ͣΣϣУѣԣգѵ֣ף߿ޱأڣۣڵǽߣ࣏ñŸIJ˻⣏㣏ʻɵƳȵ壏棏޴۵裏䣏飏꣏룏Ƹ죏Ⱥʵı̻Ų޲äĤŤƤǤȤɤųˤ̤ͤΤϤФѤҤӤԤͻդ֤ϰ޿פؤǸڤïۤߺݤįůƯߤएѶᤏ⤏䤏夏ǯ椏礏褏ȯ餏ɯʯ羅줏ͯίϯЯѯүӯԯկ֯ɺدٯпۯνܯݯ߯λѿƲȽа¥ťƥȥɥʥ˥̥ʺͥΥлϻϥȸѰХѥҥӥԥѻҰإ٥ڥۥܥݥޥߥॏ᥏⥏㥏䥏奏楏祏襏饏Dzꥏ륏쥏累űһڻɸس°¼ҵܵ˺ȲɽɲͼӰҿƶܼԿɶӻȼ¨èĨƨٳǨߴɨԽ̨ͨϨШѨҨΨӨԨըרبڨݨߨਏᨏ⨏㨏䨏娏稏訏騏ꨏ먏ʸҶԻջº˸ðdzݵ̸̺Ʊ·۽ֻ¬ìĬŬǬ׻Ȭɬ޵ˬ÷̬ͬάٱϬѬҬӬԬլ֬԰׬ج٬հڬ۬ܬݬެ߬ᬏ⬏㬏ŷְķ䬏欏笏謏鬏꬏묏Ʒ쬏﬏͸ͺȳػİúμݳκŵǷ­íĭŭƭǭȭȷɭʭ˭̭ͭέϭЭѭɳҭӭԭխ׭ح٭ڭܭݭޭ୏ٻ᭏⭏θߵ㭏䭏ɷ孏歏筏譏魏غмԶ»ۻꭏ뭏쭏ܻﭏݻܽװDZսʷǶ˲ŰûʶȱǺɰݼŮϵƮȮ̲޻ϸ̮ͮͲήϮЮѮҮӮƼԮɱˮخٮڮܮ˳ݮʳϺޮ˷߮ஏưᮏ⮏Ͷ˵㮏䮏殏箏讏鮏ꮏ뮏쮏ﮏذȶݽ˶ڳݱįůƯǯɯʯ˯̯ͯ߳ϯЯѯүӯԯ֯ׯ̵دկگۯܯޯ߯௏⯏㯏䯏每寏篏诏믏쯏﯏նֶβ߻к޽Ļ̳ʱϲ¾˱̱þձʽ߽Ѻľ½̷иž¹ô´в޼ҺٰǾƾȾѼϽ߼ԺѸýͳ̶Ѳ׶ͱĴŴӿùڰͷ۰ֱɾĹαױƴʾǴֽպֺεܹ˾Źγ̾Ҽ˽;׺ضҲٶӲʲξܰԲηƹϱϳϾ׽ȴо޳ڿڶղɴļʴζͽѾҸǹϷȹӼɹٺ¿Ҿзʹѷݰ˹۶˴ްʼĽ̽ҷ̴ӷʹ͹Լ̹ӾδԸιϹ߰ոӵտйѹÿ˼ܴؽҹϴǼĿֲݷܶײѱزԷշӹʮٲдƵݶ۲Ծںڲָվü־ɼſ׸Եؼַ³ܲµԹѽұ׾չ޶Ӹۺؾ߶гƿѴѳ׷ֿپǿھ۾ӱط͵ܾظݲõҴۿڱֹռٷĵݾ׹߲Ӵ޾عϼҳ۱ٸȿּڷӳܺɿ׿޷ҽյʿ׼ԴټٹԳݿڹ߾ӺŽ˿óڸ۹ƽԱݹӶմ״ִشճ޹ܱǰ߹¸ؿٴֳݺ۸̿׳ٿȰǵڴܿ۷б۳ܸܳ±۴¶رٽö߷ܷеݸ˯ׯɮЮگޯʡˡܡ£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣΡϡСáѡ֢עŽÎĎŎƎǎȎɎʎˎ͎̎ΎώЎюҎӎԎՎ֎׎؎َڎێ܎ݎގߎoo pKpppqBqqqrArvrrrrs@sssss!t9tjtttuUuuuuv vBvpvvvwJwwwxxBx{xxxxy@yjyyyy-zNzzzz{P{r{{{{|@|P|||||}O}}}}~:~f~~~~Y~UՀ=|2o$N~܃IM_+]BdчJLj/c7fL*VkٌR#QȎՎUΏ HU6_ӑL~ 1c֓J6gѕߕ={Eė={ơʣңӣ٣ܣ٤¯ܤ㤏ޤ뤏ꤏ̯ǥե֥ŨȨʨ˨ۨ樏쨏Ь嬏֭®ĮǮɮîծ׮֮ۮ¯ïٯίᯏꯏ鯏ĥq#@рo𠪀asmdylink.0"`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_euc_cn_to_utf8pg_finfo_utf8_to_euc_cneuc_cn_to_utf8utf8_to_euc_cn __wasm_apply_data_relocs  "#Aj#A@k6#Aj#Aj6 # #A8j #A X  r . Hb|8Rl(B\v2Lf"<VP&_ M졧¡¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئѧҧӧԧէ֧ا٧ڧۧܧݧާߧק$d$c0h$d>y8x ^  ]  Z  Q  Q QPPO IE>};{1q1q/n&d#c!a^USR P !G!!!"E"""#D###$B$$$%@%%%%+&k&&&('h'''$(d((()])))*W***+A++++5,o,,,.-m---,.i...#/c///"0b000!1`111 2`2223[3334[4445[5556X6667Q7777'8e888#9b999":b:::;_;;;<^<<<=Z===>U>>>?R???@N@@@AMAAA BLBBB CICCCDADzDDDENEEEE.FmFFF+GkGGGH?HHHH=I|III4JQJJJJK7KmKKKK>L~LLL>M~MMM9NxNNN!OaOOOO5P^PPPQZQoQQQRPRRRSMSSS TLTʡǡơ̡ءޡϡΡġšɡȡҡӡߡáˡס֡ա١ԡܡݡڡۡѡ͡С٢ڢۢܢݢޢߢŢƢǢȢɢʢˢ̢͢΢ϢТѢҢӢԢբ֢עآ¢âĢ©éĩũƩǩȩɩʩ˩̩ͩΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩ¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥŨƨǨȨɨʨ˨̨ͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨިߨҡϢػǧԴ˩ɭͤپþشΧԹ˳žƲҰԥήѩͺຶϩҲӴֲնتۼݷ·οɰΫˤ͵κء۰Ѽٮٹٶ޳Ľ뿭ٴ٣ӹ٩Щٶٻټ٫ŵ٥٢ߴٵٮ˿Ҷ˰ع߾ԸâڹԤ٬סմ˻ʵͼۯԶַЮոι֢˯Ȳ̴̿ذй˽찦Ӽν֬ٽۿҴد׳˷ǽܻ׿屲߼ըرخáӣ޲Ǿβ沰ӫ˴ڿŹߵ߻нȰɿ̳߷ضź˾ԳϺϸ¹ͷɰֶԷԿγεʳ渻߽߾߻ſ߱߶Ǻ׾ͺ̾߾ȿߧ߶ϥߴ縶ɨ޿ߺ˽߽ʨΧળпߡߢȷƶɲΫȺμ¸ְٺƬػڶѴ̹صۡۮ̲ӿἳӰطۺ۸ѿdzӺѶܤ̵¶̫ܬɹǮնڱǿ٦̫ѻм޼ܷޱ°ūú׾ʶ˼ѡĨùЯͦ«濽Ӵͻӿ޼յ׿ע澼¹˳ʲٹ֨ҦͿʶ»ϬҼżļܿǯѹԶ˰Ѽ梳;߳ġ־ӾҨڸẵᶰ޴Ѳ޾Ͱұʼ˫֯۵ᣳϻᱴɸûӱЮ⿦׵ϷȶʵѢޥتƪױڳܵϡ鹱ʲհ˱ܺ᲻õµջرɼͦ޷йֹסлֻֿ޺㲶̧ϡҿĢ㷺ڻХ㯱¼㿵ǰϮݻҲͳѲ߹Ϸ̻и߷ȴŻۻ㩺ðΧȷɳƩؽ쿷ŲǰۿǴިѤ簶гѰʥͶٿŧֵ޺֣ĭչܾΰоݰӹŦȩ޽Ƨװֳҹ괰΢̮IJշӻަͦư񼻻ݾݽ޶̸ӽؿ֧ҽ鸧괦ڰݴáġųǥߣٲߢߧĸŷʹеȾ뽰ֱ̽Ҹض봾߰϶·кȼȩɾи굺οгλ޻ưŵǷܲΩľԨ˸IJŶܸѿܽݿܼϼذ̸ƾ¿걻谶˺ͣ۽赵谽̵ÿ׹ֵŸӴ۲ȳδУ˴߼вζٻȱϱѱбʵƭշѱͭȯسڷŤײ㦻ھӺзȴ㨷Ũñѣ麪ֲ͢Ǭü뻰űգƺӵȧլɢԺϿ䭵̵ɶԳ۸ʿͪȸε̱γİƵһľӲ¶Ȼ澿żѸ캱ٷͻ뮰ְŹҵѾݺƽϨ²֨ì緻磲穷ȪѨϹ갿αɴʸӦ±׼۳ξ̰ôҾָӷۺճԱΤթǵװٰĵԽʻ޸кǸĢܶգˡ޽Dzöأɵؾý̶ί°Ƴ׺­̱ŴĿǻӮ̺нѸƿӳƳս̳ɰްڼǶտǭѽܴ߿͵߽˶͸ʰʱѵڵȵֲ߲ܹתݸ۴شɻ۷ִڲԷԶͼȳΡٸ׷ķţϤɸϯ֧ҭὫѭʽ̼ͮ稼бв´ɬ÷պº׻穼ж纻޵翸ɽ׸޹ر·հԵĺҰܳ۾ϴǶظθ릳ɹʷ缾빰Ͽηղ¹Ž̤ĥ͡۱ʾҨ˾㰰ղ涰ϴܬڽɺܶܢܽΥ潫ܾҷŰܾܨܿԲܦׯöǩܢĴݲĻԼܴܫӡݣݥҤݦݧݩɺݱݴܮܯݳݭݪݳݫݨӺݧݼվʺ˲ݤƷüƮӪдٵͱ̲ݢުα޶ުޮѵʹز򢻲°泰纳˺ϲθϲѺƹ׻ΩȻȶֽijòңӹֺ۹ǽƼȥڧȨҶǼ仩ڪѫ÷֬ڭ׶ծʴگұڲڳʴګʵڶϳַڰڹҺøﲻڼӽξ廿ڵڵ̷οڭڸұѻڳڽڻХګ÷ھڴȹϿѺպƲ̶ַܰᱺṡѷغּ߻ɳĶʹɮӸպϸó׿ϰȲ帵ıŵ׶ڴɪνϽ騸鲱ԻԽϷդեмǴٱ߱Ƹ嵷ԥάٳϵűѷݵ庶ѳƱݶܱ˵Ӫۤۦۣ۬ºԿɱ۵ƾӷԪͥͽ˪״éɲְҿդƸ۶ĵָγؼ̬ǭã½Ҩ֩ˮб淿г̶ջü¸臨ͶƶﵾձγâҺӶ׽ʼ¤³°ĵݱӡگѯ͹ƴӧЫլ԰ǦǷаϾޱ¾ҥϳ˹ٶԭƱռҵͥſߵƭɷͲ⹷ҤʥȽݹʸ¦ͱ۳Ծݼ§ҳǹ߸į𦼰Ż͸븽׺ƻںĹDZƴݳȻ硥£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣۣܣݣޣߣ@^z@рasmdylink.0 "`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_euc_jp_to_utf8pg_finfo_utf8_to_euc_jpeuc_jp_to_utf8utf8_to_euc_jp __wasm_apply_data_relocs  "#A j#A@k6#Aܘ j#Aj6 # #A8j #AXr$u/I !c!!"}""9###S$$%m%%)&&&C'''](()w))3***M++ ,g,,#---=...W//0q00-111G223a334{447555Q666P7POC¢â좏ޡ뢏ĢªЪҪѪԪتӪߡ㪏⪏媏䪏Ω«éЫҫѫԫثӫ̩㫏⫏嫏䫏Щ©ĩǪǫŪūƪƫĪũƩȪȫɪɫǩʪʫ̪̫˪˫ɩȩͪͫϪϫΪΫʩ˩ת׫֪֫ͩ٪٫۪۫ڪګܪܫݪݫߪ߫ުޫ᪏᫏એ૏ϩ쪏쫏骏髏檏櫏몏뫏誏諏ꪏ꫏êëժի窏竏摒𢡊ᦏ⦏㦏䦏福馏즏妏ꦏ¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئ§çħŧƧǧȧɧʧ˧̧ͧΧѧҧӧԧէ֧ا٧ڧۧܧݧާߧק!a!aI/m Mm&f% d  V  R  R  R ROONNNNN J I I GECCA@@ @ 9!y!!!8"x"""8#x###8$x$$$8%u%%%5&u&&&5'u'''3(s(((2)r))),*l***++k++++,k,,,)-e---".b..."/a/// 0`000 1`111 2`222 3`333 4`4445]5556]6667]7778Y8889X999:X:::;7;w;;;7<w<<<3=r===2>r>>>2?r???1@o@@@.AnAAA.BnBBB*CjCCC*DjDDD)EiEEE)FiFFF)GhGGGHGHHHH#IcIII"JbJJJKHKKKLGLLLMDMMMNDNNNO?O~OOOPGPPPP.QnQQQ-RmRRR!SaSSS TJTTTT6UvUUU5VuVVV.WnWWW,XKXXX YKYYYY ZJZZZ [ơǡȡɡšġ͢΢ϢߢТܢ¡ʢˢݢޢҡӡԡա֡סء١ڡ̡ۡ͡¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥƭʭĭ­̭˭ŭͭǭϭέíȭɭ߭ӭԭЭѭҭ֭խֵݴ׵ø߸޸°ͿοðصİƻŻŰưǰȰɰʰʰ˰Ķ̰ͰΰϰаѰҰӰ԰հ˰ְװٵذٰڰ۰ܰݰްఏᰏⰏ㰏ǻ䰏小氏簏谏鰏갏및̰찏ﰏ߰²ȻͰӽ±ñıűƱDZȱɱʱ˱̱ͱĸαϱбѱұӱԱձֱױڼرٱڱ۱ܱݱޱ߱౏ᱏⱏ㱏ΰ䱏屏汏籏豏鱏걏뱏챏ﱏżźĺ϶²òIJŲѲƲDzȲɲʲ˲̲ͲβϲвҲӲԲղֲײزٲڲ۲ܲݲ޲߲ಏ᲏ⲏ㲏䲏岏沏粏貏鲏겏벏첏ﲏ߱ƺ̼ڽŶнϿɻ³óijųƳdz޺ȳɳʳ˳̳ͳγijϳгѳҳӳԳճֳ׳سòٳڳ۳ܳݳ޳߳೏᳏ⳏ㳏䳏峏泏糏賏鳏곏볏쳏ﳏжۼѵ´ôĴŴƴǴȴɴʴ˴̴߿ʹδޱϴдѴҴӴԴմִ״شڵٴڴ۴ǽܴݴ޴ߴഏñŸᴏⴏIJ˻㴏ʻ䴏ɵƳȵ崏洏紏贏鴏괏޴봏촏۵ﴏƸȺµõĵŵƵǵȵɵʵ˵̵͵εϵеѵҵӵԵյֵ׵صٵڵ۵ܵݵ޵ߵ൏ᵏⵏ㵏䵏嵏浏絏赏鵏굏뵏쵏﵏ʵı̻Ų޲¶öĶŶƶǶȶɶʶ˶̶Ͷζ϶жѶҶӶԶնųֶ׶ضٶڶ۶ܶݶ޶߶ඏᶏⶏ㶏䶏嶏涏綏趏鶏궏붏춏ﶏͻϰ޿ǸߺѶ·÷ķŷƷǷȷɷʷ˷̷ͷηϷзѷҷӷԷշַ׷ාطٷڷ۷ܷݷ޷߷᷏⷏㷏䷏巏淏総跏鷏귏뷏췏﷏ɺпν¸øĸŸƸǸȸɸʸ˸̸͸θиѸϸҸӸԸոָ׸ظٸڸ۸ܸݸλѿ޸߸ฏḏ⸏Ʋ㸏丏帏Ƚ縏踏鸏긏븏츏️аʺлϻȸѰ¹ùĹŹƹǹȹɹʹ˹ѻ̹Ұ͹ιϹйѹҹӹԹչֹ׹عٹڹ۹ܹݹ޹߹๏ṏ⹏㹏乏幏湏繏蹏鹏깏빏칏﹏DzűһڻɸسºúĺźƺǺȺɺ°ʺ˺̺ͺκϺк¼ҵѺҺӺԺܵպ˺ֺ׺Ȳغٺںɽۺܺݺ޺ߺຏẏ⺏㺏亏ɲ序溏纏躏ͼӰҿ麏꺏뺏캏ﺏƶܼԿɶӻȼٳߴԽ»ûĻŻǻȻɻʻƻ˻̻ͻλϻлѻһӻ׻ջԻֻػٻڻۻܻݻ޻߻໏ỏ⻏㻏仏廏滏经軏黏껏뻏컏ﻏʸҶԻջ¼üļżƼǼºȼɼ˸ʼ˼̼ðͼμϼмҼѼӼԼռdzּ׼ؼټڼۼܼݼ޼߼༏ݵἏ⼏㼏伏式漏缏̸輏鼏꼏뼏켏/̺Ʊ·۽ֻ½ýĽŽƽǽȽɽʽ˽̽ͽνϽнѽҽӽԽսֽ׽ؽ׻ٽڽ޵۽ܽݽ޽߽ཏ὏⽏㽏住彏潏罏轏齏꽏÷뽏콏oٱ԰հ¾þľžƾǾȾɾʾ˾̾;ξϾоѾҾӾԾŷվְ־ķ׾ؾپھ۾ܾݾ޾߾ྏᾏ⾏㾏侏徏澏羏辏龏꾏Ʒ뾏쾏マ͸ͺ¿ÿĿſƿǿȿɿʿ˿̿ͿοϿпѿҿӿԿտȳֿ׿ؿٿڿۿܿػİݿ޿߿࿏῏⿏㿏俏忏ú濏翏迏鿏꿏뿏쿏ᅬμݳκŵǷȷɳٻθߵɷغмԶ»ۻܻݻܽװDZսʷǶ˲ŰûʶȱǺɰݼÏÏÏÏϵÏÏÏÏÏÏÏÏÏÏÏÏ̲޻ϸÏÏÏÏͲÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏƼÏÏÏɱÏÏÏÏÏÏÏÏÏÏÏÏ˳ÏʳϺÏ˷ÏÏưÏÏͶÏ˵ÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏÏďďďďďďďďďďďďďďďďďďďďذďďďďďďďďďďďďďďďďďďďďďďďďďďȶݽďďď˶ďďڳďďďݱďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďďď߳ďďŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏ̵ŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏŏնŏŏŏŏŏŏŏŏֶŏŏŏβŏŏŏŏŏŏ߻ŏŏŏŏкŏŏƏƏƏ޽ĻƏƏƏƏƏƏƏƏƏƏƏƏƏƏ̳ƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏʱƏƏƏƏƏƏƏƏƏƏƏƏǏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏƏϲƏ¾ƏƏƏƏƏƏƏƏƏǏǏǏǏǏǏǏǏǏ˱ǏǏǏǏǏǏǏǏǏǏǏǏ̱ǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏþǏǏǏǏǏǏǏǏձǏǏǏǏǏǏǏǏǏǏʽǏǏǏǏǏǏǏǏǏǏ߽ǏǏǏǏǏѺľ½̷ǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏǏиǏžǏǏǏȏȏȏȏȏȏȏȏȏ¹ȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏôȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏ´ȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏȏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏвɏɏɏɏ޼ҺɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏٰɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏɏǾɏɏɏɏɏɏƾɏɏɏɏɏɏɏɏɏɏɏɏɏȾʏѼʏʏʏʏʏʏʏʏϽʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏ߼ʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏԺʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏʏѸʏʏʏʏʏʏʏʏʏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏýˏˏˏˏˏˏˏˏͳˏˏˏˏˏˏˏˏ̶ˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏѲˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏˏ̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏׶̏̏̏̏̏̏̏̏̏̏̏ͱ̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏Ĵ̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏̏͏͏͏Ŵӿ͏͏͏͏͏͏͏ù͏͏͏͏͏͏͏͏͏͏ڰ͏͏͏͏͏͏ͷ͏۰͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏ֱ͏͏͏͏͏͏͏ɾ͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏͏ΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏĹΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏαΏױΏΏΏΏΏΏƴΏΏΏΏΏΏΏΏΏʾΏΏǴΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏΏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏֽϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏպϏϏϏϏֺεϏϏϏϏϏܹϏϏϏϏϏϏϏϏ˾ϏϏϏϏϏϏϏŹϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏϏγЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏ̾ЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏҼЏЏЏЏЏЏЏЏЏЏЏЏ˽;ЏЏЏ׺ЏЏЏЏЏضЏЏҲЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏЏٶӲЏЏЏЏЏЏʲЏЏЏЏЏяяяяяяξяяܰяяяяяяяяяяяяяяяяяяяяяяԲηƹяяяяяϱяяяяяяяяяяϳяяяяяяяяяяяяяяяяяяяяяяяяяяяяϾ׽яяяяяяяяяȴяояя޳яڿяяяяяяяяҏҏҏҏҏҏҏڶҏҏҏҏҏҏҏҏҏҏҏҏҏղҏҏҏҏҏҏҏҏɴҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏļҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏʴҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏҏӏӏӏӏӏӏӏӏӏӏӏζӏӏӏӏͽӏӏӏѾӏӏӏӏӏӏӏӏӏӏӏҸӏӏӏӏӏӏӏӏӏǹӏӏӏӏϷӏȹӏӏӏӏӏӏӏӏӼɹӏӏӏӏӏӏٺӏ¿Ҿӏӏӏӏӏӏӏзӏӏӏӏӏӏӏӏʹӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏӏѷӏԏԏԏԏݰ˹ԏԏԏԏԏԏԏԏԏ۶ԏԏԏԏԏԏԏԏ˴ԏԏԏްԏԏԏԏԏԏԏԏԏԏԏԏԏʼԏĽԏԏԏԏ̽ԏԏԏԏԏԏԏҷԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏ̴ԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏԏӷԏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏʹՏՏՏՏՏ͹ԼՏՏՏՏՏՏՏՏՏ̹ՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏՏӾՏδՏԸՏՏՏιϹՏՏ߰ՏՏՏՏՏՏՏՏՏոՏՏ֏֏֏֏֏֏֏֏֏֏֏֏ӵ֏֏֏֏֏֏֏֏֏֏֏֏֏֏տ֏й֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏ѹ֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏֏ÿ֏֏֏֏֏֏֏֏֏֏֏֏֏֏˼֏֏֏ܴ֏֏ؽ֏֏֏֏ҹ֏֏֏֏֏֏֏׏׏׏׏׏׏׏׏ϴ׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏Ǽ׏׏׏׏׏׏׏׏׏Ŀ׏ֲ׏׏׏ݷܶ׏׏׏׏׏׏׏׏ײ׏׏׏׏׏׏׏ѱ׏׏׏׏׏׏ز׏׏׏׏Է׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏׏շ׏׏׏ӹ؏׏׏׏׏׏ٲ׏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏д؏؏؏؏؏؏؏؏؏؏Ƶݶ؏؏؏۲؏Ծں؏؏؏ڲָ؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏վ؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏؏ُُُُُُُُُُُüُُُُُُُُُُُُُُُُُُُُُُ־ɼُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُُſُُُُُُُُُُُُُُُُُُُُُُُُڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏ渏ڏڏ׸Եڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏؼַ³ڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏڏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏܲۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏµۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏۏ܏܏܏܏܏܏܏܏܏Թ܏܏ѽ܏܏܏܏ұ܏׾܏܏չ܏܏܏܏܏޶܏܏܏܏܏܏܏܏܏Ӹ܏܏܏܏ۺ܏܏܏܏܏܏܏܏܏܏܏܏܏܏ؾ܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏܏߶܏܏܏܏܏܏܏܏܏ݏݏݏݏݏݏݏݏгݏݏݏݏݏƿݏѴݏݏݏݏݏѳݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏ׷ֿݏݏݏݏݏݏپݏݏݏݏݏݏݏݏݏǿھݏݏݏݏݏݏݏݏݏݏ۾ݏݏݏݏݏӱݏطݏݏ͵ܾݏݏݏݏݏݏݏݏݏݏݏظݏݏݏݏݏݏݏݏݏݏݏݏݲݏޏޏޏõޏޏޏޏޏޏҴۿޏޏޏޏޏޏޏޏޏޏޏޏޏޏڱޏޏޏޏޏֹޏռޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏٷޏĵޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏޏݾޏޏޏޏޏޏޏޏޏޏޏޏߏߏߏߏߏߏߏߏ׹ߏ߲Ӵߏߏߏߏߏߏߏߏߏߏߏ޾ߏߏߏߏߏߏߏߏߏعߏߏߏߏߏߏߏߏߏϼߏҳߏߏߏߏߏߏ۱ߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏٸߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏߏȿּڷӳܺɿ׿޷ҽյʿ׼ԴټٹԳݿڹ߾ӺŽ˿óڸ۹ƽԱݹӶմ״ִشճ޹ܱǰ߹¸ؿٴֳݺ۸̿׳ٿȰǵڴܿ۷б۳ܸܳ±۴¶رٽö߷ܷеݸʡˡܡݡ£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣΡϡСáѡŽÎĎŎƎǎȎɎʎˎ͎̎ΎώЎюҎӎԎՎ֎׎؎َڎێ܎ݎގߎ̢â@g@рasmdylink.0"`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_euc_kr_to_utf8pg_finfo_utf8_to_euc_kreuc_kr_to_utf8utf8_to_euc_kr __wasm_apply_data_relocs  "#Aj#A@k6#Aj#Aj6 # #A8j #A| @. i ( h  _ ?  < { 9w3s1q-m*g&b[ FA|8w4s[WD}:y4t1l)h' g $!d!!!"V"""#T###$N$$$ %K%%% &I&&&'?'~'''<(z(((5)u))),*l*** +`+++,T,,,-S---.I....=/}///=0{00071v11152t222.3n333+4j444*5h555!6`666 7`7778\8889M999 :I:::;C;;;;L>>> ?J??? @E@@@A;A{AAA4BsBBB-CfCCCDRDDDEPEEE FMFFFGDGGGHH^HHHI6IqIII$JcJJJ"KGKKKLDLLLL1MqMMM'NaNNNOROOO PJPPPP)QiQQQ"R\RRRSDSSSS'TgTTT U:UyUUUVQVlVVVWNWWWW'X`XXXYTYYYZPZZZ[P[[[ \K\\\ ]G]]]]<^|^^^+_h___ `L````:azaaabUbbbbcXccc dMddd eHeeefEfffg@gggg7hwhhh0ipiii)jejjjkTkkkklJlll mEmmmm;nunnn.onooo%pbppp q_qqqr_rrrs\ssstZttt uLuuuu>vvvvv(w\wwwxMxxxx:ypyyy,zezzz!{^{{{|V||| }L}}} ~J~~~G9v.k$c#c"bӢԢǡȡءɡ٧ʡբآ֢٢עӡԡġСš֡ա¡áѡҡͩΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨިߨȦǦ¦ƦŦĦæɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئ٦ڦۦܦݦަߦ䦶ƢâǢȢˢʢɢ̢ߡޡ¢ۡݡܡĢŢڡ١Ϣ΢ТѢϡΡۢ͢ܢݢڢ롲ªêĪŪƪǪȪɪʪ˪̪ͪΪϪЪѪҪӪԪժ֪תت٪ڪ۪ܪݪުߪ«ëīūƫǫȫɫʫ˫̫ͫΫϫЫѫҫӫԫի֫׫ث٫ګ۫ܫݫޫ߫¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ©éĩũƩǩȩɩʩ˩̩ߢ¨èĨŨƨǨȨɨʨ˨̨ޢɧʧ˧̧ͧܧݧާԧէ֧קا㧿§çħŧƧǧȧΧϧЧѧҧӧڧۧ짦ᢼߧ߾߻ݦΰ޺˥ܭޣΤпܹӵ֤ޡӷ٥̵̨۷ʧкͿױݷע޻з۱ͥҤִΨҡϨʰϽϯͣЯʻԣ٨٩޸ֳϯ˼ΫЪЯдҿ˯ڰ̵ͦε˾ڨްӳͧЫܹӨ߬˼Ӳް׭Ӥڴ˴̾ر̯ջʫծ۶ٹˬѺ٫ڳٹֺΫʤݦЮͰʻվѢ׺ѰͫʮʮۻʰҺ̨۲ѸԲ٢ڧֲԾ޵ˮѪةޯη̼Ͼˤڪ۵׵ͮͻذֳ˩ֿغ߳ԳլڦܴׯߢۿѤԡ֯޵ѷѳТԳܶΩԳʦϢЧڹ֭ڣε׬޴Ѫ٣Կ׿Ͷ̸ۤݰأٴͷ۵ݵףϹԷۿ˥ܮϬ٦ݯާΡй˰Բ־αܧԹس٬ѱ͹֧ؽ׶̢Ѯ̾ܰ°ðİŰưǰȰɰʰ˰̰ͰΰϰаѰҰӰ԰հְװذٰڰ۰ܰݰް߰±ñıűƱDZȱɱʱ˱̱ͱαϱбѱұӱԱձֱױرٱڱ۱ܱݱޱ߱²òIJŲƲDzȲɲʲ˲̲ͲβϲвѲҲӲԲղֲײزٲڲ۲ܲݲ޲߲³óijųƳdzȳɳʳ˳̳ͳγϳгѳҳӳԳճֳ׳سٳڳ۳ܳݳ޳߳´ôĴŴƴǴȴɴʴ˴̴ʹδϴдѴҴӴԴմִ״شٴڴ۴ܴݴ޴ߴµõĵŵƵǵȵɵʵ˵̵͵εϵеѵҵӵԵյֵ׵صٵڵ۵ܵݵ޵ߵ¶öĶŶƶǶȶɶʶ˶̶Ͷζ϶жѶҶӶԶնֶ׶ضٶڶ۶ܶݶ޶߶·÷ķŷƷǷȷɷʷ˷̷ͷηϷзѷҷӷԷշַ׷طٷڷ۷ܷݷ޷߷¸øĸŸƸǸȸɸʸ˸̸͸θϸиѸҸӸԸոָ׸ظٸڸ۸ܸݸ޸߸¹ùĹŹƹǹȹɹʹ˹̹͹ιϹйѹҹӹԹչֹ׹عٹڹ۹ܹݹ޹߹ºúĺźƺǺȺɺʺ˺̺ͺκϺкѺҺӺԺպֺ׺غٺںۺܺݺ޺ߺ»ûĻŻƻǻȻɻʻ˻̻ͻλϻлѻһӻԻջֻ׻ػٻڻۻܻݻ޻߻¼üļżƼǼȼɼʼ˼̼ͼμϼмѼҼӼԼռּ׼ؼټڼۼܼݼ޼߼½ýĽŽƽǽȽɽʽ˽̽ͽνϽнѽҽӽԽսֽ׽ؽٽڽ۽ܽݽ޽߽¾þľžƾǾȾɾʾ˾̾;ξϾоѾҾӾԾվ־׾ؾپھ۾ܾݾ޾߾¿ÿĿſƿǿȿɿʿ˿̿ͿοϿпѿҿӿԿտֿ׿ؿٿڿۿܿݿ޿߿¢¤¦¬®¯±µ·¸½¡âãåéëìôøúûýĢĥĦĨĬİĴĸĺĻĽŢŪŮűŵŹżžƣƧƯƲƵƻƽǫǮDZȤȩȮȴȹͭϢиѢңҧҨҩҪҫҭҲҾԥիծոۥܥ޳£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣۣݣޣߣˡ̡͡ܣ@^@рvasmdylink.0В "`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_euc_tw_to_utf8pg_finfo_utf8_to_euc_tweuc_tw_to_utf8utf8_to_euc_tw __wasm_apply_data_relocs  "#A j#A@k6#A j#Aj6 # #A8j #Aw>>3???M@@ AgAA#BBB=CCCWDDEqEE-FFFGGGHaHHI{II7JJJQKK LkLL'MMMANNN[OOPtPP0QQQJRRSdSS T~TT:UUURVV WhWW$XXX>YYYXZZ[r[[.\\\H]]^a^^_z__6```Paa bjbb&ccc=dddWeefqff-gggDhhi^iN.¥åĥťƥ| L K$OVK1[ I I I I  G  G FFFFFFFFFEEEEEEEDD D !D!!!"D"""#C###$A$$$%A%%%&A&&&'A'''(A((()A)))*A***+@+++,@,,,-@---.@.../@///0>0~000>1~111:2z222:3z333:4z444:5y55596y66697y77798y8889X999:V:::;V;;;<V<<<=V===>V>>>?V???@T@@@ASAAABSBBBCSCCCDSDDDE3EsEEE3FPFFFGPGGGHOHuHHH5IuIII5JuJJJ5KuKKK5LuLLL5MuM~MMM&NfNNN&OfOOO&PfPPPQ[QQQRERqRRR1SqSSS1TmTTT-UmUUU VLVVV W1WqWWW0Xݢآբע֢٢ڢܢۢɢȢŢƢ͢΢ТϢĢǢʢģţǣƣã£̣ͣΣȣɣˣʣԢѢӢҢҡӡΡϡ֡סڡۡʡˡơǡǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥ̢ˢ⢮᢮㢮áġţơš䢮γ칮墮졮梮¤§ǡɡ̡ˡʡʡơɡȡ򡮎𡮎šǡ袮񡢎뢮碮𡢎좮򡢎ꡢ𢮎롢󢮎󡢎򢮎졢ФȤϤƤŤΤɤˤäĤ̤䮎䮎˥ǧ̥ϧå¥ɥħѧȧĥȥçƥʥťǥ̧ɧ˧ʧͧ⮎䮎ȯͯ񭢎𭢎įد̯֯Ư˯ɯǯꭢ뭢ϯӯ쭢޳ﭢů魢ίѯï򭢎Я󭢎ԯկ䮎波ڳ߳峢سܳճٳĴ곢Գ´ׯ鳢Ǵ۳ֳҳೢӳѳݳ㳢䳢᳢гⳢ˴糢ϳô׳賢̴ʴŴƴºú񹮎򹮎﹮𹮎䮎Ů㮎ɢȢȢŮŮȢŮȢŮ㮎ɢŮŮɢȢȢȢȢŮɢɢɢȢŮϢˮϢˮϢϢϢˮϢϢϢϢϢϢˮˮ䮎֢֢Ю֢֢Ю֢ЮЮܢܢܢܢܢԮԮܢЮᢎᢎ׮Ϣᢎ墎墎ܮ뢎뢎எԤӤѤҧĺޮ䮎͡ȡΡէפͥۯٯگʹ٤ڤΥϥޯ߯ϴ볢δźɢˮˮˮ֢Ԯѡۤ٧Ůڧҡ̡ˡߤ᤮ܤޤݤमۧԥѥҥާХߧݧ䮎ӥë诮寮⯮௮毮ᯮ㯮䯮д쳢ﳢѴɢɢ̢ˮϢϢˮЮЮ墎뢎뢎எԡӡ㤮⤮᧮৮ե⮎⧮ȫƫǫﯮ쯮꯮񳢎Ҵ𳢎ɢƮɢŮˮϢϢͮܢ墎ա֥֡ץǺƺЮ͡䮎央ɫ򳢎ɢƮˮ֢Ԯܮ袎ס椮إ١Ρ㧮ʫڡ䮎ܪ礮姮槮˫ۡ٥秮ڥ䮎󳢎ԴȺɺɢƮƮˮԮ墎ܡ駮ꧮմޡ࡮맮ЫϫΫ֢ͫţģ𤮎ã󤮎ƣ£륢ꥢ異䥢祢ᥢ奢饢ʩΩ楢񧮎⥢㥢ܥݥߥ짮ۥॢ𧮎襢󧮎ޥ燐쥢ܫݫɩ̩׫٫ĩЩ۫ԫޫƩéѫ˩ͩǩȩի䮎㫮᫮ӫũثϩƮĮŮîȮ®ɮ󯮎Ǯ箎ߴ贮洮紮۴ش⴮ᴮ״䴮޴ٴ䮎䮎箎䮎κٺܺպҺںߺӺʺ׺Ѻݺ޺кֺغ̺ۺ˺ºͺԺ箎¢¢¢¢¢¢箎箎¢䮎ƮɢɢƮɢɢɢɢƮɢƮƮƮɢɢƮɢɢɢƮɢɢƮ䮎䮎ƮɢƮϢˮϢˮˮϢϢˮϢϢϢϢϢϢϢˮϺϢˮϢϢϢˮϢˮˮˮƮˮˮˮϢϢ֢Ю֢Ю֢֢Ю֢֢֢֢֢֢ЮԮܢܢܢܢܢܢܢԮԮܢܢ䮎䮎ܢ׮׮ᢎᢎᢎᢎ׮ᢎᢎ׮׮׮墎墎墎墎墎墎ڮ䮎袎袎袎箎箎䮎ޮ뢎뢎뢎箎߮எɣȣǣȥ𥢎񥢎嫮ʮˮຢĺú¢ƮϢ֢֢߮ᡮϡС⮎£ʣˣͣΣ̣ϣ¥䮎򥢎󥢎䮎թ髮諮۩쫮竮ꫮ٩ߩ񫮎֩کܩީة𫮎שҩө뫮ԩݩ򫮎櫮ѩծԮٮЮӮҮ֮ڮѮ׮̮خϮή񴮎Ĵ´򴮎ȴ̴鴮ô봮ʹ˴躢ƴﴮɴϴʴδŴ䮎Ǵ䮎䮎ʺ㺢ź캢뺢亢Ǻк溢꺢̺庢红Ả㮎󺢎𺢎ͮﺢ⺢򺢎񺢎κɺ¢˺㮎䮎麢¢¢¢¢¢¢¢¢¢¢¢¢㮎¢¢¢ƮƮɢɢƮƮɢɢɢɢɢɢƮɢɢɢɢɢƮƮɢɢɢɢƮɢƮƮƮɢ䮎ϢϢϢˮϢˮϢˮˮϢϢƮϢˮϢˮˮˮˮ֢Ю֢֢֢Ю֢ЮЮ֢֢֢ЮԮܢԮܢܢܢ墎墎ڮ墎ڮ袎ޮãťåĥ੢Һ¢ɢϢ䮎ЮģУƥᩢۮƮ宎墎ѡˮҡǣɥѣܮ䮎⩢дӺԺɢƮᢎˣͣե̥֣٣أ˥գӣ֥ӥΥѥԣۣףңڣŨƨ𩢎詢䩢㩢񩢎婢穢򩢎󩢎쩢謁驢멢ꩢ橢䮢⮢⮎ϰʰᮢޮ㮢ݮΰ客ŰȰҰ߮஢Ͱ˰殢״ִ鴢索𴢎ഢ㴢崢괢财ٴⴢݴӴﴢߴҴ䴢񴢎ᴢմڴѴ޴۴Դ촢ܴش봢㺮Ắغۺ򺮎ٺຮ洢¢溮⺮ܺ޺󺮎ں׺ֺ¢¢¢¢¢¢¢¢¢¢¢¢¢¢¢¢¢¢¢뺮䮎䮎ɢɢɢɢɢɢɢɢɢɢƮɢƮɢɢɢɢɢɢƮƮɢϢТϢТТˮˮϢˮϢˮТТТˮТˮТˮˮˮТ֢ЮЮ֢֢Ю֢֢Ю֢֢֢Ю֢Ю֢֢Юܢܢܢܢ֢ԮԮܢܢܢܢԮܢԮԮԮڮ׮׮ᢎ墎墎墎ܮܮ袎ܮ뢎뢎ޮ߮எȨ⮎䮎箢󴢎򴢎ɢЮܢڮܮӡԡУڥܣݣ̨ʨΨ˨ͨ订ꮢ鮢װְհ¢¢¢㮎ɢɢ֢ܢܢڮޮޥܥݥШ뮢ذٰա⮎ңѨ¢宎ޣߣߥ¢Ԯ֡ԣԨըڰ۰쮢䮎õĵɢТᢎᢎڮ𢎫ءס䮎գڣ᥮楮磢⣢䣢棢㣢࣢⥮ᣢ壢裢飢㥮ɦݨæƦĦʦͦȦǦ¦Ŧ̦ި˦ܨߨרب䮎¬ì㰮߰𮢎䰮񮢎ᰮⰮ򮢎ް⮎⮎ﮢ󮢎˵ȵǵѵҵϵյƵεʵԵ˻һǻûӻлλȻѻʻ»Իͻջϻ¢ŻĻɻƻ̻¢¢¢¢¢¢¢¢¢䮎ɢƮɢɢƮɢɢɢɢɢɢɢƮɢɢɢɢƮƮɢ䮎ˮˮˮТТТˮТˮТТˮТТТТТТˮˮ䮎Ю֢֢֢֢Ю֢֢֢֢֢֢֢Ю֢֢䮎ܢԮԮԮ䮎ᢎ׮䢎墎ڮ袎袎ܮܮ뢎ܮ뢎ޮ߮எ꣢׵ˮ¢祮ਮŬĬ㡮١ܣ襮룢륮죢⨮ᨮϦΦЦƬ氮鰮谮갮簮۵ٵصڵ׻ֻ¢¢¢¢¢ƮɢɢɢˮТТˮТ䮎֢֢֢Тܢܢᢎᢎ֢墎殎㨮ڡǢۡȢ殎𣢎񣢎娮種訮Ȭ찮밮ᵮ൮¢¢¢¢¢䮎ɢƮƮɢʢʢʢɢɢʢТɢТТ֢֢֢֢֢Ю䮎袎袎ܮ뢎ᣮ騮먮̬ˬ葉򣢎䡮ɢ⣮»󣢎񥮎ҦӦԦ𨮎Ѧͬﰮ⵮㵮ǻŻĻ¢ʢʢТ֢׮ʢѣզ񨮎ػЮ׮ᮎ¡򥮎Ьʢ߮ئצ֦⮎𰮎򰮎񰮎䮎䮎ڻٻ˻ۻ¢¢ТƮƮʢˮ䮎עעܢ墎袎袎ޮ͢⮎ܡ̢¢森磮飮٦ڦᦢߦ覢馢즢릢⦢⮎ݦ䦢廉妢禢ڬΪܦ榢ۦꦢ۬ަ㦢ঢ˪̪ϪŪǪ⮎Ȫମʪ֬󰮎׬ݬƪªЪɪԬĪͪ߬ᬮѪҪêܬ赮񵮎򵮎ﵮµԻĵݻƵɵ컢ǵỢܻŵ޻ȵ໢굮ֻջõ߻ػٻڻͻ㻢绢¢黢껢޻뻢񻢎򻢎滢ϻ仢󻢎ѻ𻢎ݻ転⻢廢ﻢỮ⻮㻮л䮎ʢ¢¢ʢ¢¢¢Ʈ¢ƮʢƮ¢ʢƮ¢¢¢¢¢䮎ʢʢʢʢˮˮʢˮʢƮʢˮʢТƮʢʢƮʢʢʢʢ̮ТʢƮƮʢƮТ̮Ʈ̮ˮТТעТˮТТˮעЮ̮ЮТ̮ע̮ТТТˮˮעТТТТТТעܢЮעЮעЮܢЮעЮעܢЮעעעЮЮЮ殎ᢎᢎԮԮԮԮԮܢᢎܢԮܢܢܢܢᢎᢎᢎᢎᢎᢎᢎ׮袎墎뢎߮ᮎݡ룮𦢎㬮仮¢¢¢¢ʢƮʢʢƮТ̮Ю߮塮桮΢񦢎ӪԪТޡɢˢâ죮ĢʢƢȢŢ̢Ǣ䮎򦢎󦢎ժ۪窢تઢߪܪ䪢檢᪢ڪאַ𬮎תު֪٪ݪ⪢㪢媢쬮묮Ưʵȯ¯˯ᵢͯǯίʯį̯ïůɯ䮎䮎˵ݵٵֵ赢۵㵢ߵε嵢͵䵢׵̵絢յص浢ӵܵҵеⵢൢԵѵ޵ڵ䮎ϵ񻮎𻮎¢󻮎绮滮軮ââ¢򻮎㮎ﻮ宎âââââââââââââââââââââʢâââââââǮʢâââ殎ʢƮʢʢǮʢʢƮǮƮʢʢʢʢʢʢǮǮʢʢТǮʢʢТТǮʢʢʢʢʢʢƮʢǮʢ̮Ǯʢ̮Т̮עТТТ̮̮Т̮̮ТТТ̮ТТТ̮Тʢ̮̮̮̮Т̮宎̮עЮע̮ЮעעעЮЮЮעעעעЮԮԮܢܢ׮׮ܢܢ׮ܢԮܢע׮ᢎ׮ᢎᢎᢎᢎᢎᢎ׮墎ڮ墎ڮڮ墎墎墎墎ޮ袎袎袎袎宎뢎߮߮߮எ򬮎ע确衮͢誢骢󬮎Яϯ鵢㮎âǮʢТТТТעעܢܢ墎ܮإâᢎ±ʢעꪢТТԮܢ몢ԯүӯѯ굢¼üâܢᢎڮ墎墎袎顮Ѣ󣮎򣮎Ϣ΢⮎é©𪢎򪢎񪢎󪢎甆쪢Ʊ̱ıׯɱկȱͱűñد¶ﵢ֯˱쵢𵢎Ķ뵢Ŷʼżȼ˼âɼƼļǼââââââââǮǮʢʢʢǮǮǮТТ̮̮ТТТ̮Т̮Тעע̮עעЮעѮЮЮעעעעѮԮעԮԮܢԮԮԮᢎᢎᢎ墎ڮڮ宎袎袎ܮܮ袎𢎹𢎿ᮎ̼宎ʢʢѮũ殎ٯگȶ񵢎ǶƶâƢʢעѮ殎ҢעҢѢԢӢ֢ТբȦäɦǤ¤ŤŦĦǦƤ¦Ĥʦ⮎ǩǧȧŧҩƧɩħ⮎ʩϩ§ɧȩçΩ̩宎宎ë«ūīѩ宎宎ﯢݱ㯢ױܯӱ寢۱ۯޱ䱮б廊߱񯢎篢ֱ询򯢎鯢㱮䯢ޯ߯쯢毢Աϱ௢ڱ믢ٱݯᯢ󯢎ꯢ⯢Ɱرᱮ౮宎宎նථζ򵢎۶׶󵢎ѶڶͶܶж˶Զ㼢̶Ҷ޶߶ֶż漢񼢎༢𼢎鼢μּӶм򼢎󼢎޼ټ켢ӼؼҼ弢âԼݼڼ׼輢뼢꼢¼ϼ߼ἢͼռܼ伢ۼ缢Bļ宎Ѽ宎âââââââââââââââââââââââââââââââââââââ⼢ââââââŢʢʢǮˢʢǮʢʢˢǮʢʢǮˢǮʢˢǮʢˢʢʢˢʢʢʢʢǮʢˢʢʢ㮎ʢʢʢʢǮˢʢǮˢǮʢʢʢʢǮǮʢǮǮ̮ˢǮТǮТТѢѢ̮̮ѢТѢ̮̮ТѢѢѢѢТ̮̮ѢѢѢТТѢТѢѢѢ̮̮Ѣ̮Ѣ̮̮ѢТѢТѢ̮Т̮ТТ̮̮ѢѢѢע̮̮̮宎עѮעѮѮעעעעѢעѮѮѮעעѮѮעעעעעѮѮעעעѮעעѮעעעѮעעעעעעѮעѮעѮѮע宎宎ԮݢݢԮݢݢծݢԮݢԮݢܢݢծݢݢݢݢݢծԮݢݢծݢݢݢݢݢݢԮݢծ׮ᢎ׮خ׮ᢎ׮ᢎᢎᢎᢎ׮ᢎ׮خ׮׮خᢎᢎᢎ׮宎墎墎墎ڮ墎墎墎ڮڮڮڮڮ墎墎墎墎墎ᢎڮڮ宎墎颎ܮ颎墎׮颎颎颎颎颎ܮ宎뢎颎뢎ޮޮޮ뢎ޮ뢎뢎߮߮宎宎எ񢎡񢎢񢎤ᮎᮎᮎʧөԩƫ⮎汮屮籮ⶮĢââââĢˢˢˢ̮Ѣ̮̮עעעѮѮݢծᢎ墎թ֩豮ɼǼ®ǮҢӢ̧˧ةǫȫ걮¶䶮Ģ®㮎ˢˢˢǮѢѢѢѢעעעݢ墎٩ɫ嶮˼®ˢˢעעᢎȤکʫ˫宎宎̫ͧ­챮涮ͼ宎ĢĢĢ®ĢĢˢѢѢѢѢעעעݢծᢎ墎ߡآɤʤݩΧ宎ͫΫöμ®®ࡢעԢ㡢⡢ᡢآ٢٢ݢߢࢢܢڢޢզۢ宎ۤ٤̤Ӥͤ䩮դЦҤѤڤӦˤצܤѦ̦姢Τ֤㧢ϤݤФͦϧפ㩮Ԥؤ䧢ΦҦܦ٦֦ۦ֧έ맢멮⧢ԧاۧ秢ڧܧݧꧢ⮎駢쩮٧梨ৢէꩮӧ׫᧢槢婮驮⮎ק穮ѧЧާҧߧϭ짢ƭޫ᫢Э䫢٫ȭʭ竢ꫢ쫢֫嫢ݫիɭǭͭǰ⫢ګܫ߫ҫ諢˭뫢ŭ׭ӭϫ髢ѫ觢ثЫ㫢۫ӫԫ櫢ૢխѭ󱮎°ﱮ򱮎˰ɰʰİŰȰưð̰宎ŶɶﶮǶƶм̶򶮎޶궢۶ԶĶ궮ජ붮жⶢڶ趢춮ᶢ㶢嶢ζ߶Ӷ綢ضֶ׶ҶѶ˶鶢նʶܶݶ䶢ٶͶ涢ݼ϶𶮎宎ԼҼͽѽȽ뼮½νǽٽڽ̽ڼּؼ鼮׽Ͻս漮伮۽ŽýɽƽӽнؽĽۼ˽®༮ܼʽȶѼ켮Խҽֽ⼮宎㼮輮宎㮎宎宎ĢĢĢ®ĢĢĢĢĢ®ĢĢĢĢĢĢĢĢ®®®ĢĢĢĢ̮̮̮ĢĢĢĢĢĢĢĢĢĢĢˢĢĢĢĢĢ®®®Ģ®®®®®ˢˢˢǮˢǮˢˢˢˢǮˢˢˢѢˢǮˢˢˢˢˢ̮Ǯˢˢ̮ǮˢǮˢˢˢǮˢǮˢˢˢˢѢˢǮˢˢˢǮˢˢˢˢˢˢˢ̮ˢѢǮˢǮ宎宎Ǯ宎ˢѢѢѢѢѢѢ̮Ѣ̮ѢעѢѢѢ̮ѢѢѢѢѢ̮Ѣˢ̮̮ѢѢ̮ѢѢѢѢ̮ѢѢѢѢ㮎ѢѢѢ̮Ѣ̮ѢѢѢѢѢ宎宎עѮآעآآݢآآآעآآآآѮѮآآѮעעѮآעѢעעآآעݢآעآ̮ѮݢծծծծݢݢݢݢݢծݢݢݢծݢݢڮݢѮծ⢎宎⢎⢎خᢎ⢎ᢎخخآᢎᢎخ⢎ᢎᢎᢎخخᢎ墎墎墎墎ڮ墎墎墎墎墎ڮ⢎墎墎颎墎ڮ宎宎颎颎颎颎颎ܮ颎颎颎颎颎颎ܮ颎颎颎颎뢎뢎뢎뢎ޮ뢎뢎뢎ޮޮஎ߮எ宎𢎾𢎼𢎥񢎤ᮎ񢎾򢎿ᢢޤ⦮ߦަߤ㦮ম򧢎𩮎﩮򩮎񩮎󧢎𧢎񧢎﫢ޭ󫢎ܭڭح⮎孮⭮߭򫢎񫢎䭮㭮譮ݭ𫢎宎ڰ۰ܰ⮎Ѱٰްϰհΰذ԰ݰͰаְװ߰Ӱ宎宎񶢎󶢎ﶢ붢߽򶢎𶢎춢宎宎齢ݽ潢ܽ佢⽢㽢罢N򼮎ར޽ὢ形񼮎󼮎宎轢宎宎宎ĢĢĢ̮̮®Ģ̮̮ĢĢĢ®ĢĢȮĢĢĢĢĢĢĢ®®®Ģ宎Ģ®宎宎宎ĢˢǮǮǮˢˢˢǮˢˢˢǮˢǮǮǮǮˢˢǮ宎宎ˢѢѢѢѢѢѢѢͮͮѢѢͮѢѢѢͮͮͮѢѢѢѢ宎ѢѮѮآѮѮآآآآآآآآآآآѮ㮎آѮѮآآآآآ宎宎ݢݢծݢݢծծծծݢݢݢծ⢎خ⢎⢎خ⢎墎⢎ڮ墎墎ڮ墎ܮ墎宎ܮܮܮ颎颎ڮܮܮ宎뢎뢎߮뢎߮எᮎᮎ񢎬魮뭮¡ఢˢ꽢®Ģ®®ˢͮͮ뽢⢢ढ䦮㰢Ⱒᰢ「콢𽢎ĢĢĢĢĢˢǮˢˢѢͮѢآآ墎墎墎墎墎颎ᮎ䡢塢㢢䢢릮馮椢榮禮⤢ꦮᤢ夢㤢礢䤢覮𭮎󭮎񭮎鰢氢谢尢갢簢䰢밢򽢎񽢎®󽢎ĢĢĢĢ®Ģˢ®宎宎ĢĢͮˢˢǮˢѢǮǮǮѢҢҢҢҢҢҢҢҢҢآآآآآآآݢݢծݢ⢎颎颎뢎桢ڢ롮墢줢ꤢ뤢褢餢𰢎찢ﰢDz򰢎Ʋ񰢎󰢎宎宎®®宎®®ĢŢ®Ģ®Ţ®®®ĢĢ®ŢĢĢĢĢĢ®Ţ®Ģ®®ȮǮˢǮǮˢȮȮǮˢˢˢˢȮˢȮҢͮͮҢҢآҢͮͮҢҢҢҢҢҢͮ宎ݢآͮآآѮݢ㮎آѮѮآآѮ宎ݢݢݢծݢծݢݢݢծ宎⢎⢎梎⢎خ颎⢎خ⢎⢎⢎⢎梎ڮ墎ڮڮڮ墎ܮܮܮܮܮޮŢȲŢŢŢˢ®ˢˢȮҢҢͮѮآѮݢݢݢݢ⢎⢎梎뢎ķŢ®ŷ梢βͲвϲѲƷɷǷý½ĽŢŢ®ˢҢآѮծݢܮŽ̢ۢ󦮎濫𤢎ײղҲķŷ÷ǷƷ·ʷǽŢ®ŢŢŢŢŢŢŢŢŢŢ®ŢȮ̢̢̢ȮŢŢ̢̢̢̢ҢҢҢҢҢҢҢҢҢѮآآآآآآآѮѮѮآآݢծծݢݢݢծخ⢎خ⢎⢎⢎⢎خ⢎梎⢎ޮޮ뢎எ宎ܢ宎碢񤢎ɷȷͷ̽®îŢҢҢҢҢѮծݢծ⢎ڮ颎颎ͽŢȮ̢Ȯآ宎⢎颎ڲ۲ʷзҷѷϽŢȮآݢخ⢎颎ǬɬȬìĬŬ⮎¬Ƭ䲮߲޲貮ٷ粮岮ӷշܲ㲮ͷ̷ӷηϷѷзշ˷ԷҷⲮ׷ֽӽ¾ѽҽþžƾľŢîŢŢŢîŢŢîŢŢîŢŢŢ̢̢ȮȮȮȮȮȮȮȮ̢̢̢̢̢̢̢ҢҢͮҢҢͮآѮآѮآآآآآآآآծծݢծݢծݢݢݢݢݢݢخخ⢎خخخ⢎梎ڮڮ梎梎颎颎颎颎뢎ޮ𢎲䮎񢎩񢎳鲮Ǿ׽ŢʬˬȾݢ梎颎ԬϬ̬ӬҬѬЬͬάլ宎宎殎ı첮ܷűDZñ±ȱƱ宎ⷮݷ㷮ݷַطڷ߷۷ٷᷮ޷෮׷宎宎宎̾Ծܽɾվٽʾ˾ݽӾҾϾ;оѾξڽîŢîŢî̢ŢîîŢŢŢŢŢîîîîŢîîŢŢŢŢŢ̢̢Ţ̢̢̢Ȯ̢̢̢̢̢ȮȮȮ̢̢宎ȮҢͮͮҢҢͮͮҢҢҢҢҢҢҢͮͮҢҮ宎آҮآآآآآآآآآآҮآ宎ծծݢݢծݢݢݢݢݢݢݢݢݢخخخ⢎خخ⢎خ⢎⢎⢎⢎⢎خ梎ڮڮ梎梎梎梎ڮ梎宎颎颎颎颎颎颎뢎ޮ뢎ޮ뢎ޮஎ𢎪򤢎è¨ڬ٬֬ج׬宎˱ϱαͱɱﲮ𲮎ʱ̱巢򲮎㷢߷޽෢ᷢⷢ䷢淮差پ߽ؾ׾־佮⽮ŢŢŢîîŢî㽮宎Ȯ̢Ȯ̢̢̢̢̢̢̢̢̢̢宎ҢҢҢͮͮͮҢҢҢ宎آҮݢҮݢ⢎⢎خ梎颎எ硢淢宎ĨªĪ宎ܬ߬ݬ®۬ެî󲮎ֱرױұձбѱԱӱ鷮緮뷮귮鷢귢跢췮緢彮ھܾ޾潮齮۾ݾ轮îŢŢŢŢŢŢŢŢŢîŢ宎̢̢ȮȮ̢ȮȮ̢̢ȮͮҢͮͮͮͮآҮآآծ̢ҮҮޢݢޢޢݢݢ⢎ڮڮ梎梎ڮ颎颎颎ܮஎஎ袢ŨƨĮǮᬢଢɮȮ۱ٱ߱ڱޱܱݱ뷢򷮎񷮎췢߾𷮎ŢîŢŢî宎̢̢̢ͮ٢ҢҢҢآآ٢آҮҮޢޢޢծޮޮǪή⬢Ϯͮˮ̮ౢ󷮎񽮎ᾢྡྷ𽮎îîŢȮ̢ȮҮծծخ颎߮ǨѮЮ㬢䬢Ɫ䱢汢鱢籢豢屢ᱢ걢㱢󷢎񷢎㮎򷢎𷢎宎﷢辢侢꾢㾢徢⾢澢羢򽮎龢宎îŢîŢŢŢŢîŢîŢîŢŢŢŢŢŢŢîȮ̢Ȯ̢Ȯ̢̢̢̢̢̢̢ȮȮ̢̢̢̢̢ȮȮȮ̢ҢͮҢͮͮҢҢҢҢͮ㮎㮎ҢҢͮҢ殎٢٢٢٢٢٢٢٢٢٢٢٢٢٢٢ҮҮޢޢޢޢޢծޢ٢ծޢծޢޢޢޢޢޢޢޢծޢޢޢޢޢޢծծ⢎خخ⢎⢎⢎⢎⢎خ⢎⢎⢎⢎梎⢎خ殎⢎殎梎ڮڮ梎梎梎殎ܮ颎颎颎颎颎ܮ殎ޮ뢎뢎ޮ߮߮எஎ殎𢎬񢎥ᮎ⮎ɪȨȪҮ欢笢嬢ԮӮ謢鬢ꬢ뱢񱢎ﱢ𱢎챢쾢뾢殎îŢîŢŢȮȮ̢̢̢̢ͮͮͮҢͮͮҢͮҢҢͮ٢٢٢Ү٢٢ծծҮخخޢ梎梎殎颎뢎ᮎஎ˪ɨʪ묢쬢󱢎򱢎򾢎󾢎ᄁ񾢎𾢎îƢƢƢƢƢŢƢƢƢŢîŢîîîƢƢƢîƢƢî̢îîî̢̢̢͢Ȯ̢̢Ȯ̢̢Ȯ̢̢ȮȮ̢̢̢̢̢̢̢̢̢Ȯ̢̢͢Ȯ̢Ȯ殎Ȯ殎ήҢҢͮҢҢͮήήҢҢҢήͮҢҢҢТήҢҢͮҢήήήήήͮͮҢ殎٢٢٢٢٢٢٢٢٢٢٢Ү٢٢٢٢٢٢٢٢ҮҮޢޢծޢޢޢޢޢޢޢޢޢޢޢޢޢޢծخ⢎⢎⢎⢎⢎⢎خ⢎خ⢎⢎⢎⢎殎خ梎ڮڮ梎梎ڮ梎梎梎梎梎梎梎颎颎ܮ颎颎ޮޮ뢎뢎뢎ޮ뢎뢎뢎ޮ߮𢎯񢎱񢎮񢎰񢎹⮎Ұ殎Ȯ٢ޢծخ梎梎뢎߮颢ΪƢƢƢƢƢȮȮ͢Ңή٢٢٢ޢޢޢ梎䮎梎𬢎ݮﬢîƢƢƢҢҢήҢ٢⢎خ⢎梎颎뢎񬢎³ó¸ƢƢî͢͢͢͢ӢήӢӢҢӢҢ٢ޢޢᢎծ⢎⢎خ梎梎颎殎򬢎ij󬢎ŸĸøƢɮ͢٢٢֮ޢخܮ뢎󤢎ʨɳȳdz殎ǸƸȸ箎î㮎ɮ͢͢ɮɮ殎ӢήήӢήήή٢Ү֮⢎梎颎ܮܮܮ衢˨֪۪ͨتϪ٪Ш̨ҪԪϨתΨ殎殮மᮮޮ宮䮮̳ʳҳ˳γͳϳ㮮ľҸɸɸ˸Ǹ̸ԸиθѸոʸӸ㮎ϸ͸¸ŸȸþžƢ¾ƢƢîƢîƢƢƢîƢƢƢîîĮƢƢîƢƢĮɮ͢ɮ͢͢͢͢͢͢ήήήӢήӢӢӢӢήӢӢ٢٢Ү٢٢Ү٢Ү٢٢٢٢٢٢֮٢ޢޢޢޢޢ֮ޢޢخ⢎⢎⢎ڮ梎ڮ梎颎颎뢎񢎳ޢǾ٢Ⱦɾ梎ݪָɮ͢ӢҮخڮƢѨ议׳سճ۸ظڸ׸ٸƢĮƢƢƢ殎ƢɮɮӢӢӢӢӢӢ٢٢٢ޢޢޢ⢎⢎梎ڮ梎梎ڮ颎颎ޮܸڮꢢ뢢좢֨ըרમܨҨਢ樢㨢몮٨ߨᨢ檮Ԩڨ쪮ިب娢ݨۨӨ⨢䨢ު誮ꮮ뮮í­򮮎ƭŭ鮮ĭﮮDz©殎殎ʲⳮŲ͸Բٳ̲߳²۸˲ײϲƲղβͲȲߪòѲ׾вزֲҲɲIJӲڳ㳮殎θѸ⸢丢鸢ԸḢ츢󸢎и渢ϸݸ򸢎ย帢ݸո긢縢踢꿢𸢎޸︢׸Ҹ޸㸢߸븢񸢎ظ߸ѿſ⿢뿢Ϳ濢οܿؿ޾ٿ¿翢Ͼپ俢ڿ𿢎տƢ;󿢎ӿ߿׿񿢎пɿԿ߾ȿƿ迢Ͽ쿢˾㿢ۿ˿ÿ忢¬ʿֿҾҿܾھῢоݿ޿̿࿢ǿ鿢ؾݾ־ξ򿢎殎۾殎ĿƢĮǢƢĮƢƢƢƢƢƢƢƢƢƢĮƢƢĮƢƢǢƢƢĮĮƢƢƢƢĮǢƢƢĮǢĮƢĮƢƢĮƢƢƢǢĮĮƢƢǢǢƢƢĮĮƢƢƢƢƢƢĮƢǢĮĮĮĮƢƢƢƢ͢ɮɮ͢ɮɮ͢͢͢͢͢͢͢͢͢ɮ͢ɮ͢͢͢͢͢͢ɮ͢͢͢͢ɮ͢ɮ͢ɮ͢͢͢ɮ͢͢ɮƢ͢Į͢͢͢͢͢͢͢ɮ͢͢ɮɮ͢殎殎殎ɮӢӢӢӢӢήӢӢƢӢӢӢήӢӢήӢӢӢӢӢӢӢήӢήήήƢӢӢӢӢӢӢӢӢӢӢӢӢӢήӢӢӢӢӢӢӢӢӢӢӢӢӢӢӢӢήήήӢ٢Ү٢٢Ү٢٢٢٢ҮҮ٢٢٢٢ڢ٢٢ޢ٢Ү٢ҮڢҮ٢٢٢٢٢ڢ٢٢٢ڢ٢ҮҮ٢殎٢ߢޢޢޢޢޢޢ֮ޢޢޢޢޢޢޢޢޢ٢ޢޢޢߢ֮֮ޢޢ֮ߢޢޢޢޢߢޢޢޢޢޢޢ֮֮⢎خ⢎⢎⢎⢎㢎㢎خ⢎㢎⢎⢎خ⢎⢎⢎⢎⢎⢎⢎⢎خ⢎梎㢎殎ڮ梎梎梎梎ڮ梎梎梎梎梎梎梎ۮ梎梎梎梎ܮ梎梎梎梎ۮ殎颎梎ܮ颎颎颎颎颎ܮܮ颎颎ݮ颎颎ܮݮܮݮޮޮ좎좎颎좎ޮ좎좎좎좎颎좎㢎좎좎좎ޮ좎좎ޮ좎ޮ殎எஎᮎ殎񢎵񢎶ᮎᮎ򢎭ڲٲ㸮ฮḮᾮ͢Ӣڢڢڢߢ㢎騢ꨢ訢稢殎ʭȭǭɭ鳮沢㲢Ტ쳮䲢޲ﳮﲢ߲𲢎벢ݲⲢ첢貢岢볮ಢ곮𳮎鲢۲粢겢ܲ渮丮⾮Ǣ㾮辮ǢǢǢǢǢĮĮĮǢǢǢǢǢǢǢǢ͢͢ĮĮ͢͢͢ɮ͢͢͢͢͢͢͢͢͢ɮ͢͢͢͢͢͢͢͢ɮ͢ɮ͢͢ɮ͢͢͢͢͢ɮ͢ɮ殎ǢӢԢӢӢӢӢӢӢӢӢԢӢӢӢӢԢӢӢԢԢԢӢ͢ӢӢԢӢήӢԢӢڢӢԢήڢڢڢڢڢڢҮҮҮڢڢڢڢڢڢڢڢڢҮڢڢڢڢҮڢڢ殎殎ߢߢߢߢߢߢ֮ߢߢߢߢߢߢߢߢߢߢߢ֮ߢߢߢߢ֮ߢߢߢ֮֮㢎㢎ۮخ㢎㢎㢎خ㢎㢎㢎ߢ㢎Ӣ㢎㢎㢎㢎㢎㢎㢎خ㢎㢎㢎خخ㢎㢎殎梎梎ۮ梎梎ۮ梎梎㢎梎梎梎ۮ梎梎梎梎梎خۮ颎颎ݮ颎颎颎ݮ颎ޮ좎좎좎좎좎߮좎좎எ殎˭񲢎򲢎긮꾮龮좎̭񳮎殎ĮԢήҮҮͭϭέ󲢎򳮎󳮎殎򸮎Źǹƹ츮¹븮󸮎ù︮񸮎𸮎Ĺ𾮎򾮎ᆴǢǢǢǢĮǢǢǢǢǢĮή͢ɮɮ΢΢ɮ΢΢͢΢ɮ΢͢΢΢΢΢ɮɮɮԢԢԢԢԢԢήԢԢԢԢԢԢήڢڢڢڢҮڢڢڢڢڢڢڢڢڢߢߢߢ֮ߢߢ֮֮ߢߢ֮㢎خ㢎خ㢎㢎خخ㢎㢎㢎ߢ㢎殎梎梎梎梎梎梎梎梎梎颎ݮ颎ݮ좎좎좎좎ᮎ񢎸񢎺񢎹ᮎ𢢎ȹ殎Ǣۮ梎எᮎǢ΢΢΢΢ԢԢԢήҮή֮ߢߢߢخخٮۮ碎梎颎ݮޮЭ˹ɹʹǢǢǢǢǢǢǢǢĮ΢΢ɮ΢ԢԢήԢڢߢߢۮ碎颎좎ѭҭϹ͹ι㮎̹ǢǢĮĮĮĮĮǢǢǢǢĮǢĮĮǢĮǢǢǢǢǢĮ΢ɮ΢ɮ΢ɮ΢΢ɮɮɮɮɮɮ΢ɮήήήήήήԢԢԢԢԢԢήԢԢԢڢήήήԢήԢԢԢԢԢԢԢڢڢڢڢڢڢҮڢҮڢήҮҮڢڢڢڢڢҮڢҮڢ殎ߢߢߢߢ֮ߢ֮ߢߢߢߢߢڢߢߢߢߢߢߢ֮ߢ㢎㢎㢎㢎㢎ٮ㢎ٮ㢎㢎㢎㢎ٮ㢎ٮ㢎㢎㢎ٮ㢎㢎㢎㢎㢎ۮ碎碎ۮ좎㢎碎碎碎ۮݮ碎碎碎碎碎碎碎碎颎颎ݮݮ颎ݮꢎꢎ颎ݮ颎ꢎݮܮ䮎ޮ좎좎좎좎ޮ߮߮எஎஎஎᮎ񢎽񢎴ᮎᮎ񢎶йѹǢ΢Ԣ֮㢎碎߮ǢǢԢߢݮ殎⮎먢ҹӹĮǢǢǢɮ΢΢ߢߢߢߢٮ㢎碎碎ԹǢǢǢ㮎ĮήԢڢڢڢߢߢ֮㢎㢎㢎碎ᮎչĮǢĮ΢ɮɮ΢ɮ΢殎ԢԢήԢԢԢԢԢήϮڢҮڢڢҮڢڢ֮֮ߢ㢎㢎㢎ٮ㢎碎碎碎ۮ殎䮎좎ޮޮ좎殎எᮎǢǢڢڢߢӭع׹ֹǢǢǢǢǢǢǢǢǢ΢ɮɮɮԢԢϮԢԢϮϮڢҮڢٮ碎碎碎碎ꢎ좎殎۹ٹܹݹڹǢǢǢǢǢǢǢǢĮǢǢǢǢǢ΢΢΢΢ɮ΢΢΢΢΢΢ɮ΢΢ɮ΢ԢԢԢԢԢԢԢԢԢԢԢԢԢԢԢԢԢԢϮϮԢڢҮڢڢڢҮڢڢڢڢڢڢҮڢ֮ߢߢߢߢ֮ߢߢ㢎㢎㢎ٮ㢎㢎㢎㢎㢎㢎㢎㢎㢎㢎ۮ㢎碎ۮ碎碎ۮ碎ۮۮ碎碎ݮꢎꢎꢎ좎좎எ𢎩ᮎ񢎿񢎾ᮎ񢎻ĮɮɮϮϮϮϮ殎ڢٮٮ碎ۮݮ殎⹢޹ǹṢ๢߹㹢乢ſǿĿƿɿǢǢǢȢĮǢǢȢȢȢ΢΢΢΢ԢԢԢϮԢԢϮԢԢϮϮԢӮڢӮӮڢڢڢڢڢڢӮ֮ߢ֮ߢ㢎㢎㢎ٮ㢎碎碎碎碎碎ꢎꢎꢎꢎꢎꢎ좎ޮ좎좎⮎˿ĮĮʮʮϮӮӮ殎ٮϮ碎򪮎𪮎諸쨢񨢎𨢎򨢎󪮎񪮎׭խԭ֭湢鹢˹繢ʹι蹢깢幢̹ϿпͿ̿ѿտֿԿ׿ȢȢĮĮȢĮĮĮȢĮȢʮʮʮԢϮԢԢԢϮԢڢڢڢߢߢۢٮꢎޢݢ򢢎󢢎񢢎殎ѹ󨢎٭ݭڭܭޭୢ߭񹢎ۭ칢򹢎󹢎Ϲ빢ح﹢𹢎㮎ҹۢٿȢŮȢȢȢȢȢŮȢŮȢ΢΢΢΢΢΢΢΢΢΢ʮբ㢎ԢբԢբԢբۢۢۢӮߢ㢎㢎ٮٮ㢎碎碎ꢎꢎ좎좎좎óij³չԹ殎Ů¢ŮȢȢ΢΢ʮ΢΢ʮʮբբբբբբϮբϮۢӮۢۢۢۢӮӮߢߢߢߢߢߢߢߢ㢎㢎㢎ٮ㢎碎㢎碎ꢎꢎꢎꢎ좎ޮஎᮎ⭢᭢ųdzƳع׹ֹٹݿ濮࿮迮鿮⿮忮޿殎㿮殎ϢȢŮȢȢȢȢŮȢȢŮŮŮŮȢȢȢȢȢȢȢȢȢȢŮȢŮŮŮȢŮȢȢŮȢȢȢȢŮŮȢȢŮȢȢȢ殎΢΢΢΢΢΢ʮ΢Ȣʮ΢΢΢ʮ΢Ϣ΢΢΢Ůʮʮ΢΢΢΢΢΢΢ʮ΢΢΢΢΢΢΢΢΢΢΢ʮʮ箎ʮբբբϮϮϮϮբբբբբբբբۢբբբբբբբϮբϮբբբϮϮϮբբբբբϮϮբբբբϮϮ΢բբϮ殎殎ʮۢۢۢۢӮۢۢۢۢۢӮӮۢӮۢۢӮۢۢۢۢۢۢۢۢۢӮۢӮۢۢۢۢۢբۢۢۢӮۢӮӮӮۢۢۢۢۢ殎殎Ӯۢߢ֮ࢎࢎࢎࢎࢎࢎࢎ֮ࢎߢࢎࢎࢎࢎ֮ࢎ֮ࢎࢎ֮ࢎߢ֮ࢎ֮֮ࢎ֮ࢎ֮ࢎ֮֮֮ࢎࢎ֮ࢎۢࢎࢎ֮֮䢎ߢ殎䢎䢎ٮ㢎䢎䢎ࢎٮ䢎䢎ٮ䢎䢎䢎ٮ䢎䢎䢎ٮߢ䢎䢎碎䢎䢎䢎碎䢎ٮߢ䢎䢎䢎㢎䢎ٮٮ殎殎殎碎ۮ碎碎ۮۮ碎碎ۮ碎碎碎碎碎ۮ碎碎碎碎ۮ碎ۮ碎ۮ碎碎ۮۮۮ碎ۮ碎殎殎殎ݮޮꢎꢎꢎꢎ碎ꢎꢎꢎꢎꢎꢎݮݮݮꢎꢎݮꢎꢎꢎꢎꢎꢎꢎꢎꢎꢎꢎꢎꢎꢎݮꢎݮݮݮݮݮꢎ殎殎殎ݮꢎ좎좎좎ޮ좎좎좎좎좎좎ꢎ좎좎좎߮߮߮߮߮எ䮎எஎஎஎஎஎ殎殎𢎢ᮎ񢎬񢎫񢎵ᮎ⮎򢎱򢎯򢎷򢎶⮎㮎բ碎ܹ쿮殎ŮŮȢȢȢȢʮʮբբբϮբϮϮۢۢࢎӮۢۢۢۢۢۢࢎӮӮࢎ֮ࢎࢎࢎۢ殎䢎䢎䢎ٮٮ碎碎ۮꢎꢎꢎ좎좎좎殎á顢筢譢䭢孢止㭢޹ȳɳṮ幮񿮎򿮎󿮎𿮎ŮȢȢȢŮȢʮϢʮʮϢբϮբϮۢӮࢎ֮ࢎ֮ࢎ֮䢎ݮӮ㮎ʳȢʮʮբۢ䢎䢎䢎䢎䢎碎ޮ𢎥ᮎ⮎ŮȢȢȢŮȢϢբբբϮۢӮۢۢӮӮӮࢎࢎ֮֮ࢎࢎࢎ䢎䢎䢎碎碎碎碎碎ꢎꢎݮݮݮ좎ޮޮ좎殎߮߮எᮎ殎⮎ŮϢʮբٮʮޮȢȢȢȢŮϢϢϢϢϢϢϢϢϢϢϮբϮբϮբӮۢۢۢࢎ֮ࢎࢎࢎ֮ࢎ䢎䢎䢎䢎ٮ䢎䢎䢎䢎ۮۮ碎ۮۮ碎碎ݮꢎݮꢎޮޮ좎߮𢎨ᮎ⮎ϢϢբբӮࢎࢎ䢎䢎䢎䢎ٮ碎碎碎좎ޮᮎŮϮۢࢎۮŮۢ䢎ݮꢎꢎŮȢȢȢʮʮϢʮʮբբբϮբϮ㮎բբբբϮӮۢӮۢӮҮۢӮӮӮӮٮ׮ࢎ㮎ࢎࢎࢎ׮ޢࢎࢎٮ䢎䢎䢎ٮٮۮ碎碎碎碎ꢎꢎ䮎ꢎꢎ좎ޮޮஎஎஎȢϢϢբӮ׮䢎ٮ碎碎碎碎좎ꢎꢎݮ좎ޮޮ좎ޮ񢎥⮎ޮ⮎繮˳殎蹮ŮŮŮŮȢŮʮȢբŮϢʮϢʮϢբ殎բբբբբϮӮӮۢӮӮӮۢࢎۢۢࢎࢎࢎࢎࢎࢎࢎࢎࢎٮٮٮ䢎ٮ䢎ٮ䢎殎碎ۮ碎碎ꢎꢎݮꢎޮꢎꢎ좎좎ꢎ߮ᮎࢎŮϢϢۢӮࢎ׮ࢎٮ碎碎߮எȢȢȢȢʮʮʮϢϢϢʮϢʮʮʮϢϢʮϢϮբϮբբբբբբբբբբϮբϮϮӮۢۢۢӮۢӮۢۢӮۢۢӮۢ׮ࢎ׮ࢎࢎࢎࢎࢎࢎࢎࢎࢎ׮ࢎࢎ䢎䢎䢎䢎ٮ䢎䢎䢎ٮ䢎䢎ٮ䢎袎袎ۮۮ袎袎袎袎袎ۮ袎ۮ袎袎袎袎ۮ袎ꢎꢎꢎꢎꢎݮꢎꢎꢎꢎꢎ좎좎߮߮좎좎좎좎좎좎߮எஎᮎᮎ򢎸򢎥򢎳򢎲ȢȢϢբۢϮϮۢۢ׮ࢎۢ䢎袎ݮꢎꢎݮݮꢎ좎߮𢎯ᮎ㮎ʮ䢎߮எ̳ŮϢʮʮϢʮʮʮբբ֢֢բϮӮۢۢӮۢۢࢎࢎࢎ׮ࢎ׮䢎䢎ٮ䢎ۮ袎袎袎袎ꢎꢎꢎ߮좎좎좎좎殎ᮎʮ䢎ݮᮎ䮎ͳ⮎ۢ׮䢎袎ݮ좎ŮϢϢʮ֢֢ࢎ׮䢎䢎䢎ݮ좎߮ᮎ𢎣ȢŮϢϢϢϮ֢֢֢֢ϮϮ֢֢֢Ϯ֢֢֢ܢܢܢܢܢܢܢӮӮܢࢎܢܢԮӮԮԮӮܢܢܢӮܢ殎׮ࢎࢎ׮ࢎ׮ᢎࢎᢎ׮ࢎࢎࢎࢎᢎ䢎䢎䢎䢎ٮ䢎䢎䢎ٮ䢎䢎ۮ䢎䢎ٮٮ׮ٮ䢎袎袎袎袎袎袎袎ۮ袎袎袎ۮ袎袎袎ۮ袎袎袎ۮ袎ݮꢎꢎݮݮݮݮݮݮݮݮꢎ뢎뢎ꢎ뢎ݮꢎݮ뢎ݮꢎ뢎ݮ뢎ݮ좎좎߮좎좎좎䮎좎좎좎좎߮எ߮எꢎஎஎஎஎᮎ𢎳ᮎᮎᮎᮎᮎ򢎼⮎ȢŮȢŮ¯ȢŮŮϢϢϢ֢Ю֢֢֢֢֢Ю֢֢ЮЮ֢֢֢֢ԮЮЮԮܢԮܢԮܢܢܢԮܢܢܢܢԮܢԮܢԮܢԮᢎᢎᢎᢎᢎᢎ׮ᢎᢎᢎ׮ᢎᢎᢎᢎᢎᢎ׮ᢎ殎䢎䢎墎ٮٮ䢎ٮ墎䢎墎ٮ墎墎墎墎墎䢎䢎ڮ墎ٮۮᢎ袎袎袎ܮܮ袎袎袎袎袎袎ܮ袎袎袎ۮ袎袎ܮ袎袎袎袎ܮ袎袎袎袎袎袎袎袎뢎ܮ뢎뢎ݮ뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎뢎ݮ뢎뢎뢎뢎뢎߮߮좎߮뢎߮எ𢎵ᮎᮎ񢎧򢎩⮎򢎰⮎⮎߮ȢŮ֢ЮԮܢܢܢᢎᢎ墎ᢎ墎ڮ袎袎ܮޮ뢎뢎뢎߮񢎱⮎⮎򢎧ǥϢЮЮԮܢܢ׮ᢎڮڮˮ袎ޮ𢎧깮ԮԮᢎڮ𢎩빮֢ܢܢԮᢎ墎ܮ뢎뢎뢎뢎எ𢎧ܢᢎ袎Ȣ򧮎ᢎ墎墎ڮܮܮ߮ᮎ֢֢ܢŮ墎ܮᮎᢎᢎᢎ墎ڮڮ墎墎墎墎袎뢎뢎𢎫𢎪எܢ袎袎ᮎ񢎩墎袎𣮎Ԯᢎ墎袎袎袎뢎ޮ뢎뢎뢎뢎߮𢎲𢎰𢎯𢎡񢎳⮎׮뢎எ⮎ޮᢎ߮ᮎᮎġšȡɡ̡͡Сѡԡաء١ܡݡޡߡâ¢ߢ¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ¡ޢá@^0@πnasmdylink.0"``` ``envcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenv __table_baseenvmemoryenv__indirect_function_tablep __wasm_call_ctors Pg_magic_funcpg_finfo_gb18030_to_utf8pg_finfo_utf8_to_gb18030gb18030_to_utf8utf8_to_gb18030 __wasm_apply_data_relocs #    "#Aj#A@k6#Aj#Aj6 # #A8j #AqrAr AM@ AtAqrAr AM@ AtAqrAr AM@ AtA001{2:334w56667s8299:o;.<<=k>*??@gA&BBCcD"EEF_GHHI[JKKLWMNNOSPQQROSTTUKV WWXGYZZ[C\]]^C_M_S_]_g__?`g``caa5bbcccLddDeNeXebeleveeeeeeeeeeeeeef ff f*f4f>fHfRf\fffpfzffffffffffffffggg$g.g8gBgLgVg`gjgtg~gggggggggggggh hhh(h2hkHkRk\kfkpkzkkkkkkkkkkkkkklll$l.l8lBlLlVl`ljltl~lllllllllllllm mmm(m2mwHwRw\wfwpwzwwwwwwwwwwwwwwxxx"x,x6x@xJxTx^xhxrx|xxxxxxxxxxxxxxyyy#y-y7yAyKyUy_yiysy}yyyyyyyyyyyyyy zzz'z1z;zEzOzYzczmzvzzzzzzzzzzzzzz{ {{ {*{4{>{H{R{\{f{p{z{{{{{{{{{{{{{{|||"|(|2|<|F|P|Z|d|n|x||||||||||||||}}}"},}6}@}J}T}^}h}r}|}}}}}}}}}}}}}}~ ~~~)~3~=~G~Q~[~e~o~y~~~~~~~~~~~~~~ !+5?IS]gq{PPPP00102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020¡30405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040@A50607080900010203040506070B8090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦ90ҦӦԦզ֦צئ001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080ѧҧӧԧէ֧ا٧ڧۧܧݧާߧ90ק^]]???  ?  ?  ?  > ~ >~>~>~>~>~>~>~&f&f&f&fP0p0p$d$]UU U !U!!!"U"""#U###$U$$$%U%%%&U&&&'U'''(U((()U)))*U***+U+++,U,,,-U---.U.../U///0U0001U1112U2223U3334U4445U5556U6667U7778U8889U999:U:::;U;;;<U<<<=U===>U>>>?U???@U@@@AUAAABUBBBCUCCCDUDDDEUEEEFUFFFGUGGGHUHHHIUIIIJUJJJKUKKKLULLLMUMMMNUNNNOUOOOPUPPPQUQQQRURRRSUSSSTUTTTUUUUUVUVVVWUWWWXUXXXYUYYYZUZZZ[U[[[\U\\\]U]]]^U^^^_U___`U```aUaaabUbbbcUcccdUdddeUeeefUfffgUggghUhhhiUiiijUjjjkUkkklUlllmUmmmnUnnnoUooopUpppqUqqqrUrrrsUssstUtttuUuuuvUvvvwUwwwxUxxxyUyyyy:zzzzz${d{{{$|d||\2636CD46566676869606162636E4656667686960616263646F566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686G960616H26364656667686960616263646566676869606162636Y465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636IJKL4656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636ʡ465666768696ǡ06ơ162636M46566676̡8696ءޡNϡ0616O26Ρ36ġšɡȡҡ4656ӡ6676869606ߡáˡ1626364656ס66768696061626364656֡667686ա9606162636P46566676869606162636465666١ԡ7686ܡݡQR960616263646ڡۡ56667686960616263646566676869606162636465666768696061626364656667686960616263646ѡ5666768696061626364656͡66768696061626364656667686960616263646566676869606S16263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626С364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960616263646566676869606162636465666768696061626364656667686960717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757٢ڢۢܢݢޢߢ67778797071727374757ŢƢǢȢɢʢˢ̢͢΢ϢТѢҢӢԢբ֢עآ¢âĢ67778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757©éĩũƩǩȩɩʩ˩̩ͩΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩ67778797TUVWXYZ[\]^_`abcdefghijklmnopqrstuvw07172737475767778797071727xyz{|}~374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787970717273747576777879707172737475767778797071727374757677787P9808T182838W4858X]68788898091929394959^697989990919293949596979899909k1929n394959q69798999s0919tu293949y596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969e79899909192939@ABCDEFGH49596979899909192939495969798999091929394959¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ69798999091929abfg3949¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥ5969798999`cd091929394959ŨƨǨȨɨʨ˨̨ͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨިߨ69798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989Z9909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919I293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959JK697989990919293949596979LMN8999O09192939495969798999091929394959697989990919293949596979899909192939P495969798999091929Q3949RS5969T7989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990919293949596979899909192939495969798999V09192939495969798999091929394959697989990919293949596979899909192939495969798999091929U39495969798999091929394959697989990919293949596979899909192939495969798999091929394959697989990010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000Z102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010\2030405060708090001020[`80900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020_304050607080900010203040506070809000102030405060708090001020304050607080900111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181be9101112131415161718191011121c314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191d0111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171h8191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141i5161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171jo324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262pr8292021222324252627282920212223242526272829202122232425262728292021222324252627282920212223242526272829202122232425262728292031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333x43536373w83930313233343536373839303132333435363738393031323334353637383930313233343536373839303z1323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383{}2333435363738393031323334353637383930313|233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637383930313233343536373839303132333435363738393031323334353637394041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940414243444546474849404142434445464748494041424344454647484940515253545556575859505152535455565758595051525354555657585950515253545556575859505152535455565758595051525354555657585950515253545556575859505152535455565758595051525354555657585950515253545556575859505152535455565758595051525354555657585950515253545556575859505152535455565758595051525@ABCDEFԴGHIJKLMNOPQRSپTUVWþXYZ[Թ\˳]^ž_`abcdefghijklmnopqrstuvwxyz{|}~Ӵֲۼݷ·ÁāŁƁǁȁɁʁˁ́́΁ρЁсҁӁԁՁ͵ցׁκ؁فځہ܁݁ށ߁۰Ѽ޳@ĽABCDEFGHIJKLMNOPQRSٴTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ټ‚ÂĂłƂǂȂɂʂ˂̂͂΂ςЂт҂ӂԂՂւׂ؂قڂۂ܂݂ނ߂ߴ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~˿ҶƒÃăŃƃǃȃɃʃ˰˃̃ع߾̓΃σЃу҃ӃԸԃՃփ׃؃كڃۃ܃݃ރ߃ڹմ@ABCDEFGHIJKLMNO˻PQʵRSTUVַWXYZ[\]^ո_`abcdefghiιjklmn̴̿opqrstuvwxyйz{|}~˽Ӽٽ„ÄĄńƄDŽȄɄʄ˄̄̈́΄τЄф҄ӄԄՄքׄ؄لڄۄ܄݄ބ߄Ҵ@ABCD׳EFGHIJKLMN˷OPQRSTUVWXYZ[\]^_`aܻbcdefghijklmnopqrstuvwxyz{|}~޲ǾβڿŹнȰɿźԳϺͷ…ÅąɰֶԷŅԿƅDžȅɅʅ˅̅ͅ΅υЅхʳ҅ӅԅՅօׅ؅مڅۅ܅݅ޅ߅Ǻ׾ͺ̾@ABCDȿEFGHIJKLM߶NOPQRSTUVWXY޿Z[\]^_`abcߺdefghijklmnopqrstuvwxyz{|}~пȷȺ†ÆĆņƆdžȆɆʆˆ̆͆ΆφІц҆ӆԆՆֆ׆؆نچۆ܆݆ކ߆@AμBCD¸EFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdٺefghijklmnopqrstuvwxyz{|}~‡ÇćŇƇLJȇɇʇˇ͇̇·χЇч҇ӇԇՇևׇ؇هڇۇ܇݇އ߇ػڶѴ̹@ABCDEFGHIJKLMNOPQRSصTUVWXYZ[\]^_`abcdeӿfghijklӰطmnopqrstuvwxyz{|}~ѿdzˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈш҈ӈԈѶՈֈ׈؈وڈۈ܈݈ވ߈̵¶@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~նڱ‰ÉĉʼnƉljȉɉʉˉ͉̉ΉωЉщ҉ӉǿԉՉ։׉؉ىډۉ܉݉މ߉м@ABCDEFGܷHIJKLMNOPQRSTU°VWXYZ[\]^_`abcdefgúhijklmnopqrʶ˼stuvwxyz{|}~ùŠÊĊŊƊNJȊɊʊˊ̊͊ΊϊЊъҊӊԊՊ֊׊؊يڊۊ܊݊ފߊ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~޼յ‹ËċŋƋNjȋɋʋˋ̋͋΋ϋЋыҋӋԋՋ֋׋؋ًڋۋ܋݋ދߋ@ABCDEFGH׿IJKL¹MNOPQRSTUVWXYZ[\]^_`abcdefٹgͿ»hijklmnopҼqrstuvżwļܿxyz{|}~ѹԶ;߳־ŒӾÌČŌƌnjȌɌʌˌ̌͌ΌόЌьҌӌԌՌ֌׌،ٌڌی܌݌ތߌڸ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~޴ÍčōƍǍȍɍʍˍ͍̍΍ύЍэҍӍԍՍ֍׍؍ٍڍۍ܍ݍލߍ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{޾|}~Ͱұ۵ϻŽÎĎŎƎǎȎɎʎˎ͎̎ΎώЎюҎӎɸԎՎ֎û׎؎َڎێӱ܎ݎގߎ׵Ϸȶ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnױopqrstuvwڳxyzܵ{|}~ʲ˱ܺõÏďŏƏǏȏɏʏˏ̏͏ΏϏЏяҏӏԏՏ֏µ׏؏ُڏջۏ܏ݏޏߏرɼ޷@ABCDEFGHIJKLMNֹOPQRSTUVWXYZ[\]^_`abcdefлghֿijklmnopqrstֻuv޺wxyҿz{|}~ڻ¼ݻҲͳѲ߹̻ÐĐŐƐǐȐɐʐː̐͐ΐϐАѐҐӐԐՐ֐אِؐڐېܐݐސиߐ߷@ȴABŻCDEFGHIJKLMNOPQRSTUVWۻXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ð‘ÑđőƑǑȑɑʑˑ̑͑ΑϑБёґӑԑՑ֑בّؑڑۑܑݑޑߑɳؽŲ@AǰBCDEFGHIJKLMۿNOPQRSTUVWXYгZ[\]^_`Ѱabcdefghijkٿlmnopqrstuvwֵxyz{|}~չܾΰоݰֳҹӻư’ÒĒŒƒǒȒɒʒ˒̒͒ΒϒВђݾҒӒԒՒ֒גݽْؒڒےܒݒޒߒ޶ӽؿ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ҽ]^_`abcdefghijklmnopqrstuvwxyz{|}~ڰݴ“ÓēœƓǓȓɓʓ˓͓̓ΓųϓГѓғӓԓՓ֓דؓٓړۓܓݓޓߓٲ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ĸŷʹеȾֱ̽Ҹض”ÔĔŔƔǔȔɔ߰ʔ˔͔̔ΔϔДєҔӔԔՔ֔הؔ϶ٔڔ۔ܔݔޔߔȼɾ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrλstuvwxyz{|}~޻•ÕĕŕƕǕȕɕʕ˕͕̕ΕϕЕѕҕӕԕՕ֕וٕؕڕەܕݕޕߕܲ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdef˸ghijIJklmnopqrŶsܸtuvwxyz{ܽ|}~ݿܼϼذ̸–Ö¿ĖŖƖǖȖɖʖ˖̖͖ΖϖЖіҖӖԖՖ֖זٖؖږۖܖݖޖߖ˺۽@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ÿ׹—×ėŗƗǗȗɗʗ˗̗͗ΗϗЗїҗӗԗ՗֗חؗٗڗۗܗݗޗߗ@ABCDEFGHIJKLMNOPQRSTUVŸWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~۲˜ØĘŘƘǘȘɘʘ˘̘͘ΘϘИјҘӘԘ՘֘טؘ٘ژۘܘݘޘߘȳ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~™ÙęřƙǙșəʙ˙̙͙ΙϙЙљҙәԙՙ֙יؙٙڙۙܙݙޙߙδ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg˴hijklmnopqrstuvwx߼yz{|}~вζٻȱϱѱбšÚĚŚƚǚȚɚʚ˚͚̚ΚϚКњҚӚԚ՚֚ךؚٚښۚܚݚշޚߚ@AسBCDEFGHIJKLMNOPQRSڷTUVWXYZ[\]^_`abcdefgײhiھjkӺlmnoзpqrstuvwxyz{|}~ñü›ÛěśƛǛƺțɛʛ˛̛͛ΛϛЛћқӛԛ՛֛כ؛ٛڛۛܛݛޛߛӵԺ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrsɶtuvwxyz۸{|}ʿ~ȸœÜĜŜƜǜȜɜʜ˜̜͜ΜϜМќҜӜԜ՜֜ל؜ٜڜۜܜݜޜߜ@ABCεDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~γÝĝŝƝǝȝɝʝ˝̝͝ΝϝНѝҝӝԝ՝֝İם؝ٝڝ۝ܝݝޝߝ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ƵһľžÞĞӲŞƞǞȞɞʞ˞̞͞ΞϞОўҞӞԞ՞֞מ؞ٞڞ۞ܞݞޞߞ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghٷijklmnopqrstuvwxyz{|}~ͻŸßğşƟǟȟɟʟ˟̟͟ΟϟПџҟӟԟ՟֟ן؟ٟڟ۟ܟݟޟߟ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ְ àĠŠƠǠȠɠʠˠ̠͠ΠϠРѠҠӠԠՠ֠נؠ٠ڠ۠ܠݠޠߠҵѾ@ABݺƽCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc²defghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ϲ@AɴBCDEFGHIJKLMNOPQRSTUVWXYZ[ʸ\]^_`abcdef±g׼hijklmnopqrstuvwxyz{|}~@ABCDEFGHIξJKLM̰NOPQRSôTUVWҾXYZ[\]^_`abۺcdefghijklmnopqrճstuvԱwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkǵlװٰmnopĵqԽʻrs޸tuvwxyz{|}~@ABCDкEFǸGHIJKLMNOPQRSTUVWXYZ[\]^_`ܶabcdefghijklmnopqrstuvwxyz{|}~@ABCDEFG޽DzHIJKLMNOPQRSöTUVWXYZ[\]^_`abcdefghijklmnopqrɵstuvwxyz{|}~@AؾBý̶CDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQṞSTUVWXYZ[\]^_`abcdŴefghijklmnopqĿrstuvwxyz{|}~ǻ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abc̺defgѸhijklmnƿopqrstuvwxyz{ӳ|}~Ƴս̳ް@ABCDEFGHIJKLMNOPQRSTUVWڼXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~տѽܴ߿@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxy߽z˶{|}~͸ʰʱѵڵ@ABCDEFGHIJKLMNOPQȵRSTUV߲WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ܹ@ABCDEFGHIJKLMNݸOPQRS۴TUVWXYZ[\]^_`abcdefghijklmnopشqrstuvwxyz{|}~ɻ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~۷ִ@ABCDEFGHIJKLMNOڲPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ͼٸ׷ķʽ̼´ж޵ɽ׸޹@ABCDEFհGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ե@ABCDEFGHIJKLMNOPQRSTUVWXYZ[ĺҰ\]^_`abcdefghijklmܳnopqrstuvwxyz{|}~۾ϴ@ABCDEFGHIJKLMNOǶظθPɹQʷRSTUϿVWXYZ[η\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ž@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~۱@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ʾ`ab˾cdefghijklmnopqrstuvwxyղz{|}~@ABCDEFGHIJKLڽMNOPQRSTUVWXYZ[\]^ҷŰ_`abcdefghijkԲlmnopqrstuvwxyz{|}~Ĵ@ABCDEFݲGHIJKĻLMNOPQԼRSTUVWXYZɺ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~վʺ˲@AƷBCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~д@ABCDٵEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}ͱ~@ABCDEFGHIJKLMNOPQRSTUVW̲XYZ[\]^_`abcdefghijαklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|ز}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVϲWXYZ[\]^_`abcdefghijklmnopqrstuƹvwxy׻z{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghȻijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghiֽjklmnopqrstijuvwxyz{|}~@ABCDEFGHIJKLMNOPòQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxӹyz{|}~ֺ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^۹_`ǽabcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ƼǼ÷ʴϳø̷οѻȹ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ѻ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOƲܰѷغּ߻ĶʹPQRSӸTUVWպXYZ[\ϸ]^_`abcdeófghijklmnopqrstuvwxyz{|}~ϰ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrȲstuvwxyz{|}~ıŵ׶@ABCDEFGHڴIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`aνbϽԻcdeǴٱfghijklmnopqrstuvw߱xyz{|}~ٳϵűݵ@AѳBCDEFGHIJKLMNOPQRƱSTUݶVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}ܱ~˵@ABCDEFGHIJKLMNºOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{ɱ|}~@ABCƾDEFGHIӷJKLMNOPQRSͽTUVWXYZ[\]^״_`abcdefghijklmnopqrstuvwxyz{|}~ɲ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ƹ۶ָؼ½@AͶBƶCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ձ]Һ^_`abӶcdefghijklmno׽pqrstuvʼ³wxyz{|}~ݱ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcde͹fghƴijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQR԰STUVWXYZ[\]^_`abcdefghijklmnopǷqrstuvwxyz{|}~а@AϾBCDEFGHIJKޱLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~¾@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDE˹ٶռFGHIſJߵKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyɷz{|}~@ABCDEFͲGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ƚݹ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQ۳RԾݼSTҳUVWXYZǹ[\]^_`abcdefghijklmnopqrstuvwxyz߸{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmno׺pqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSƻTUVWXYZ[ں\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ĺ@ABCDEFDZGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ݳªêĪŪƪǪȪɪʪ˪̪ͪΪϪЪѪҪӪԪժ֪תت٪ڪ۪ܪݪުߪ«ëīūƫǫȫɫʫ˫̫ͫΫϫЫѫҫӫԫի֫׫ث٫ګ۫ܫݫޫ߫¬ìĬŬƬǬȬɬʬˬ̬ͬάϬЬѬҬӬԬլ֬׬ج٬ڬ۬ܬݬެ߬­íĭŭƭǭȭɭʭ˭̭ͭέϭЭѭҭӭԭխ֭׭ح٭ڭۭܭݭޭ߭®îĮŮƮǮȮɮʮˮ̮ͮήϮЮѮҮӮԮծ֮׮خٮڮۮܮݮޮ߮¯ïįůƯǯȯɯʯ˯̯ͯίϯЯѯүӯԯկ֯ׯدٯگۯܯݯޯ߯@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~96٦ڦۦܦݦަߦ§çħŧƧǧȧɧʧ˧̧ͧΧϧЧ06¨èĨX[]^_1626364656667686960616263646QRS5666768696Y06162636465666a76869606fg16263646lm5666768696061626v36465666768696~061626364656667686960616263646566676869606162636465666768696506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030405060708090001020304050607080900010203040506070809000102030@ABC40D50EF607080G900010203040HIJ50KL6070MNOU8191011121hijklmnopq31rstu41vwxyz{|}~516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣۣܣݣޣߣ516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131415161718191011121314151617181910111213141516171819101112131VW@@?_0909@рPasmdylink.0"`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_gbk_to_utf8pg_finfo_utf8_to_gbk gbk_to_utf8 utf8_to_gbk __wasm_apply_data_relocs  "#Aj#A@k6#Aj#Aj6 # #A8j #A{:w6s 2 o . k*g&c"_Y z9v 5!!"r#1$$%n&-''(j))**+f,%--.b/!001^2334Z5667V899:R;<<=N> ??@JA BBCFDEEFBGHHI>JJK{L:MMNwO6PPQsR2SSToU.VVWkX*YYZg[&\\]c^P5d K졧¡@AB¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئѧҧӧԧէ֧ا٧ڧۧܧݧާߧק)i)i$a3cC;{: z  G  C  C  C CCCCCCCCCCCCCCCCCC C !C!!!"C"""#C###$C$$$%C%%%&C&&&'C'''(C((()C)))*C***+C+++,C,,,-C---.C.../C///0C0001C1112C2223C3334C4445C5556C6667C7778C8889C999:C:::;C;;;C>>>?C???@C@@@ACAAABCBBBCCCCCDCDDDECEEEFCFFFGCGGGHCHHHICIIIJCJJJKCKKKLCLLLMCMMMNCNNNOCOOOPCPPPQCQQQRCRRRSCSSSTCTTTUCUUUVCVVVWCWWWXCXXXYCYYYZCZZZ[C[[[\C\i\\\\]G]]]^F^\CDEFGHYIJKLʡǡơM̡ءޡNϡOΡġšɡȡҡӡߡáˡס֡աP١ԡܡݡQRڡۡѡ͡SС٢ڢۢܢݢޢߢŢƢǢȢɢʢˢ̢͢΢ϢТѢҢӢԢբ֢עآ¢âĢ©éĩũƩǩȩɩʩ˩̩ͩΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~e@ABCDEFGH¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤabfg¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإ٥ڥۥܥݥޥߥ`cdŨƨǨȨɨʨ˨̨ͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨިߨZIJKLMNOPQRSTҡ@ABCϢػDEǧFԴ˩GHIJKɭLMNOPQRͤSپTUVWþXشYΧZ[Թ\˳]^žƲҰ_`abcdefghijklmnopqrstuvwxyz{|}~ԥή؃ѩЄͺຶĈϩٌٍؑҲ𳔁齕Ӵ˜ֲնϙتǜ؝ҞؠáѤإۼȩݷ·ƬҳοеغɰΫؽؾÁāŁƁǁȁˤɁʁˁ́́΁ρЁсҁӁԁՁ͵ցׁκ؁ءفځہ܁݁ށ߁۰Ѽづ灬ٮ聫ٹ끩ٶ޳@Ľ뿭ABCDEFGHIJKLMNOPQRSٴTUVWXYZ[\]^_`a٣ӹbcdef٩ghЩijklmnopqrstuvwxyz{|}~ٶق󾅂҈ى轋뾏ٻĐّ՜֝Ǟ٢ټ٥٨٫Ʃٮײͳ‚ÂĂłƂǂȂɂŵʂ˂̂͂΂٥ςЂт҂ӂԂՂւׂ؂قڂۂ܂݂ނ߂٢ߴٵ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeٮfghijklmnopqrstuvwxyz{|}~قȈԳմ⹵˿÷ҶټƒÃăŃƃǃȃɃʃ˰˃̃ع߾̓΃σЃу҃ӃԸԃՃփ׃؃كڃۃâ܃݃ރ߃ڹუ⃩Ԥ٬탳סմ@ABCDEFGHIJKLMNO˻PQʵRSͼۯTԶUVַWXYZ[Ю\]^ո_`abcdefghiιjklmn֢˯Ȳ̴̿opqrstuvwذxyйz{|}~؃؄؆羊؛˽؝Ţةث찦Ӽν֬ٽۿ۷„ÄĄńƄDŽȄɄʄ˄̄̈́΄τЄф҄ӄԄՄքׄ؄لڄۄ܄݄ބ߄􄴹Ҵ@ABCدD׳EFGHIJKLMN˷OPQRSTUVWXYZ[ǽ\]^_`aܻbcde׿fghij屲߼ըرklmnoخáӣpqrstuvwxyz{|}~޲񺈅؊ԋ؍ώǾؓۚȞϡβ沰ӫ˴ʬЭŮڿŹߵ߻нȰɿ̳߷Ӵضź˾̵߶ӹԳ߻ϺϸϽ¹¾ͷ…ÅąɰֶԷŅԿƅDžγȅɅεʅ˅̅ͅ΅υЅхʳ҅渻ӅԅՅօׅ߽߾߻ſ߱؅مڅۅ܅݅ޅ߅߶Ǻ׾ͺ̾߾@ABCDȿEFGHIJKߧLM߶NOϥPQRߴSTUVW縶ɨXY޿Z[\]^_`abcߺdefghi˽jklmnopqrstuvwxyz{|߽}~߀߂ʨΧળߌߍߎп׏ɐߡߗߢࠆȷƶɲߦŨĩЯ̱ಆΫɳെ߸ๆໆ྆Ⱥ†ÆĆņƆdžȆɆʆˆ̆͆ΆφІц҆ӆԆՆֆ׆؆نچۆ܆݆ކ߆ㆾ䆲ꆵ@AμBCD¸EFGHIJKLMNOPQRSTUVWXYZ[\ְ]^_`abcdٺefghijklmnopqrstuvwxyz{|}~Ƭʄ̟ࢇϱ༇‡ÇćŇƇLJȇɇʇˇ͇̇·χЇч҇ӇԇՇևׇ؇هڇۇ܇݇އ߇ػڶ釰뇧Ѵ퇧̹@ABCDEFGHIJKLMNOPQRSصTUVWXYZۡ[\]^_`abcdeۮ̲ӿfghijklἳӰطmnopۺqrstuvwxyz{|}~ہۅۊⶑ۸ەѿۖۗ浘忙ۜ۝۠°dz۲۴۵۷۹Ӻ۽ˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈш҈ӈԈѶՈֈ׈؈وڈۈ܈݈ވ߈ሧ刦戩ܤ̵툰¶@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcd̫efghijklmnopqrstuvܬwxyz{|}~ɹąǮ܊Ѝնۧڱۮ۹‰ÉĉʼnƉljȉɉʉˉ͉̉ΉωЉщ҉ӉǿԉՉ։׉؉ىډۉ܉݉މ߉≸牴٦񉻹̫ѻм@ABC޼DEFGܷHIJKLޱMNOPQRSTU°VWXYZ[\]^_`abūcdefgúhijk׾lmnopqrʶ˼stѡuvwxyz{|}~恊Ĩ惊慊Ëƌ掊ĕʘùЯΜ枊ҟ栊楊Ҩ淊Ҹ׻ͼͦ«濽潊濊ŠÊĊŊƊNJȊɊʊˊ̊͊ΊϊЊъҊӊԊՊ֊׊؊يӴڊۊ܊݊ފߊ㊹ͻ@ABCDEFGHIJKLMNOӿPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~υ놋戋捋޼ɏϗ朋杋枋柋梋յ榋樋Ī櫋氋‹ËċŋƋNjȋɋʋˋ̋͋΋ϋЋыҋӋԋՋ֋׋؋ًڋۋ܋݋ދߋ@ABCDEFGH׿IעJKL澼¹MNOPQRSTUVWXYZ[\]˳^ʲ_`abcdefٹ֨ҦgͿʶ»hijϬklmnopҼqrstuvżwļܿxyz{|}~Àԁǯ첊ѹՏ唌啌Զ˰Ѽʞ⷟ɡפШɩ⼫ɭ梳޲޳Ҵ޸;޾߳ġ־ŒӾÌČŌƌnjȌɌʌˌ̌͌ΌόЌьҌӌԌՌ֌׌،ٌڌی܌݌ތߌҨ쌬ڸẵ@ABCDEFᶰGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~၍糃Ɖ޴яᓍᕍᚍᛍ៍ᤍᬍﴍǶÍčōƍǍȍɍʍˍ͍̍΍ύЍэҍӍԍՍ֍׍؍ٍڍۍ܍ݍލߍ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyѲz{޾|}~ۀͰσұʼ˫ʌϏ̓֯۵֜ﰡ࣎ᣳêîϻļŽÎĎᱴŎƎǎȎɎʎˎ͎̎ΎώЎюҎӎɸԎՎ֎û׎؎َڎێӱ܎ݎގߎЮ⿦׵㎮Ϸȶ펥ʵ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeѢfghijޥتƪklmnױopqrstuvwڳxyzܵ{|}~ϡ偏像̈́ȅnj协쐏埏鹱塏ҥШͩѪʲ뱬ŭհӯᰏ᳏Ҵ˱ḏܺ᲻ẏн;õÏďŏƏǏȏɏʏˏ̏͏ΏϏЏяҏӏԏՏ֏µ׏؏ُڏջۏ܏ݏޏߏرɼͦ޷@ABCDEFGHIJKLMNйֹOPQRSTUVWXYZ[ס\]^_`abcdefлghֿijklmnopqrstֻuv޺㲶̧wϡxyҿz{|Ģ}~ǂφ㷺㌐ڻ㎐㑐㒐ӓԗĘХ㚐Û㯱㝐¼㿵ǰ㪐ͭ󻲐̵㷐㸐Ϯ㹐ݻҲͳѲ߹Ϸ̻ÐĐŐƐǐȐɐʐː̐͐ΐϐАѐҐӐԐՐ֐אِؐڐېܐݐސиߐ߷ᐴ䐺@ȴABŻCDEFGHIJKLMNOPQRSTUVWۻXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~퇑㩺퐑㒑㜑Ъð㱑‘ÑđőƑǑȑɑʑˑ̑͑ΑϑБёґӑԑՑ֑בّؑڑۑܑݑޑߑΧȷɳƩ摪瑬葮ؽ푯쿷Ų@AǰBCDEFGHIJKLMۿNOǴPިѤ簶QRSTUVWXYгZ[\]^_`ѰabcdefʥgͶhijkٿlmnopŧqrstuvwֵxyz{޺|}~֣ĭށչܾΰоݰć𼉒ӹŦԊՌȩˎ޽Ƨװēֳҹ괰濜̞͢¥΢̮IJշӻ촩լꮒަʹͶ޺ͦ׽ư达’ÒĒŒƒǒȒɒʒ񼻻˒̒͒ΒϒВђݾҒӒԒՒ֒גݽْؒڒےܒݒޒߒ޶蒴̸ӽؿ֧@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ҽ]^_`abcdefgh鸧ijklmnopqrs괦tuvwxyz{|}~ށ̄勓А벒듓ޔڰ̗ޞ˟բާݴİ޳áġ߽“ÓēœƓǓȓɓʓ˓͓̓ΓųϓГѓғӓԓՓ֓דؓٓړۓܓݓޓߓǥ⓫瓢ߣ蓥铳쓦ٲߢ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~߃𾈔ߧ֊ʎĸŷՒʹеÝȾ뽰ֱ̽Ҹɨض봾ʱDzճ󷵔”ÔĔŔƔǔȔɔ߰ʔ˔͔̔ΔϔДєҔӔԔՔ֔הؔ϶ٔڔ۔ܔݔޔߔᔽ㔶甹·к씻ȼȩɾи굺@ABCDEFGHIJKLMNOPQRSTUοVWXYZ[\г]^_`abcdefghijklmnopqrλstuvwxyz{|}~́ꅕꆕΈ޻ưΏǒꓕ֕ԛ꜕ϞꢕʦŵꯕĽ•ÕĕŕƕǕȕɕʕ˕͕̕ΕϕЕѕҕӕԕՕ֕וٕؕڕەܕݕޕߕǷܲ@ABCDEFGHIJKLMNOPQRSTUVWΩľXYZ[\]^_`abcdԨef˸ghijIJklmnopqrŶsܸtuvwxѿyz{ܽ|}~耖脖尅芖͋茖ΐՔ蕖Ö藖Ԛ蛖蜖㷝螖ݿ蟖衖ܼϼ袖誖ذ̸ƾȵ踖׹ĺ軖鲽–Ö¿ĖŖƖǖȖɖʖ˖̖͖ΖϖЖіҖ걻谶ӖԖՖ֖זٖؖږۖܖݖޖߖ˺ͣ۽@ABC赵谽DEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwx̵yz{|}~켇舗ÎƏזř̞頗ɪÿ׹貗鶗ҹ龗ֵ׿—×ėŗƗǗȗɗʗ˗̗͗ΗϗЗїҗӗԗ՗֗חؗٗڗۗܗݗޗߗ㗪䗻旫@ABCDEFGHIJKLMNOPQRSTUVŸWXӴYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~郘鋘錘鍘鑘隘馘骘۲鵘˜ØĘŘƘǘȘɘʘ˘̘͘ΘϘИјҘӘԘ՘֘טؘ٘ژۘܘݘޘߘȳ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~邙ÙÙęřƙǙșəʙ˙̙͙ΙϙЙљҙәԙՙ֙יؙٙڙۙܙݙޙߙδУ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg˴hijklmnopqrstuvwx߼yz{|}~в遚酚և銚鏚闚ζҠٻ쨚ҪίİñȱϱѱųбõպšÚĚŚƚǚȚɚʚ˚͚̚ΚϚКњҚӚԚ՚֚ךؚٚښۚʵܚƭݚշޚߚᚱ⚳㚤ѱ暪皵蚮ͭ@AȯسBCDEFGHIJKLMNOPQRSڷTUVWXYZ[\]^_`abcdefgŤײh㦻iھjkӺlmnoзpqrstuvwȴxyz{|}㨷~ńŨƅĆ׈㉛㋛ӌñ㍛㎛ཐ䒛䔛ѣ䗛䘛țϟ 򽨛䩛麪䫛䭛ֲ䯛䰛䳛͢Ŵ䷛Ǭ丛ⲹü些뻰ű仛գ›ÛěśƛǛƺțɛʛ˛̛͛ΛϛЛћқӛԛ՛֛כ؛ٛڛۛܛݛޛߛᛳ⛸ӵȧլɢ𛭺ԺϿ@ABCDEFGHIJKL䭵MNOPQRSTUVWXYZ[\̵]^_`abcdefghijklmnopqrsɶtԳuvwxyz۸{|}ʿ~ӂÃ䋜䓜䗜ϙ՛䞜䩜䫜ͪʺ侜ȸœÜĜŜƜǜȜɜʜ˜̜͜ΜϜМќҜӜԜ՜֜ל؜ٜڜۜܜݜޜߜ@ABCεDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~䃝䆝·őǔ•䘝̱䤝䥝䨝䩝䪝γ䴝ŶÝĝŝƝǝȝɝʝ˝̝͝ΝϝНѝҝӝԝ՝֝İם؝ٝڝ۝ܝݝޝߝᝥ睡@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~办卞๟塞寞ûƵһľžÞĞӲŞƞǞȞɞʞ˞¶̞͞ΞϞОўҞȻӞԞ՞֞מ؞ٞڞ۞ܞݞޞߞ澿ż@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_Ѹ`abcdefgh캱ٷijklmnopqrstuvwxyz{|}~ȁ쏟쓟ͻ引좟ɣè쩟֮챟쵟춟ɸϾŸßğşƟǟȟɟʟ˟̟͟ΟϟПџҟӟԟ՟֟ן؟ٟڟ۟ܟݟޟߟ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~삠쌠׍Ŏ뮰ְؕ˖㗠氞Ź론률먠Ѫūꬠĭıβ궠ɸǺν àĠŠƠǠȠɠʠˠ̠͠ΠϠРѠҠӠԠՠ֠נؠ٠ڠ۠ܠݠޠߠ⠮㠸破ҵ񠷱Ѿ@ABݺƽCDEFGHIJϨKLMNOPQRSTUVWXYZ[\]^_`abc²defghij֨ìklmnopqrstuvwxyz{|}~K↪釪⋪⓪̞⟪@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmn緻opqrst磲uvwxyz{|}~ɀՂ穷烫犫玫֏瓫甫畫ఘ眫@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~臬般艬ȪɊ藬幙Ѩ螬@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~芭Ϲ𔭭𕭰갿Ȗ͗αꞭ@AɴBCDEFGHIJKLMNOPQRSTUVWXYZ[ʸ\]^_`abcdeӦf±g׼hijklmnopqrstuvwxyz{|}~۳Ѐƈ볓目@ABCDEFGHIξJKLM̰NOPQRSôTUVWҾXYZ[ָӷ\]^_`abۺcdefghijklmnopqrճstuvԱwxyz{|}~񌯍Τ񏯣ʑ̓񔯕񖯗թ񘯙Ț񝯫񞯟@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkǵlװٰmnopĵqԽʻrs޸tuvwxyz{|}~Ƒ񔰕ÞӠ@ABCDкEFǸGHIJKLMNOPQRSTUVWXĢYZ[\]^_`ܶabcdefghijklmnopqrstuvwxyz{|գ}~큱Â퇱̈щՌ퍱퐱혱@ABCˡDEFG޽DzHIJKLMNOPQRSöTUVأWXYZ[\]^_`abcdefghijklmnopqrɵstuvwxyz{|}~Հۏ񛲜Ҡ@AؾBý̶CDEFGHIJKLMί°NOPQRSTUƳVWXYZ׺[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ςȎ6Ś@ABCDE­FGHIJKLMNOPQṞSTUVWXYZ[\]^_`abcdŴefghijklmnopqĿrstuvwxyz{|}~Ą퇴팴퍴ǻ횴@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ρƂ쇵쏵억욵@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abӮc̺dнefgѸhijklmnƿopqrstuvwxyz{ӳ|}~Ƴսҋ໌ώ̳ɰ˖ް֟@ABCDEFGHIJKLMNOPQRSTUVWڼXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ъǶտ͏ǭՐ񑷺񒷓ǖ֙ѽܴΞ߿񟷠@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrs͵tuvwxy߽z˶{|}~󅸆͸ʰˎ󑸦Вʱ󔸕ѵ󛸜ڵ@ABCDEFGHIJKLMNOPQȵRSTֲUV߲WXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~󀹁˄󈹉ܹ󋹌ϑ󓹔󖹗󞹟@תABCDEFGHIJKLMNݸOPQRS۴TUVWXYZ[\]^_`abcdefghijklmnopشqrstuvwxyz{|}~􅺆ɻ􍺎@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~۷ƊִՋˎ֑෕ⴟ@ABCDEFGHIJKLMNOڲPQRSԷTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ˏːח@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~􀽁@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~􋿌@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ԶͼȳΡٸā׷ķţϤɸϯ֧ҭὫȄѭʽͮЅ̼稼бв´ɬ÷պº׻穼ж纻޵翸췊ɽ׸ȍ޹͟ر@·ABCDEFհGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ӇΉ᳌ґǙԵ@ABCDEFG²HIJKLMNO­PQR«S¼TUVWXYZ[ĺҰ\]^_`abcdefghijklmܳn¢o¢pqrstuvwxyz{ª|}~¸ƀ۾‚ƒ„…†‡ˆ‰Š‹ŒŽϴ‘’“”–—˜™š›œžŸ @òABCDEFGHIJKLMäNOǶظθPÿ릳ɹQʷRST缾U빰ϿVWXYZ[η\ղ]è^_`abócdefghijklmn÷opqúrs÷tuvwxìyz{|}¹~ÀفñŽÅÆÈÉÊËÌÍÎÏÐÑÒÓÕìØÙóÜÝÞßâƠ@ABCDEFGİHIJįKLMNOPQRSTUVWXYZ[\]^_`abcĹdefghijIJklmnopqrstuvw̤ĥxyz{|}~ĢŁăĄąĆćĈĉɊċČčĎďđĒē͡۱ӔĕҖėĘěĜĝĞğĠ@ABCDEFGHIJKLMNżOPQŰRSTūUVWXYZ[\]^_ʾ`ŧaŨҨbŪ˾cdefghijklmnopqŶrsŭtuvwŲxŽ㰰yűղzŶ涰ϴ{ŵ|}Ÿ~ŀŁłŃŹŅŧ͆źŻʼnŊżŌōŎŏŐőŒ˓ŽŕŖŗžřŚśŜŝŞşſ@ABCDƫEFGHƳIJƴܬKLڽMƹNOPQƷRɺܶSƻܢTUVWƼܽXYΥZ[\]潫^ƸܾҷŰܾܨ_Ƽ`aܿbcdƿefghijƭkԲlƷܦmnopqrstuƻvwxƽyƢz{|}~ƻƀ܁ƂƃƄƅׯöǩ܆Ƈ܈ƥ܉܊Ƌ܌܍Ǝܢ܏ƐƑƒƓƔƕƖƗƘĴƚƣܛܜܝ貞ܟܠ@ABCDEǣFݲGHIJKĻLMNOPQԼRܴSܫӡݣݥҤݦݧݩTUVWXYZɺ[\Ƕݱݴ]^_`abcǰdefghiǯjklܮmnopǷqrܯsǸtǬuvwxyz{ǹݳݭݪ|}~ǀǨݳݫ݁DzݨӺ݂ǻݧÃDŽݼ݅džLJ݈ǽNJվǍʺǏǐǑݒݓǿݔǕǖ˲ݗݤݘǙǚǾݛǜǝݞǟǠ@AƷBCDEFGHIJKLȽMNOPQRüƮSTUVWXYZ[\]^_`abȩӪcdefghijklmnopqrstuvwxyz{|}~ȀȁȂȃȄȅȆ݇ȈȉȊȋ֌ݍȎȏȐƑȭȓȔȕȖݗݘșȚдݜݝݞݟȠ@ABCDٵEFGHIɯJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}ͱ~ɀɁɂɃɄɶɻ݆ɇ݈݉ɊɋɌɍŎɏɐݑɒɓɔɕɖɗɘəɚɛɤޜɝɣޞɟɠ@ABCDEFGHIJKLMNOPQRʵSTUVW̲XYZ[\]^_`abcdefghijʾݢުαklmnoʬpqrsʦ޶tuvwxyz{|}~ʡހʁʥނʃʄʅʩކʇʈʉʊʨދʌʍʧގʏʐʑʒʓʔʕʖʭޗԘʙʚʛʳުޮޜʝʟʠ@AˡB˱CDEFGHI˲JKLMNOPQRST˦ѵUVWXYZ[˯\]^˰_˽`ab˴ʹcdefgh˸i˷jklmnop˻qrstuvwxyz{|ز}~˺ހ˺Ł˂˃˄˅ˆ˼އˈˉˊˋˌˍ̎ˏːˑ˪˓˔˕˖˗˘˙˚˛˜˝˞˟ˠ@ABCD̽EFGHI̿JKLMNOPQRST̢UVWXYZ[\]^_`abcdefgh̾ijklmnopqrstuvw̺xyz{|}~̮̀́̂̃̄̅̆̇̈̉̊̋򢻲°Œ̯̍̏̐̑̒Г̔̕Ӗ̛̗̘̜̝̞̟̠̽̚泰@ͱABͭCDEFGHI纳˺ϲJKLMNOPθQRSTU;VϲWXYZ[\Ѻ]^_`aͼbcͻd͹efghijklmnopqrstuƹvwxy׻z{|}~͇͈̀͂̓̈́͆͊͋Œ͎͏Ӑ͓͑͒궔ʕ͚͗͘͜͝͞͠Ω@ABCDίEFGHIJKLMNOPQRSTUVWXYZ[\]^ά_`aΫbcdefghȻijklmnopqrstuvwxyz{|}~΁΂΃΅ΆΣΉ΢΋ȍΎΏΐΑΓΔΥΖΗΘΙΚΛÜΝΞΟΠ@ABCDϧEFGHϫIϪJKLMNOϮPQϰRSTUVϡWXYϱZ[\]^ϯ_`abcdeϲfghiϴjklmϨnopqϳrstϵuvwxyz{|}~ϷЀρςσϸυφχوωϊϋόύϹϏϐϑϒϓϔϕϷȶϘϙϚϺϜϝϞϟϻ@ABCDEFGHIJKLMNOPQRSмTUнVWXЪYZ[Ь\]^_`abcdefghiֽjklmnopqrstijuvХwxyz{|}~ЀЁЬЅЇʼnЊЋЌл̍ЎЏАБВГД͕ЖЗИЙٛМНОПРл@ѮABCѤDEFGHIJKLMNOPòQRѰSTUVWXYZ[\ң]^_`abcdefghijklmnopqrstuvwxӹyz{|}~ртуфхֺшщъыэюяѐђѓȔѕіїљњћѽѝў@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ҁҁ΂Ҫ҃҅Ҳ҇҈҉ҊҋҌҍҎҏҐґҒғҔҕҖҗҘҙҚқҜҝҞҟҠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^۹_`ǽabcdefghijklmӡnopqӢrstӣuvwӲxyz{|}~ӀӁӂӃӄхӆӇӈӉӊًӌӍӎӏӐӑӒӓӔӕӖӗӘәӚӛӜӝӞӟӠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_Ԥ`abcdefghԺijklmnopqrstuvwxyz{|}~ԀԁԂԃԄԅԆԇԈԉԊԋԌԍԎԏԐԑԒԓԔԕԖԗԘԙԲ՚ԛԜԝԞԟԠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ՀՁՂՃՄՅՆՇՈՉՊՋՌՍՎՏՐՑՒՓՔՕՖ՗՘ՙ՚՛՜՝՞՟ՠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~րց֥փքօֆևֈ։֊֋֌֍֎֏֐֑֖֛֚֒֓֔֕֗֘֙֜֝֞֟֠@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_ׯ`abcdשefghijklmnopqrstuvwxyz{|}~׀ׁׂ׃ׅׄ׆ׇ׈׉׊׋׌׍׎׏אבגדהוזחטץƼȥڧȨƙ׵ҶǼײ仩ڪѫ›÷֬ڭ׶ʜשծʴگڝұڲڳʴګʵڶϳַڰڹҺøﲻڼڞӽξ廿ڵڵ̷οڭڸ̟ұѻڳڽڠڻХګ÷ھڴȹ@ABCDEFGHIJKLعMNOPQRSTUVWعXYZ[\]^_`aϿbcdefghijklmnopqrstuvwxyz{|}~؀ѺزÂ؃؄؅؆؇؈؊؋؍؎؏ؘؙؚؐؑؒؓؔؕؖؗ؛؜؝؞؟ؠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ـفقكلمنهوىيًٌٍَُِّْٕٖٜٟٓٔٗ٘ٙٚٛٝٞ٠@ABCDEFGHIJKLMNڴպOڱƲ̶ַܰᱺṡѷغּ߻ɳĶʹPQRڸSɮӸTUVWպXYZ[\ϸ]^_`abcdeófghijkڽlmnopqrstuvwxyz{|}~ڀڤȁڂڃڄڅچڇڈډڊڋڌڍ׿ڐڻںڕږھڙښڛϰŞڟڠ@ABCDEFGHIJKL۷MNOPQRSTUVWXY۽Z[\]^_ۤ`abcdefghijklmnopqrȲstuvwxyz{|}~ۀ̂ۃۿ帵̄ۅۆۇۈۊۋیۍێ۾ېۑےۓ۔ەۖۗۘۙۚıۜۿ۞ŵ䲟׶@ABCDEFGHڴIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijkɪlmnopqrstuvwxyz{|}~܀܁܂܃܄܅܆܇܈܉܊ܦ܌܍܎܏ܐܑܒܓܔܕܖܗܘܙܚܛܜܝܞܟܠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~݂݄݆݈݀݁݃݅݇݉݊݋݌ݍݎݏݐݑݒݓݔݕݖݗݘݙݚݛݜݝݞݟݠ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`޵aνbϽ騸鲱ԻcޡdԽϷդեмeǴٱfghޱijklmnopq޽rstuvw߱xyz{|ި}Ƹ~€ށނރބޭӅ嵷ވ޹Չԥάٳދ̌ϵƎʐޑޓޔűޖޗ޷טޙĚޛޡѷ޸ݵ޾͟庶@ߨAѳBCDEFGHIJKLMNOPQRƱSTUݶVWXYZ[\]^_`abcdefghijߣklmnopqrstuvwxyz{|}ܱ~߁߂߃߅߇߈߉ߊҋ˵ڎڏڐڑߒߓĔߕߗߘ߰ЙښӪǛڜߡߞߥ۟ߠ@AۤBCD༽EFGۦۣHIJKLMN۬ºOPQिRSTԿUVWXYZ[\໳]^_঵`abc༶defghijklmnopqrstuvwxyz{ɱ|}~ہ۵ۄۏېۗ۠@ABCƾDEFGHIӷJKԪLMNOPQRͥSͽ˪TUVWXYZ[\ἴ]^״_`abcdefgéhijklmnopqrstuvwxyz{|}~ɲʌְҿ᪸@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~դ谷Ƹ۶ĵָγؼ̬ǭØã½Ҩ֩ƞˮб淿г̶ջü¸@臨AͶBƶCDEFGﵾHIJKLMNOPQRS餳TUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\ձγâ]꧷Һ^_`a그bӶcdefghijklmno׽pqrstꢰuv꽸ʼ¤³w°ĵxyz{|}~ݱچ긶ԇŊڋڐϑӡžڟ@ABCDEFگGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdeѯ͹fghƴijklmnopqrstuvwxyz{|}ӧ~뢱΍ЫϐլÑė˞ϟ@ABCDEFGHIJKLMNOPQR԰STUVWXYZ[\]^_`abcdefghiǦjk츾lm첾nopǷq쿿rstuvwxyz{|}~саД찰ǜ@AϾBCDEFGHIJKޱLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Ȃ¾҈ɉ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEҥϳ˹ٶԭƱռFGҵHͥIſJߵKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvƭwxyɷz{|}~@ABCDEFͲGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~𢼘⹷Ҥʥ˙ȽĞݹ@AʸBCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQ¦ͱ۳R󵲿ԾݼS§TҳUVWXYZǹ[\]^_`abcdefghijklmnopqrstuvwxyz߸{|}~מ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ӁϏ@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSTUVWXYZ[į𦼰\Ż]^_`͸ab븽cdefghijklmno׺pqrstuvwxyz{|}~@ABCDEFGHIJKLMNOPQRSƻTUVWXYZ[ں\]^_`abcdefghijklmnopqrstuvwxyz{|}~؇Ĺ،܍ʓ@ABCDEFDZGHIJKLMNOPQRSTUVWƴXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ݳȻٗ@ABCDEFGHIJKLMNOUhijklmnopqrstuvwxyz{|}~硥£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣۣܣݣޣߣVW@@|@рasmdylink.0ܧ.``` ```` envcheck_encoding_conversion_argsenv LocalToUtfenv errstart_coldenverrcodeenverrmsgenv errfinishenvputsenv UtfToLocalenv__stack_pointerenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_func pg_finfo_iso8859_to_utf8 pg_finfo_utf8_to_iso8859 iso8859_to_utf8 utf8_to_iso8859__wasm_apply_data_relocs  #Aj#Aj6#Aj#Aܝj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A̟j6#Aj#Aj6#AĜj#Aj6#AȜj#Aܠj6#AМj#Aj6#AԜj#Aj6#Aܜj#Aj6#Aj#Aj6#Aj#A̢j6#Aj#Aj6#Aj#Aj6#Aj#Aܣj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Ḁj6#Aj#Aj6#Aj#Aj6#Aj#Aܦj6#Aj#Aj6#Aܝj#Aj6#Aj#A j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#A̟j#Aj6#Aj#A#j6#Aj#A(j6#Aܠj#A0j6#Aj#A5j6#Aj#A=j6#Aj#Aj6#Aj#Aj6#AТj#Aj6#Aj#Aj6#Aj#Aj6#Aܣj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AХj#AЁj6#Aj#AЉj6#Aj#Aj6#Aܦj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A̜j6#Aj#A؜j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aħj#Aj6#Aȧj#Aj6#A̧j#Aj6#AЧj#Aj6#Aԧj#Aj6#Aاj#Aj6 # #A8j #AC?@D'+_DGEP‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ حآأؤإئابةتثجحخدذرزسشصضطظعغفقكلمنهوىيًٌٍَُِّْSNILgU   NN Oˀ ?ˀ@ŀ``?ŀ< ?ŀ> p!p%@ŀ&ḻp)p-@ŀ₂/3@Ȁ 6:@р℄=s>;ـ@D@πH GK?׀  NN(N4N@NLNXNdNpNNNNNNNN|NNNNasmdylink.0@(```````envcheck_encoding_conversion_argsenvreport_invalid_encodingenvpg_utf_mblen_privateenvpg_utf8_islegalenvreport_untranslatable_charenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_iso8859_1_to_utf8pg_finfo_utf8_to_iso8859_1iso8859_1_to_utf8 utf8_to_iso8859_1  # #A8j #A=? @@AuBCCDDE{FIGHHIJOKLLMNUO#PPQR[S)TTUVaW/XXPHw6g79VNٙݚݥ4٬٘ݬܯO٪<13P:=245ݦ678ݩ9@ݯ?;>٫٪٭QRSTUVWXYZ[\]^_`abcdefghqrstuvwxyz{|}~ۑےۓەۖۗۘۙۚޢޣޤޥަިީުޫެޭޮޯްޱ޲޳޴޵޶޷޸޹޺޻޼޽޾޿TS2r+X>| @. i ( h  _ ?  < { 9w3s1q-m*g&b[ FA|8w4s[WD}:y4t1l)h' g $!d!!!"V"""#T###$N$$$ %K%%% &I&&&'?'~'''<(z(((5)u))),*l*** +`+++,T,,,-S---.I....=/}///=0{00071v11152t222.3n333+4j444*5h555!6`666 7`7778\8889M999 :I:::;C;;;;L>>> ?J??? @E@@@A;A{AAA4BsBBB-CfCCCDRDDDEPEEE FMFFFGDGGGHH^HHHI6IqIII$JcJJJ"KGKKKLDLLLL1MqMMM'NaNNNOROOO PJPPPP)QiQQQ"R\RRRSDSSSS'TgTTT U:UyUUUVQVlVVVWNWWWW'X`XXXYTYYYZTZZZ[T[[[\T\\\]T]]]^T^^^_T___`T```aTaaabTbbbcTcccdTdddeTeeefTfffgTggghThhhiTiiijTjjjkTkkklTlllmTmmmnTnnnoTooopTpppqTqqqrTrrrsTssstTtttuTuuuvTvvvwTwwwxTxxxyTyyyzTzzz{T{{{|T|||}T}}}~T~~~TTԀTԁTԂTԃTԄTԅS:>?@A56WXhݞݟݠY4iZ@ABCDEFGHI123456789:wxvyzc٤dٖ~T`;ٟٜٕٝٔUٓ=ّfQeRS|}ٛٙabwxyz{|}~ݑݒݓݔݕݖݗ]^_`abcdefghijklmnopqrstuvۭ۬ۢۮۤۯۦ۱ۥ۰ۧۼ۷۲۩۾۹۴ۨ۸۽۳۪ۺۿ۵۫ۻ۶qpsrٹutٷonkmlji_^ٽٻپ1238DEFGHIJKLM{BCݢݣݤݥݦݧݨݩݪݫݬݭݮݯݰݱݲݳݴݵݶݷݸݹݺݻݼݽݾݿ123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ޑޒޓޔޕޖޗޘAADAFGAAAJKLMNOPAAATAAAAAAAAAAaAaAaAaABCDEFGHIJKLMNOPQRSTUVWXYZ[\ܴܷܸܹܻܼܾܲܳܵܶܺܽܿYZ[\]JKlmnFGHdefgh1235;<=>?@ABCD789:MNuvwxqrsOPQRSTUVWX^_`abcjk|6pܑL}EIz{ot~yybB@?<Obq\qsP37vQ<\o4BMXa7bAaRrI^EE4vz5o{aqFST1|G_XHz52}{UYyFRWreE=KYeQVtAH6ZGn37YF5@c~[QbJpbZy4W\s}ID:LKSJ>ow>t2B|R}2>_92M`UXzcZ:<N4N^K8^vL55;RNM4F]_^a{\cSB8`abcTm8FrC_d6_id[O_};Bpsb2t336zXYPdbNU3;7Jcs1q6f~3<8Yd6ZVUvjt?6LZG@rwrW~[H9O4VO=O5\ngGe\>=4423C|P`7?hDANlR7P}{SdXcaWRu[ErUev]|:rdH|w8?u5Aa8^;CO\]}bvi3mK]~]9{Qh^o_6R@D5Vj<@:A|~e|MsV>z}{9ex\Wke?XNyB5:S;ffBi[kL<fK`@Tavb_~c69=s9jCEzkON]IIAwxf>~stJPtElInu;cfn}8d<Q{V=JW^QDDI_Cz{Lbm|?9XVvUo7wYPj<9gP?F=Q?@EiopceWfp@[k4^_qGxQgKf>qCf5qXOqKQH}:r7}DO4S=~RwmYCPDSgZDS[GAR`d:Kc8QeZT`;sh1B;MGO26xrLhiMVsIu`h<yP56^YYH4XjygoJ3`Ra6;ET9Ea4Zvg47^E\bF_J:Sfc=:w~v;85wR8Tgh6P@Z@xphfU>iQy}9TrjSTUdF>ElFyU\][\_iGtIUh?w:<an|wiV}WhjsWVJuUg`XxAWrczbJ7qdN~k@rgm;R<=>Gcc?@jksxGV;8`~eH]dn9LkYYl<BHzZNf1BZ[k{COtO<^^yi:7[WUPd7yuI<evA2`[C^@2F=Vpmz_v8ABxSoH;U|9LA3>ls1M:F\hW9n?9XQMd]_lKeoljzV<W:g`mwXGPC[m=i:~l^_NBg3w2x`xLeIR4pVNnDbRtD:E`lHXI~>aa?Q;5iKda\>L@;N{haCb]hY]AeXx=Bh=6DIq3~Eb>y~[DMy<m7YkI=1cnB{Xd1cepJ^S8i|2OgYh_<7bc`CJcCH;pJCF:BKCZjtSz=<}uTRK;r3LzD>\l<mMW\GLmfAXbT[yZDP8|nT?]jj}^EfUdLU?c5XV2dgodpaK@5kWqzFOGJDH4f[Dv}eFqInfiUBKGPsr6Q@@~AofRXIle{\8gd~QzFghobapBMr9iN={jg1xAq|DsBko9jskn_u1E<=78th6tuCcDdv>og1hYY:h2NCwLF1eoj{Ii=RSfpS;CTmDA>{N]gPQ:;t1MukEvvjn2?MY|\Em4DhTGVfIOxzkghCo{iG3ihFi<L231}ylEtWqjwO}ruozEGxpHa^UZYnJ`e3VkBjl=s~ppT[I{FkJyPPHbaWqHNJ\J]^Oq8Ka~_eKAyLzPM944Uy|Ml{llFGym[fp1]lG:vAbU{~Kq1cpi]>k?C^|k{2@R;HXm8o|2O|lt_9mnc|Ii53JZDMDrNXEYdjL}p:KOhur}|dE@ezIqF2\[43pYm<SgOZwsmh=MtF~N5Pk5n\imIpP3AO[m;fC2`5Xg5rnY~SF5K4\yijTna?zQ|LruFGk4jkNGuPo>>]5Blxv^lqlZ4m>H>?=a\VJW@UHQ}rYHpoT\5Abj3Ls56sQ46pk{EusBo6CgmJ]U`s]6_}7K1IQ8RSweZw??H7K1]SOr8tRItqIwsQ>N1{uc?Vq<{OJvc5h?RD@wBr^h]srKi@uR`~Zf_6NSno;O`<n9:sl^Lxn6KyQAMwBx_6Qs7t@}T1L6jCnPJzt~PSdtCUMTA;Kg`<DWQ9V=E2ZGluT2GR=xVwWneWX7xrFnH87EXmWu|{fa^6|]pZXAiqTLU3V1fvI}x^}CRvFwFYk@2PG1Z[_[Db9J[Law\:t73So]xj4HT|1:Ldu8v[czMWoG4R}23^g[UyJ8IYdSy;`WySXK>OMS_gMT_Up9~\p\MDNPNy`N>NE`a61jup:kzeh}ZqO7T>xyLT|uKM?lmstz;l83M8?39<JAB]bVu[abcdefghijklmnopqstuvwxyz{|}ˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈшӈԈՈֈ׈؈وڈۈ܈݈ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}‰ÉĉʼnƉljȉɉʉˉ͉̉ΉωЉщӉԉՉ։׉؉ىډۉ܉݉ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ŠÊĊŊƊNJȊɊʊˊ̊͊ΊϊЊъӊԊՊ֊׊؊يڊۊ܊݊ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}ŒÌČŌƌnjȌɌʌˌ̌͌ΌόЌьӌԌՌ֌׌،ٌڌی܌݌ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ÍčōƍǍȍɍʍˍ͍̍΍ύЍэӍԍՍ֍׍؍ٍڍۍ܍ݍABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ŽÎĎŎƎǎȎɎʎˎ͎̎ΎώЎюӎԎՎ֎׎؎َڎێ܎ݎABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}ÐĐŐƐǐȐɐʐː̐͐ΐϐАѐӐԐՐ֐אِؐڐېܐݐABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}‘ÑđőƑǑȑɑʑˑ̑͑ΑϑБёӑԑՑ֑בّؑڑۑܑݑABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}’ÒĒŒƒǒȒɒʒ˒̒͒ΒϒВђӒԒՒ֒גْؒڒےܒݒABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}”ÔĔŔƔǔȔɔʔ˔͔̔ΔϔДєӔԔՔ֔הؔٔڔ۔ܔݔABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}•ÕĕŕƕǕȕɕʕ˕͕̕ΕϕЕѕӕԕՕ֕וٕؕڕەܕݕABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}–ÖĖŖƖǖȖɖʖ˖̖͖ΖϖЖіӖԖՖ֖זٖؖږۖܖݖABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}˜ØĘŘƘǘȘɘʘ˘̘͘ΘϘИјӘԘ՘֘טؘ٘ژۘܘݘABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}™ÙęřƙǙșəʙ˙̙͙ΙϙЙљәԙՙ֙יؙٙڙۙܙݙABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}šÚĚŚƚǚȚɚʚ˚͚̚ΚϚКњӚԚ՚֚ךؚٚښۚܚݚABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}œÜĜŜƜǜȜɜʜ˜̜͜ΜϜМќӜԜ՜֜ל؜ٜڜۜܜݜABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ÝĝŝƝǝȝɝʝ˝̝͝ΝϝНѝӝԝ՝֝ם؝ٝڝ۝ܝݝABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}žÞĞŞƞǞȞɞʞ˞̞͞ΞϞОўӞԞ՞֞מ؞ٞڞ۞ܞݞABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|} àĠŠƠǠȠɠʠˠ̠͠ΠϠРѠӠԠՠ֠נؠ٠ڠ۠ܠݠABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¡áġšơǡȡɡʡˡ̡͡ΡϡСѡӡԡա֡סء١ڡۡܡݡABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¢âĢŢƢǢȢɢʢˢ̢͢΢ϢТѢӢԢբ֢עآ٢ڢۢܢݢABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤӤԤդ֤פؤ٤ڤۤܤݤABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥӥԥե֥ץإ٥ڥۥܥݥABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¦æĦŦƦǦȦɦʦ˦̦ͦΦϦЦѦӦԦզ֦צئ٦ڦۦܦݦABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}¨èĨŨƨǨȨɨʨ˨̨ͨΨϨШѨӨԨը֨רب٨ڨۨܨݨABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}©éĩũƩǩȩɩʩ˩̩ͩΩϩЩѩөԩթ֩שة٩ک۩ܩݩABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ªêĪŪƪǪȪɪʪ˪̪ͪΪϪЪѪӪԪժ֪תت٪ڪ۪ܪݪABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}¬ìĬŬƬǬȬɬʬˬ̬ͬάϬЬѬӬԬլ֬׬ج٬ڬ۬ܬݬABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}­íĭŭƭǭȭɭʭ˭̭ͭέϭЭѭӭԭխ֭׭ح٭ڭۭܭݭABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}®îĮŮƮǮȮɮʮˮ̮ͮήϮЮѮӮԮծ֮׮خٮڮۮܮݮABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}°ðİŰưǰȰɰʰ˰̰ͰΰϰаѰӰ԰հְװذٰڰ۰ܰݰABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}±ñıűƱDZȱɱʱ˱̱ͱαϱбѱӱԱձֱױرٱڱ۱ܱݱABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}²òIJŲƲDzȲɲʲ˲̲ͲβϲвѲӲԲղֲײزٲڲ۲ܲݲABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}´ôĴŴƴǴȴɴʴ˴̴ʹδϴдѴӴԴմִ״شٴڴ۴ܴݴABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}µõĵŵƵǵȵɵʵ˵̵͵εϵеѵӵԵյֵ׵صٵڵ۵ܵݵABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¶öĶŶƶǶȶɶʶ˶̶Ͷζ϶жѶӶԶնֶ׶ضٶڶ۶ܶݶABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}¸øĸŸƸǸȸɸʸ˸̸͸θϸиѸӸԸոָ׸ظٸڸ۸ܸݸABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¹ùĹŹƹǹȹɹʹ˹̹͹ιϹйѹӹԹչֹ׹عٹڹ۹ܹݹABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ºúĺźƺǺȺɺʺ˺̺ͺκϺкѺӺԺպֺ׺غٺںۺܺݺABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}¼üļżƼǼȼɼʼ˼̼ͼμϼмѼӼԼռּ׼ؼټڼۼܼݼABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}½ýĽŽƽǽȽɽʽ˽̽ͽνϽнѽӽԽսֽ׽ؽٽڽ۽ܽݽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}¾þľžƾǾȾɾʾ˾̾;ξϾоѾӾԾվ־׾ؾپھ۾ܾݾABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}abcdefghijklmnopqstuvwxyz{|}ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}‚ƒ„…†‡ˆ‰Š‹ŒŽ‘“”•–—˜™š›œ¡¢£¤¥¦§¨©ª«¬­®¯°±³´µ¶·¸¹º»¼½ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÓÔÕÖרÙÚÛÜÝáâãäåæçèéêëìíîïðñóôõö÷øùúûüýabcdefghijklmnopqstuvwxyz{|}āĂ㥹ĆćĈĉĊċČčĎďĐđēĔĕĖėĘęĚěĜĝġĢģĤĥĦħĨĩĪīĬĭĮįİıijĴĵĶķĸĹĺĻļĽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ŁłŃńŅņŇňʼnŊŋŌōŎŏŐőœŔŕŖŗŘřŚśŜŝšŢţŤťŦŧŨũŪūŬŭŮůŰűųŴŵŶŷŸŹźŻżŽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ƁƂƃƄƅƆƇƈƉƊƋƌƍƎƏƐƑƓƔƕƖƗƘƙƚƛƜƝơƢƣƤƥƦƧƨƩƪƫƬƭƮƯưƱƳƴƵƶƷƸƹƺƻƼƽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ǁǂǃDŽDždžLJLjljNJNjnjǍǎǏǐǑǓǔǕǖǗǘǙǚǛǜǝǡǢǣǤǥǦǧǨǩǪǫǬǭǮǯǰDZdzǴǵǶǷǸǹǺǻǼǽabcdefghijklmnopqstuvwxyz{|}ȁȂȃȄȅȆȇȈȉȊȋȌȍȎȏȐȑȓȔȕȖȗȘșȚțȜȝȡȢȣȤȥȦȧȨȩȪȫȬȭȮȯȰȱȳȴȵȶȷȸȹȺȻȼȽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ɁɂɃɄɅɆɇɈɉɊɋɌɍɎɏɐɑɓɔɕɖɗɘəɚɛɜɝɡɢɣɤɥɦɧɨɩɪɫɬɭɮɯɰɱɳɴɵɶɷɸɹɺɻɼɽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ʁʂʃʄʅʆʇʈʉʊʋʌʍʎʏʐʑʓʔʕʖʗʘʙʚʛʜʝʡʢʣʤʥʦʧʨʩʪʫʬʭʮʯʰʱʳʴʵʶʷʸʹʺʻʼʽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ˁ˂˃˄˅ˆˇˈˉˊˋˌˍˎˏːˑ˓˔˕˖˗˘˙˚˛˜˝ˡˢˣˤ˥˦˧˨˩˪˫ˬ˭ˮ˯˰˱˳˴˵˶˷˸˹˺˻˼˽abcdefghijklmnopqstuvwxyz{|}̴̵̶̷̸̡̢̧̨̛̖̗̘̙̜̝̣̤̥̦̩̪̫̬̭̮̯̰̱̳̹̺̻̼́̂̃̄̅̆̇̈̉̊̋̌̍̎̏̐̑̓̔̽̕̚ABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}͇͈͉͍͎́͂̓̈́͆͊͋͌ͅ͏͓͔͕͖͙͚͐͑͗͛ͣͤͥͦͧͨͩͪͫͬͭͮͯ͘͜͢͝͡Ͱͱͳʹ͵Ͷͷ͸͹ͺͻͼͽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}΁΂΃΄΅Ά·ΈΉΊ΋Ό΍ΎΏΐΑΓΔΕΖΗΘΙΚΛΜΝΡ΢ΣΤΥΦΧΨΩΪΫάέήίΰαγδεζηθικλμνABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ρςστυφχψωϊϋόύώϏϐϑϓϔϕϖϗϘϙϚϛϜϝϡϢϣϤϥϦϧϨϩϪϫϬϭϮϯϰϱϳϴϵ϶ϷϸϹϺϻϼϽabcdefghijklmnopqstuvwxyz{|}ЁЂЃЄЅІЇЈЉЊЋЌЍЎЏАБГДЕЖЗИЙКЛМНСТУФХЦЧШЩЪЫЬЭЮЯабгдежзийклмнABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}стуфхцчшщъыьэюяѐёѓєѕіїјљњћќѝѡѢѣѤѥѦѧѨѩѪѫѬѭѮѯѰѱѳѴѵѶѷѸѹѺѻѼѽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ҁ҂҃҄҅҆҇҈҉ҊҋҌҍҎҏҐґғҔҕҖҗҘҙҚқҜҝҡҢңҤҥҦҧҨҩҪҫҬҭҮүҰұҳҴҵҶҷҸҹҺһҼҽABCDEFGHIJKLMNOPQSTUVWXYZ[\]abcdefghijklmnopqstuvwxyz{|}ӁӂӃӄӅӆӇӈӉӊӋӌӍӎӏӐӑӓӔӕӖӗӘәӚӛӜӝӡӢӣӤӥӦӧӨөӪӫӬӭӮӯӰӱӳӴӵӶӷӸӹӺӻӼӽ=2H`m23789:;=BNRSTVWXYZ[]^_`abcdefgijnoqrtuvwxyz{vH]519147=?@ACGHLTVWZbfiloqtuvxz{|wxQu67:?@ABEHJPQUVYZemnqtwxkM7~k12v9123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijk~\Nʁ}L~ƒÃăŃƃǃȃɃʃ˃̃̓΃σЃу҃ӃԃՃփF@ABCDEGHIJKLMNOPQRSTUVWXYZ[\]^_`pqrstuwxyz{|}~v \\F,j Jj#c"a S  O M M L HHEE>~>~=|8w7v2r,k%c"a ^ZXVV L !I!!!"H"""#H###$E$$$%D%%%&A&}&&&<'t'''3(o((())f)))%*e***%+d+++,[,,,-U---.R.../M/// 0I0001E1112B2223@3333=4}444=5}555=6x66637s77728r888/9n999:D:::;C;;;;=<}<<<;=y===8>w>>>1?q???1@p@@@+AgAAA'BgBBB&CfCCC$DdDDD!EaEEE F;F{FFF7GSGGGHOHHH ILIqIII0JpJJJ$KbKKK"LbLLLMWMMMNPNYNNNN>O|OOO;PzPPP5QjQQQ%RORRRS:SzSSS2TrTTT*UgUUU!V_V~VVVg>>>#?c???#@c@@@"AaAAABXBBBCWCCCDTDDDEREEEFRFFFGQGGGHPHHHIMIII JLJJJ KLKKK LKLLL MJMMM NJNNNOHOeOOO#PcPPP Q^QQQR]RRRS]SSST\TTTUYUUUVXVVVWSWWWXRXXXYQYYYZQZZZ[N[[[[,\j\\\]D]]]^@^^^_%_e___$`c```a_aaab_bbbcYcccdd_dddeBeeef@ffff2grgggh[hhhiGiiijAjjjj9kykkk6lUlllmTmmmmnHnnnoBoooefop]\aefgh_dc~w@|~{TUVWXYZ[\]^vFDEGHˁ́JKIĹ݁΁Łށā|z假ځҁӁȁɁ߁ÁρЁсہƁǁ܁abcdefghijklmno@ABCDEFGHIJKLMNOPQRS†ÆĆņƆdžȆɆʆˆ̆͆ΆφІц҆ӆԆՆֆ׆؆؃كڃۃ܃݃ރ߃냣A@CBZ^MNY@ABVXYZqrstuvwxyzkl؁فցׁ`[‚ÂĂłƂǂȂɂʂ˂̂͂΂ςЂт҂ӂԂՂւׂ؂قڂۂ܂݂ނ߂JKTU@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~E[RS„ÄĄńƄDŽȄɄʄ˄̄̈́΄τЄф҄ӄԄՄքׄ؄لڄۄ܄نچۆ܆݆ކ߆ei`cakjdlfn_mbgh~rsopqut}LQR}uчJNهg|}^b`v~z~hGHKSg|_sSeg{RVfjgrv]agiknpnH^h{wEGIP^ꈚAO㏺s^BNCuDEF𣇤ۊO厥GTvHIVRKh娘揩NOT\񓥇]݌܌jiP𱘲S划SlTVYmWwXYedt[WߗȈZ‹\]C^˜Ɉތꊚx_`ĘaLfbϒAȘʈZC̑c𽉮ǘd]ØŘƘC`ΘјϘɘfgh͘igjkҘʘ˘ИlӘ̘mˈDoNp֕Wqrrטsܘژt՘ؘۘ٘ە֘MݘޘnCvoUw𹇺qŒ{x|yߘz{؎|l㘑ϗ`~̈ΕÎUT‡PÍbBXC͋@AÇŇlDEHFƇmGIćKJƕVMNɇȇ@LʇQPOBԘRCˇSDז̇UTWVXYZ[͇[ƖeZ\χЇ}E]S_`ZaGTbcH~fIečgh`ijkKʎ҇nLlmyopq~MustrvOwӇxyyԇÙzËՇ{}և}~ׇMRS񁙥ʓo؇TnؐYUڇۇVʕh䒍܇퍎OXU݇Y񞈐އ܍Z菛n[]c\߇_͗abwcJdeNuEוf⇥h䇦啫΋Mj񮙯َܖꇱklkxmٔnCo񽓽\pߌ™ڔ쑦PmęTsřtƙKpəușʙ˙З̙vΙ͙~X}ϙЙ򇵌wљyzQҙyFof~ՙbpÌٙ@ڙؙ‰䑶jE񐊆iۙܙhegݒD@fN噞i۔܊ߙzݙޙCۓČaB@@]PDCiAAƍENFGLKNMJBSOCHIDSBYEXOPURF[VWTZGQ`ea\HfPIhA^Jb[슅c_igriLdcmkMpjnlkorwutQOÉPqsRv܉}{|~Q\RXxyTVWXSӓdYZX[\]^_dlc͈}Ōޕ`ybݍ\cndeϋV񪚭BRؒfgh^iC_lmnoWupqrs|tx͑uš‘ÚĚ@ƚAꁉBgCۗ̚EȚFY˚h˒ǍwǚxGUɚŚo͚zmΚ{HIJKLMĒN|Кn~Oњ֚P՚ϚҚԚǕRךdSؚٚښܚۚޚӚTߚݚmpsᚺ누UVْWXϕYZĉ[[OǙg\VvΈ_aޓt_zdeDzgh@iDA@ܔϖDJWdBjEÑWikFȍlGmonnƌψKLIopqWrHÖPspЈQwxOyRPNPMzؕ{VWSKkU|X}wYT~}ZQ[_\ʼn^]kda`bcefhgilڒdjmnqtopqrEsutuyFЖGnjvwwxyz{}v~FvGw@蒶Xq鐺G{ɍQƉeh⎃ГxxQ@ljJ˞RyΑꐫˎшqz{|ޖ}ċAڎKsANj͓rWjƎwԓR򊨛Z⊈Бx𭛯݊㉴sRśěۛɛƛțǛʛ˛̛ϛΛ͛՛ћЛқӛ֛כԛ؛ފٛۛڛܛݛBꃑHIޛȌߛbJFЋsztȐёAX蛝y훋웩NKcHLݔXM{xɌNfpLf@CDB_FEAGHILJKMNꚌUOٕPMQTU|VOo햷ʌWX^꣒ꭋYJeZ[\]_`abSRc`FʍVjdeefޔihgaґmkjlk]ponq䌵rzsOtJSKEuuYZzwyOxv|ꃜ{ꆜ|ꀜvӑ}}P~pb򡜢IxYߔ{Փfɐ҈ySđz򳜴䎷DӈŜƜĜǜÜȜɜ򾜜œԑQT̜֜͜Μ՜ԜҜdSϜќԈӜʜМלc˜|Jڜޜꞑߜܜٜ؜ݜeۜ蜧圜^ʐ@ABCYDEFՑˌߖ[GˍHőKILJM}NQZOVPc}RSWTRܐ@eA┫ZcS]d_fba[YUBXSِ`qg@hminADE\kEwlˆgFG꓋jUJKLMҔp}NOJqPsoߕR{̎~UxPv|V{uzrYt@W||̍TyڐT[wdf͒}~Z`\]Kg^_`abꈝ[hcrdefggېEhijk̖ꠐlmnTQopPdBohi@록AqrB^stFvwC[CDxy{|}E빝F똝xǓĝq~ݝsŝǝƝU֓HhȝG~ɝʝ˝|Đk֍l͝ΎIΝҋːϝafzVН{ӝѝԝҝ՝֝؝םٝڝU|{۝ߝKVޝLݝՈ̐MN믐fPQtRSTUOE蝞W杙WWXNZ[\]AӔi^밐_`qŋɉa󋏪gÈcbd\Ae@fܓgBCijDFjGHȋgXIJkV֙]\֑ōLKl񍽒LN]MNOؖ{DQnpSVURTWpq뙐LjލێZmXYۖ[\oaYt^ܝnfr`”sf]cb͐tїuvʉ}ged_͌kiˉgmswyƑuAt^_zђMpoqnvljrhĎx{`|̒ȓhI~xZz}ji͍{jyĈ|~ˋK}뺊jVO뱉~[挜B뀞󐞁ǖ_󥞙@IABCX뱐DoEֈF븖AŒ̓뢞J֒Lkȑ^퓾蓖MžNƋ|O􀔺ɋPOyQT|ҞRP՞TUYԞӞVОĞWÞ֞XYΞZɞƞ[ǞϞ̞\ƒʞŞ\Ȟ]l͞מcߞ؞deޞfhݞΒi۞ٞj䞦Wkڞl➾͖~ў`nopMq랪rsuvk@ɓw힯tyhz{}@w~KGFEBDCIELHJ륔MQNOܞRSTUӋ~WVY\ԋ\[]̉V^`_abc~됕c΍defgihw}cjlBkmnopqsrtiuEkvaʚBwxꕈœyіz|{~}믖C념XiÔ`Ĕ똉𓇟]rDדB빍v뗖͉򐑔@AgD롟בjmÒk^Fh봟lY_Q\CZO붟ܗUt넗ƟҗßişʟȟŸWɟğ˟̟[~ǟYύakПߟٟnԟݟQ֟͟ϟ`۟ӟڟ؟ܟΌÏXҟN՟Οџןpퟹ@aABnMCDŖ@EAFؑHHBIJޟYKLRBAMCNE쟖ВFGGOQP@HRSNITIJ샊UKLRVK઒HגkEDMXMGFLCNOPOYPQZW\RUTV]SY^bS`TWU[QZXVabW][^cadZGe\`Y_JZXdghhf[\ibjcgemmjilғnk]oqmnoppq^rart_`sbuvΉwxDcy܎Ѝz{d|Fu}~tefxY{vzgy_׈}Ghi~|jwBkకmn쳖ŏlopRďqrsuvwƏxϔώz{F|onM~}RӗzWCיܒݎꖩuЕŔvĖSqҍ]Ɣό_ƓKTҖ—LPQblʋߊωX]ǔԗՋilڗ@ABCDŠEGFHIZJ@ZABCLDKFGErIHNKJLMONQPÊr[RᶐPYQSpRTcRb\jUUVWV[XYXEWY؈Z[Ȕ\Z{L^᪗l_]Ԕ`\aو^]fcb_`aEbidehgDda`^jklfnmuhvprit]usᾎjkoqalǏxwmynzɒo|pq{rstusv}~wyz}x~×ȕoᒔSIFcH甔Mu~mvᐓXῖĊՔږӖȏŊ^“r˕uėᵖm鋵ZḋΐӍuԍmCjv{@ABCɏDdEVOqɕאIGm֔AJ@⁖KCMBLʏDbFEGNIHOPQЎJVTU_FSPOcLNYj_MKIˏ[Ս]QRh֋\TSЉaTUWXHbYcZ[׋щÓGd\eHȉbg]hd`a≔`^i_j̏ڈHkbcŐBdetŗgfil@mj҉mkemsAoBϐnCnDEnFGpqHrInotJKuv˓LސqwMNy{xzArO|EPq~tSMuTU}⧗WvX͏vYZGw[[^|xƊ^ΏyJ}yabzcde{`iM|؋}}k~mnoplh͕ӉstZuNJ\wxyߐ͔zѕz{~ŽēUәȊАĕ̋H픔eSl⟊Ϗ⸐ЌW휓fƗnI@gC[R탏BюhAfaےFݗ׍GaIЏHIgDJEoMQ㋌LUiROPNKGWTVSpX㎑ea[_ۈZbfjԖԒ\dY]^㻈Ȗ]ًꔩΗgchjmiҕɊɖ܈lknuovrȎtqwpcDks{~|z`ѐɔ}x@qJDUyJ[Zʊߍrul딭rQA`HK퉐㊿ˊ@|sVAlҎCB㧎DϑEkFՖGHI^JKL㮒MENW㣔]яIOP̊ҌQRbmnSx݈U_wّVWEӌX[\E\ƐeҐZ_r`bcdE]^fBAtDCorTHIhGFJBڑNjOKlmLMpUQoGPSRcVWpVXZ^[Y^\q]rd_`ascbetfgbvh՗xLvijPzk{lm}no介pqɎrsܕڊCwMtquʔwǑvDxzy|{}~͊ǗFŎHmcԉF|ڋۑcՉꋗϓpΖ։s䃒t`r׉Ί䜔eۋ@ىҏ؍pAB؉ԌHC专DEGވ䎗GtH䟓䒑IKJ䘕KӏN֖fLMNO䓑PQ~uW䪖H@̕UTUӒVS@הԏǎBCWXnJP[QDNFH\]RGKLO^EEIFdOZ_BVTCmDSE`aUWXFG[YHIZJ˔MbK\a唑`dLAefbh]_gMc^PAidNOcPQjekSTfVgՌsXi|YlmjokqZlr[\]^qr_`m\sabnacopztwefstghuv֎x`uai{jk^|lm}~gؔuvwIopxqrswtuvwxyz{|X}I~ډyz{Z|}~IayOspXqՏt߈\܋Uܑьٍ啑T֏廐J݋A@CBDPEFG漐vHeIJ橌KK`LoMO旗NePQRϊSTUVpWXYGZ[\]vu`_P^Lab׏cKݐidf؏ehigُ]frmwllkFlbYڏjopn֌_FsaUvrwtuqǓNۉbzxkЊyzȗ_{泒~|@}攏dyuӎwTދ戕xc]̝QJL@ؓۏABC^eFEGILvJn݉̔ъӐ晒M惔ݑ\fGdGoLKM^܏qOPw桑RSԐ͎qT拕NUzVWYZ[Ր׌\HH_`x]bcdefHij@DAkBClJE֐GmIFnopLRKMNQPOSRUTVqWrYXgZs[]tuvw^_\`ԎaORyzb]cf|edyg~riڍhqkmjlpnPory֗SsAutx`wv{zyQ|}~DhCJ_ӕҒHIv}ߋԕމ痔Rqǒޑt秓r瀐ʒ笑秈AߑTi툝NٓxV^Օ߉繓BሦkyKՎJIɗҊWߓM׎@xYSsXsAѓUގz|珗Vy_XݏΔэߎ碗dʗB瘊jޒ@tABCݓbDn،EFGHIJSK甉ޏzLgeMLKNOPNQRݕseABC|SDTKE獐F@BGHUVACWыIdJB^EDFMXYZtNՒKOPbGH[\]QLJ^RSIߏWXYOȒ_ZT`ZMNLPa_Vb`YXLQRUaWcdbZTcS^[hf^e_de`]\fg[dbigjcaekfhlhӊgsiljkimjopoklpqtruwvqrxMsy•zJtum[ՊԊ{|}~n֊t}opwq{xrsňztuvxy}h~jɑ~zÕ@w׊A’˗褗z{G@Ku脌ۍ}Bח~ꗯǐYWٌ蓎GԙJᐴﵕ_뗋dkIPÐrʖvxCƈfڕ؊B蹉Cŕ{aДړ̗zjopz{犰芠^ޗڌ@BACDEFHGIHQJKZєOLݖM{a`NOPRSUQTيVWXYZ\[^a]_`bcd遍e]nfgyhʑwmljkiwnopqsrxtvRuxˑy@Az}|~B{CDFH[JLMNOQRSTEUVWXYZ[T\S]@飖_`abcDdef驕gLhNilmnoIqrs~tuwvp{y邊k}~hVLؗP–Γ鼓鰎DCEL@ABQJFKHG{LMNIOߒSTRQWPUVYX[\]hZ^_`abcdefghki[jlٗmꞔnpqoꍍ˖爫sotuvwٖxzy{|}~Cیl@Vsmn|jvy[\`YWdLJ·KNUy}GJbDtFRSVWXZ^_lpF]\Iij{CD^OPQRSTUVWXFGH`abcdefghijklmnopqrstuvwxymnOQMobpԁՁPoo,plppp#qcqqq"rbrrrr s5sasssstBtZtttt9uvuuuu"vAvcvvvv/wkwww!x4xcxxxx y#yayyyyzNzozzzz5{q{{{{|0|a|q||||}3}p}}}~5~[~~~~:z6v#^ځSEo˃5j:nم $L~׆ >c?kLjP‰ʼn5Xي5m׋ KwŌ4s֍Dr5=v+ivސ W0mҒAR 8k֔W3^Җ@f&^ܘ@JMUeADFPQW^`iqrx{sakDQ]ftuCQHITSXuYIa^b_xmQflMOTc|HfsQ]\_q|}TYeuwy|~cR@AhRUDNQXagx}@LKUV]\mnvy{|Kjxk|z@@рo𠪀asmdylink.0 "`` ```kenvcheck_encoding_conversion_argsenv LocalToUtfenv UtfToLocalenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_funcpg_finfo_uhc_to_utf8pg_finfo_utf8_to_uhc uhc_to_utf8 utf8_to_uhc __wasm_apply_data_relocs  "#A j#A@k6#A j#Aj6 # #A8j #Ax6p.h &!!"`#$$%X&''(P)**+H,--.@//0z18223r40556j7(889b: ;;<Z=>>?R@AABJCDDEBFGG|H:IIJtK2LLMlN*OOPdQ"RRS\TUUVTWXXYLZ [[\D]^PHw6סơҢ¥åĥťƥǥȥɥʥ˥̥ͥΥϥХѥҥӥԥե֥ץإѬҬӬԬլ֬ج٬ڬ۬ܬݬެ߬׬TSSo+h={G}+ k & e  \ < | 9 y 6v1p0n+j*g#cY F>~7u1qXTL7w4q/n&f$ d "!a!!!"X"""#R###$O$$$ %H%%%&F&&&'B'|'''9(y(((2)r)))**i***+]+++,S,,,-P---.L....;/z///:0z00041t11122r222,3k333(4h444'5g5556^6667]7778Y8889Q999:F:::;D;;;;I>>>?H???@F@@@@=AxAAA5BqBBB0CjCCCDSDDDENEEE FJFFFGAGGGH@H[HHHIWIsIII#JaJJJK_KKKLALLLL5MnMMM$NdNNNOROOOPGPPPP(QfQQQ$R_RRRSESSSS%TdTTTUHUwUUUVRVVVVWOWWWW%XdXXXYQYYYZQZZZ[Q[[[\Q\\\]Q]]]^Q^^^_Q___`Q```aQaaabQbbbcQcccdQdddeQeeefQfffgQggghQhhhiQiiijQjjjkQkkklQlllmQmmmnQnnnoQooopQpppqQqqqrQrrrsQssstQtttuQuuuvQvvvwQwwwxQxxxyQyyyzQzzz{Q{{{|Q|||}Q}}}~Q~~~QQрQсQтQуQфQхQцPӢԢǡȡءɡ٧ʡբآ֢٢עӡԡġСš֡ա¡áѡҡͩΩϩЩѩҩөԩթ֩שة٩ک۩ܩݩީߩͨΨϨШѨҨӨԨը֨רب٨ڨۨܨݨިߨȦǦ¦ƦŦĦæɦʦ˦̦ͦΦϦЦѦҦӦԦզ֦צئ٦ڦۦܦݦަߦ䦶ƢâǢȢˢʢɢ̢ߡޡ¢ۡݡܡĢŢڡ١Ϣ΢ТѢϡΡۢ͢ܢݢڢ롲ªêĪŪƪǪȪɪʪ˪̪ͪΪϪЪѪҪӪԪժ֪תت٪ڪ۪ܪݪުߪ«ëīūƫǫȫɫʫ˫̫ͫΫϫЫѫҫӫԫի֫׫ث٫ګ۫ܫݫޫ߫¤äĤŤƤǤȤɤʤˤ̤ͤΤϤФѤҤӤԤդ֤פؤ٤ڤۤܤݤޤߤ©éĩũƩǩȩɩʩ˩̩ߢ¨èĨŨƨǨȨɨʨ˨̨ޢɧʧ˧̧ͧܧݧާԧէ֧קا㧿§çħŧƧǧȧΧϧЧѧҧӧڧۧ짦ᢼߧ߾߻ݦΰ޺˥ܭޣΤпܹӵ֤ޡӷ٥̵̨۷ʧкͿױݷע޻з۱ͥҤִΨҡϨʰϽϯͣЯʻԣ٨٩޸ֳϯ˼ΫЪЯдҿ˯ڰ̵ͦε˾ڨްӳͧЫܹӨ߬˼Ӳް׭Ӥڴ˴̾ر̯ջʫծ۶ٹˬѺ٫ڳٹֺΫʤݦЮͰʻվѢ׺ѰͫʮʮۻʰҺ̨۲ѸԲ٢ڧֲԾ޵ˮѪةޯη̼Ͼˤڪ۵׵ͮͻذֳ˩ֿغ߳ԳլڦܴׯߢۿѤԡ֯޵ѷѳТԳܶΩԳʦϢЧڹ֭ڣε׬޴Ѫ٣Կ׿Ͷ̸ۤݰأٴͷ۵ݵףϹԷۿ˥ܮϬ٦ݯާΡй˰Բ־αܧԹس٬ѱ͹֧ؽ׶̢Ѯ̾ܰABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxy°zðİŰưǰȰɰʰ˰̰ͰΰϰаѰҰӰ԰հְװذٰڰ۰ܰݰް߰᰽ÁāŁƁǁȁɁʁˁ́́΁ρЁсҁӁԁՁցׁ؁فځہ܁݁ށ߁ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz±ñıűƱDZȱɱʱ˱‚ÂĂłƂǂȂ̱ɂʂ˂̂͂΂ςЂͱαт҂ϱӂԂՂбւׂ؂قڂۂ܂ѱұ݂ӱނ߂ԱձֱױرABٱCDڱ۱ܱEFGHIJݱޱK߱LMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz鱄걅챆𱊃񱋃򱎃󱏃ƒÃăŃƃǃȃɃʃ˃̃̓΃σЃу҃ӃԃՃփ׃؃كڃۃ܃݃ރ߃შ⃫僬샭탯󃲲ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz²òIJŲƲDzȲɲʲ˲̲Ͳβϲв„ÄѲĄńƄDŽȄɄҲʄ˄̄Ӳ̈́΄τԲЄф҄ӄԄՄքղֲׄ؄لײڄۄ܄݄ބ߄زٲڲ۲AܲBCDEFGݲ޲߲HIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzﲋ𲎅򲕅󲟅…ÅąŅƅDžȅɅʅ˅̅ͅ΅υЅх҅ӅԅՅօׅ؅مڅۅ܅݅ޅ߅兢煤ꅥ񅦳򅨳󅩳ABCDEFGHIJKLMNOPQRS³óTUVWXYijųZaƳbcddzefghijkȳlmnoɳpqrstuvwxyzʳ˳̳ͳγϳгѳҳӳԳճֳ׳سٳڳ۳ܳݳ޳߳ᳺ⳼㳿†ÆĆņƆdžȆɆʆˆ̆͆ΆφІц҆ӆԆՆֆ׆؆نچۆ܆݆ކ߆ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz‡ÇćŇƇLJȇɇʇˇ͇̇·χЇч҇ӇԇՇևׇ؇هڇۇ܇݇އ߇쇵򇷴ABCDEFGHIJKLMNOPQRSTUVWXYZabc´defôĴŴghijkƴǴlȴmɴʴnop˴q̴rstʹuvwδxyzϴдѴҴӴԴմִ״شٴڴ۴ܴݴ޴ߴᴦ䴩鴪촭𴹈󴺈ˆÈĈňƈLjȈɈʈˈ͈̈ΈψЈш҈ӈԈՈֈ׈؈وڈۈ܈݈ވ߈ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzµõĵŵ‰ÉĉʼnƉljȉɉʉˉ͉̉ΉωЉщƵ҉ӉԉՉ։׉؉ǵىډۉȵ܉݉މɵ߉ʵ˵̵͵ABCDEFGHIJKεϵLMеNOPѵQRSTUVWҵӵXԵYյZabcdeֵfghijklmnopqrstuvwx׵yzصٵڵ۵ܵݵ޵ߵ൶ᵹ⵼ŠÊĊŊƊNJȊɊʊˊ̊͊ΊϊЊъҊӊԊՊ֊׊؊يڊۊ܊݊ފߊABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz‹ËċŋƋNjȋɋʋˋ̋͋΋ϋЋыҋ¶öĶӋԋՋ֋׋؋Ŷًڋۋ܋݋ދߋƶABCDEFGHIJKLMNOPǶȶQRɶSTUʶVWXYZabcdefg˶hijklm̶nopqrstͶuvwxyzζ϶жŒÌČŌƌnjȌɌʌˌ̌͌ΌόЌьҌӌԌՌ֌׌،ٌڌی܌݌ތѶҶߌӶԶնֶ׶ABCDEFGHIJKLMNOPQضRSTUVWXYZabcdefghijklmnopqrٶstuڶvwx۶yzܶݶ޶߶ණᶭ㶯嶶涷綿ÍčōƍǍȍɍʍˍ͍̍΍ύЍэҍӍԍՍ֍׍؍ٍڍۍ܍ݍލߍABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz·÷ķŷƷǷȷɷŽÎĎŎƎǎʷȎɎʎ˷ˎ͎̎ΎώЎюҎӎԎՎ֎̷׎ͷ؎َڎێ܎ݎގߎηϷзѷҷӷԷշַ׷ABCDEFGHطIJKLMNOPQRSTUVWXYZabcdefghٷijklmnoڷpqr۷stuܷvwxyzݷ޷߷ළ᷋ⷎ㷑䷙巚淛跡鷣귦췭ﷵÏďŏƏǏȏɏʏˏ̏͏ΏϏЏяҏӏԏՏ֏׏؏ُڏۏ܏ݏޏߏABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz¸øĸŸƸǸȸɸʸ˸̸͸θϸиÐĐŐƐѸǐȐɐʐː̐͐ΐϐАѐҐҸӐԐՐ֐אِؐڐېܐݐސߐӸԸոָ׸AظٸBڸC۸ܸDEFGݸ޸߸HIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz񸖑󸗑‘ÑđőƑǑȑɑʑˑ̑͑ΑϑБёґӑԑՑ֑בّؑڑۑܑݑޑߑᑢ鑣ꑤ둥񑦹ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz¹ùĹŹƹ’ÒĒŒƒǹǒȒɒȹʒ˒̒ɹ͒ΒϒВђҒӒʹԒՒ˹֒גْؒڒےܒݒޒߒ̹͹ιϹйѹABCDEҹӹFԹչֹG׹HعIJٹڹ۹ܹݹKL޹߹MNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz“ÓēœƓǓȓɓʓ˓͓̓ΓϓГѓғӓԓՓ֓דؓٓړۓܓݓޓߓ⓷ABCDEFGHIJKLMNOPQºRSTUVWXYZabcdefúghijklmĺnopqrstuvwxyzźƺǺȺɺʺ˺̺ͺκϺкѺҺӺԺ”ÔĔŔƔպֺǔ׺Ȕغɔʔ˔ٺں̔ۺ͔ΔϔДєҔӔܺԔՔ֔הؔٔڔ۔ܔݔޔݺߔ޺ABߺCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzﺈ𺉕򺭕󺯕•ÕĕŕƕǕȕɕʕ˕͕̕ΕϕЕѕҕӕԕՕ֕וٕؕڕەܕݕޕߕᕲABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz»ûĻŻƻ–ǻȻÖĖɻŖƖǖʻȖɖʖ˖̖͖Ζ˻̻ϖЖіͻҖӖԖՖ֖זٖؖږۖܖݖޖߖABCDEFGHIJKLMNOPQλRSTUVWXYZabcdefghijklmnopqrϻstuvwxyzлѻһӻԻջֻ׻—×ėŗƗǗȗɗʗ˗̗͗ΗϗЗїҗӗԗ՗֗חؗٗڗۗܗݗޗߗػABCDEFGHIJKLMNOPQٻRSTUVWڻXYZۻabcܻdefghijݻ޻klmnopqrstuvwxyz߻໗ộ⻜代廤滥軫껬𻳘󻴘˜ØĘŘƘǘȘɘʘ˘̘͘ΘϘИјҘӘԘ՘֘טؘ٘ژۘܘݘޘߘ☩嘪옫𘬼ABCDEFGHIJKLMNOPQR¼üļSTUVWXżƼYZǼabcȼdefghijɼʼk˼̼ͼlmnopqμrstϼuvwмxyzѼҼӼԼռּ׼ؼټڼۼܼݼ޼߼༦ἲ⼸㼻伾™ÙęřƙǙșəʙ˙̙͙ΙϙЙљҙәԙՙ֙יؙٙڙۙܙݙޙߙABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz½šÚĚŚƚǚȚɚʚ˚͚̚ΚϚКњҚӚԚ՚֚ךؚٚښۚܚݚޚýĽߚŽƽǽȽɽʽ˽̽ͽνϽнѽҽӽԽսֽABC׽ؽٽDEڽFGH۽IJKLMNOܽݽPQ޽߽RSTUVWXYZabcdefghijklmnopqrstuvwxyz⽛㽝你彡罦齨꽮뽱콴›ÛěśƛǛțɛʛ˛̛͛ΛϛЛћқӛԛ՛֛כ؛ٛڛۛܛݛޛߛABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzœÜĜŜƜǜȜɜʜ˜̜͜ΜϜМќҜӜԜ՜֜ל؜ٜڜۜܜݜޜߜꜭ񜮾ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzÝĝŝƝǝ¾þȝľɝžʝ˝̝͝ΝϝƾǾНѝȾɾʾҝ˾̾;ӝԝ՝֝ξϾоםѾҾӾ؝ٝڝԾվ۝־׾ܝݝؾޝߝپھ۾ܾݾ޾߾ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz¿ÿĿſƿǿȿɿʿ˿̿ͿοϿпѿҿӿԿտžÞĞŞƞǞֿ׿Ȟɞؿʞ˞̞͞ΞϞОўҞӞԞٿ՞֞ڿמۿ؞ٞڞ۞ܞݞܿݿޞߞ޿߿ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzŸßğşƟǟȟɟʟ˟̟͟ΟϟПџҟӟԟ՟֟ן؟ٟڟ۟ܟݟޟߟABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz àĠŠƠǠȠɠʠˠ̠͠ΠϠРѠҠӠԠՠ֠נؠ٠ڠ۠ܠݠޠߠ࠹ᠺ栻砽蠾ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz¢ž¤ ¦ABCDEFGHIJ¬K®¯LMNOPQ±RSTUVWXYZabcµd·¸efghijklmnopqrstuvwxyz„ABCDE½FGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz’ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz…ŒŸABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz„†‰“™ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz•ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz’•œŸABCDEFGHIJKLMN¡âãOPQRSåTUVWXYZabcdeéfëìghijklmnopqrstuvwxyzÃABCDôEFGHIJKLMNOPøQúûRSTUVWýXYZabcdefghijklmnopqrstuvwxyzÊÑÔABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzÞABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzÅÆÇÍàABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzÂÅÈÏÓÙÛÞABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnĢopqrĥĦstuvwxĨyzāĬćĉČİēĔĕĴěĝĠABCDEFĸGĺĻHIJKLMĽNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzďđēĚěABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzĐĒĕĜĝĞABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzćĚABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzćčABCDEFGHIJKLMNOPQRŢSTUVWXYZabcdefghijklmnopqrstuvwxŪyzŁńŮŋŎABCDEFGHIJKLMNOűPQRSTUVWXYZaŵbcdefghiŹjklmnżopqrstžuvwxyzłńŇŎŏŕABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzłŃʼnŋŎŕŖŗŝŠABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzŁňʼnŊŎŏŒABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzŁłňABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzƣƘƚƝABCƧDEFGHIJKLMNOPQRSTUVWXYZabcdefghiƯjklmƲnopqrsƵtuvwxyzƃƆƉƻƐƽƚƜƟABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzƆƉƌƓƕƛABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzLJABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzǫdžLjǮNJNjDZǐǑǒǘABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzLJljǑǔǗǞǠABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzDžLJNJǑǒǓǙǛǞABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzǁ‚ƒ„…†LJˆ‰NJ‹Œ¡ȍŽ‘’“”¢ȕ–—˜™š›œž£Ȥȟ ¥ABCæDEFGçHIèȩJêKëLMNìOPíȮQRïSTUðVWXYZabcdeñfòghijklóȴmnõopqrstuvwxyzÁÂöȃ÷ȄÅÆÇÈÉøȹȊËúȌÍÎûȏÐÑÒÓÔÕÖüȗýȘþșÚÛÜÝÞÿȟàABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzāĂȃĄąĆȇĈĉĊċČȍĎȏĐđȒēĔĕĖėĘęĚěĜĝȞğĠABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyzŁȂȃȄŅņȇňȉŊŋȌōŎȏŐőŒœŔŕȖŗŘșŚśŜŝŞȟŠABCDEFGHIJKLMNOPQRɢɣɤɥɦɧɨɩɪɫɬɭɮɯɰɱɲɳɴɵɶɷɸɹɺɻɼɽɾɿɡͭϢиѢңҧҨҩҪҫҭҲҾԥիծոۥܥ޳£ãģţƣǣȣɣʣˣ̣ͣΣϣУѣңӣԣգ֣ףأ٣ڣۣݣޣߣˡ̡͡ܣ@A@{@рvasmdylink.0.``` ```` envcheck_encoding_conversion_argsenv LocalToUtfenv errstart_coldenverrcodeenverrmsgenv errfinishenvputsenv UtfToLocalenv__stack_pointerenv __memory_baseenvmemory__wasm_call_ctors Pg_magic_func pg_finfo_win_to_utf8 pg_finfo_utf8_to_win win_to_utf8 utf8_to_win__wasm_apply_data_relocs  #AĶj#Aķj6#Aȶj#Aj6#Aжj#Aj6#AԶj#AԸj6#Aܶj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aĺj6#Aj#Aj6#Aj#Aj6#Aj#AԻj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#AĽj6#Aj#Aj6#Aj#Aj6#Aj#AԾj6#Aj#Aj6#Aj#Aj6#Aȷj#Aj6#Aj#A j6#Aj#Aj6#AԸj#Aj6#Aj#A j6#Aj#A(j6#Aj#A0j6#Aj#A8j6#AȺj#A?j6#Aj#Aj6#Aj#Aj6#AԻj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#AȽj#AЀj6#Aj#AЈj6#Aj#AДj6#AԾj#AМj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#A̶j6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aضj6#Aj#Aj6#Aj#Aj6#Aj#Aj6#Aj#Aj6 # #A8j #Aˁ} ``@Ҁ@ #@ˀ '+@πH /3@ˀ 7;@׀ P@PD?ۀj PJPN?ˀ `R`V@̀ [[@[L[@[d[p[@[@[@[@[X[|[[[[password # # errcodes.txt # PostgreSQL error codes # # Copyright (c) 2003-2024, PostgreSQL Global Development Group # # This list serves as the basis for generating source files containing error # codes. It is kept in a common format to make sure all these source files have # the same contents. # The files generated from this one are: # # src/include/utils/errcodes.h # macros defining errcode constants to be used in the rest of the source # # src/pl/plpgsql/src/plerrcodes.h # a list of PL/pgSQL condition names and their SQLSTATE codes # # src/pl/tcl/pltclerrcodes.h # the same, for PL/Tcl # # doc/src/sgml/errcodes-table.sgml # a SGML table of error codes for inclusion in the documentation # # The format of this file is one error code per line, with the following # whitespace-separated fields: # # sqlstate E/W/S errcode_macro_name spec_name # # where sqlstate is a five-character string following the SQLSTATE conventions, # the second field indicates if the code means an error, a warning or success, # errcode_macro_name is the C macro name starting with ERRCODE that will be put # in errcodes.h, and spec_name is a lowercase, underscore-separated name that # will be used as the PL/pgSQL condition name and will also be included in the # SGML list. The last field is optional, if not present the PL/pgSQL condition # and the SGML entry will not be generated. # # Empty lines and lines starting with a hash are comments. # # There are also special lines in the format of: # # Section: section description # # that is, lines starting with the string "Section:". They are used to delimit # error classes as defined in the SQL spec, and are necessary for SGML output. # # # SQLSTATE codes for errors. # # The SQL99 code set is rather impoverished, especially in the area of # syntactical and semantic errors. We have borrowed codes from IBM's DB2 # and invented our own codes to develop a useful code set. # # When adding a new code, make sure it is placed in the most appropriate # class (the first two characters of the code value identify the class). # The listing is organized by class to make this prominent. # # Each class should have a generic '000' subclass. However, # the generic '000' subclass code should be used for an error only # when there is not a more-specific subclass code defined. # # The SQL spec requires that all the elements of a SQLSTATE code be # either digits or upper-case ASCII characters. # # Classes that begin with 0-4 or A-H are defined by the # standard. Within such a class, subclass values defined by the # standard must begin with 0-4 or A-H. To define a new error code, # ensure that it is either in an "implementation-defined class" (it # begins with 5-9 or I-Z), or its subclass falls outside the range of # error codes that could be present in future versions of the # standard (i.e. the subclass value begins with 5-9 or I-Z). # # The convention is that new error codes defined by PostgreSQL in a # class defined by the standard have a subclass value that begins # with 'P'. In addition, error codes defined by PostgreSQL clients # (such as ecpg) have a class value that begins with 'Y'. Section: Class 00 - Successful Completion 00000 S ERRCODE_SUCCESSFUL_COMPLETION successful_completion Section: Class 01 - Warning # do not use this class for failure conditions 01000 W ERRCODE_WARNING warning 0100C W ERRCODE_WARNING_DYNAMIC_RESULT_SETS_RETURNED dynamic_result_sets_returned 01008 W ERRCODE_WARNING_IMPLICIT_ZERO_BIT_PADDING implicit_zero_bit_padding 01003 W ERRCODE_WARNING_NULL_VALUE_ELIMINATED_IN_SET_FUNCTION null_value_eliminated_in_set_function 01007 W ERRCODE_WARNING_PRIVILEGE_NOT_GRANTED privilege_not_granted 01006 W ERRCODE_WARNING_PRIVILEGE_NOT_REVOKED privilege_not_revoked 01004 W ERRCODE_WARNING_STRING_DATA_RIGHT_TRUNCATION string_data_right_truncation 01P01 W ERRCODE_WARNING_DEPRECATED_FEATURE deprecated_feature Section: Class 02 - No Data (this is also a warning class per the SQL standard) # do not use this class for failure conditions 02000 W ERRCODE_NO_DATA no_data 02001 W ERRCODE_NO_ADDITIONAL_DYNAMIC_RESULT_SETS_RETURNED no_additional_dynamic_result_sets_returned Section: Class 03 - SQL Statement Not Yet Complete 03000 E ERRCODE_SQL_STATEMENT_NOT_YET_COMPLETE sql_statement_not_yet_complete Section: Class 08 - Connection Exception 08000 E ERRCODE_CONNECTION_EXCEPTION connection_exception 08003 E ERRCODE_CONNECTION_DOES_NOT_EXIST connection_does_not_exist 08006 E ERRCODE_CONNECTION_FAILURE connection_failure 08001 E ERRCODE_SQLCLIENT_UNABLE_TO_ESTABLISH_SQLCONNECTION sqlclient_unable_to_establish_sqlconnection 08004 E ERRCODE_SQLSERVER_REJECTED_ESTABLISHMENT_OF_SQLCONNECTION sqlserver_rejected_establishment_of_sqlconnection 08007 E ERRCODE_TRANSACTION_RESOLUTION_UNKNOWN transaction_resolution_unknown 08P01 E ERRCODE_PROTOCOL_VIOLATION protocol_violation Section: Class 09 - Triggered Action Exception 09000 E ERRCODE_TRIGGERED_ACTION_EXCEPTION triggered_action_exception Section: Class 0A - Feature Not Supported 0A000 E ERRCODE_FEATURE_NOT_SUPPORTED feature_not_supported Section: Class 0B - Invalid Transaction Initiation 0B000 E ERRCODE_INVALID_TRANSACTION_INITIATION invalid_transaction_initiation Section: Class 0F - Locator Exception 0F000 E ERRCODE_LOCATOR_EXCEPTION locator_exception 0F001 E ERRCODE_L_E_INVALID_SPECIFICATION invalid_locator_specification Section: Class 0L - Invalid Grantor 0L000 E ERRCODE_INVALID_GRANTOR invalid_grantor 0LP01 E ERRCODE_INVALID_GRANT_OPERATION invalid_grant_operation Section: Class 0P - Invalid Role Specification 0P000 E ERRCODE_INVALID_ROLE_SPECIFICATION invalid_role_specification Section: Class 0Z - Diagnostics Exception 0Z000 E ERRCODE_DIAGNOSTICS_EXCEPTION diagnostics_exception 0Z002 E ERRCODE_STACKED_DIAGNOSTICS_ACCESSED_WITHOUT_ACTIVE_HANDLER stacked_diagnostics_accessed_without_active_handler Section: Class 20 - Case Not Found 20000 E ERRCODE_CASE_NOT_FOUND case_not_found Section: Class 21 - Cardinality Violation # this means something returned the wrong number of rows 21000 E ERRCODE_CARDINALITY_VIOLATION cardinality_violation Section: Class 22 - Data Exception 22000 E ERRCODE_DATA_EXCEPTION data_exception 2202E E ERRCODE_ARRAY_ELEMENT_ERROR # SQL99's actual definition of "array element error" is subscript error 2202E E ERRCODE_ARRAY_SUBSCRIPT_ERROR array_subscript_error 22021 E ERRCODE_CHARACTER_NOT_IN_REPERTOIRE character_not_in_repertoire 22008 E ERRCODE_DATETIME_FIELD_OVERFLOW datetime_field_overflow 22008 E ERRCODE_DATETIME_VALUE_OUT_OF_RANGE 22012 E ERRCODE_DIVISION_BY_ZERO division_by_zero 22005 E ERRCODE_ERROR_IN_ASSIGNMENT error_in_assignment 2200B E ERRCODE_ESCAPE_CHARACTER_CONFLICT escape_character_conflict 22022 E ERRCODE_INDICATOR_OVERFLOW indicator_overflow 22015 E ERRCODE_INTERVAL_FIELD_OVERFLOW interval_field_overflow 2201E E ERRCODE_INVALID_ARGUMENT_FOR_LOG invalid_argument_for_logarithm 22014 E ERRCODE_INVALID_ARGUMENT_FOR_NTILE invalid_argument_for_ntile_function 22016 E ERRCODE_INVALID_ARGUMENT_FOR_NTH_VALUE invalid_argument_for_nth_value_function 2201F E ERRCODE_INVALID_ARGUMENT_FOR_POWER_FUNCTION invalid_argument_for_power_function 2201G E ERRCODE_INVALID_ARGUMENT_FOR_WIDTH_BUCKET_FUNCTION invalid_argument_for_width_bucket_function 22018 E ERRCODE_INVALID_CHARACTER_VALUE_FOR_CAST invalid_character_value_for_cast 22007 E ERRCODE_INVALID_DATETIME_FORMAT invalid_datetime_format 22019 E ERRCODE_INVALID_ESCAPE_CHARACTER invalid_escape_character 2200D E ERRCODE_INVALID_ESCAPE_OCTET invalid_escape_octet 22025 E ERRCODE_INVALID_ESCAPE_SEQUENCE invalid_escape_sequence 22P06 E ERRCODE_NONSTANDARD_USE_OF_ESCAPE_CHARACTER nonstandard_use_of_escape_character 22010 E ERRCODE_INVALID_INDICATOR_PARAMETER_VALUE invalid_indicator_parameter_value 22023 E ERRCODE_INVALID_PARAMETER_VALUE invalid_parameter_value 22013 E ERRCODE_INVALID_PRECEDING_OR_FOLLOWING_SIZE invalid_preceding_or_following_size 2201B E ERRCODE_INVALID_REGULAR_EXPRESSION invalid_regular_expression 2201W E ERRCODE_INVALID_ROW_COUNT_IN_LIMIT_CLAUSE invalid_row_count_in_limit_clause 2201X E ERRCODE_INVALID_ROW_COUNT_IN_RESULT_OFFSET_CLAUSE invalid_row_count_in_result_offset_clause 2202H E ERRCODE_INVALID_TABLESAMPLE_ARGUMENT invalid_tablesample_argument 2202G E ERRCODE_INVALID_TABLESAMPLE_REPEAT invalid_tablesample_repeat 22009 E ERRCODE_INVALID_TIME_ZONE_DISPLACEMENT_VALUE invalid_time_zone_displacement_value 2200C E ERRCODE_INVALID_USE_OF_ESCAPE_CHARACTER invalid_use_of_escape_character 2200G E ERRCODE_MOST_SPECIFIC_TYPE_MISMATCH most_specific_type_mismatch 22004 E ERRCODE_NULL_VALUE_NOT_ALLOWED null_value_not_allowed 22002 E ERRCODE_NULL_VALUE_NO_INDICATOR_PARAMETER null_value_no_indicator_parameter 22003 E ERRCODE_NUMERIC_VALUE_OUT_OF_RANGE numeric_value_out_of_range 2200H E ERRCODE_SEQUENCE_GENERATOR_LIMIT_EXCEEDED sequence_generator_limit_exceeded 22026 E ERRCODE_STRING_DATA_LENGTH_MISMATCH string_data_length_mismatch 22001 E ERRCODE_STRING_DATA_RIGHT_TRUNCATION string_data_right_truncation 22011 E ERRCODE_SUBSTRING_ERROR substring_error 22027 E ERRCODE_TRIM_ERROR trim_error 22024 E ERRCODE_UNTERMINATED_C_STRING unterminated_c_string 2200F E ERRCODE_ZERO_LENGTH_CHARACTER_STRING zero_length_character_string 22P01 E ERRCODE_FLOATING_POINT_EXCEPTION floating_point_exception 22P02 E ERRCODE_INVALID_TEXT_REPRESENTATION invalid_text_representation 22P03 E ERRCODE_INVALID_BINARY_REPRESENTATION invalid_binary_representation 22P04 E ERRCODE_BAD_COPY_FILE_FORMAT bad_copy_file_format 22P05 E ERRCODE_UNTRANSLATABLE_CHARACTER untranslatable_character 2200L E ERRCODE_NOT_AN_XML_DOCUMENT not_an_xml_document 2200M E ERRCODE_INVALID_XML_DOCUMENT invalid_xml_document 2200N E ERRCODE_INVALID_XML_CONTENT invalid_xml_content 2200S E ERRCODE_INVALID_XML_COMMENT invalid_xml_comment 2200T E ERRCODE_INVALID_XML_PROCESSING_INSTRUCTION invalid_xml_processing_instruction 22030 E ERRCODE_DUPLICATE_JSON_OBJECT_KEY_VALUE duplicate_json_object_key_value 22031 E ERRCODE_INVALID_ARGUMENT_FOR_SQL_JSON_DATETIME_FUNCTION invalid_argument_for_sql_json_datetime_function 22032 E ERRCODE_INVALID_JSON_TEXT invalid_json_text 22033 E ERRCODE_INVALID_SQL_JSON_SUBSCRIPT invalid_sql_json_subscript 22034 E ERRCODE_MORE_THAN_ONE_SQL_JSON_ITEM more_than_one_sql_json_item 22035 E ERRCODE_NO_SQL_JSON_ITEM no_sql_json_item 22036 E ERRCODE_NON_NUMERIC_SQL_JSON_ITEM non_numeric_sql_json_item 22037 E ERRCODE_NON_UNIQUE_KEYS_IN_A_JSON_OBJECT non_unique_keys_in_a_json_object 22038 E ERRCODE_SINGLETON_SQL_JSON_ITEM_REQUIRED singleton_sql_json_item_required 22039 E ERRCODE_SQL_JSON_ARRAY_NOT_FOUND sql_json_array_not_found 2203A E ERRCODE_SQL_JSON_MEMBER_NOT_FOUND sql_json_member_not_found 2203B E ERRCODE_SQL_JSON_NUMBER_NOT_FOUND sql_json_number_not_found 2203C E ERRCODE_SQL_JSON_OBJECT_NOT_FOUND sql_json_object_not_found 2203D E ERRCODE_TOO_MANY_JSON_ARRAY_ELEMENTS too_many_json_array_elements 2203E E ERRCODE_TOO_MANY_JSON_OBJECT_MEMBERS too_many_json_object_members 2203F E ERRCODE_SQL_JSON_SCALAR_REQUIRED sql_json_scalar_required 2203G E ERRCODE_SQL_JSON_ITEM_CANNOT_BE_CAST_TO_TARGET_TYPE sql_json_item_cannot_be_cast_to_target_type Section: Class 23 - Integrity Constraint Violation 23000 E ERRCODE_INTEGRITY_CONSTRAINT_VIOLATION integrity_constraint_violation 23001 E ERRCODE_RESTRICT_VIOLATION restrict_violation 23502 E ERRCODE_NOT_NULL_VIOLATION not_null_violation 23503 E ERRCODE_FOREIGN_KEY_VIOLATION foreign_key_violation 23505 E ERRCODE_UNIQUE_VIOLATION unique_violation 23514 E ERRCODE_CHECK_VIOLATION check_violation 23P01 E ERRCODE_EXCLUSION_VIOLATION exclusion_violation Section: Class 24 - Invalid Cursor State 24000 E ERRCODE_INVALID_CURSOR_STATE invalid_cursor_state Section: Class 25 - Invalid Transaction State 25000 E ERRCODE_INVALID_TRANSACTION_STATE invalid_transaction_state 25001 E ERRCODE_ACTIVE_SQL_TRANSACTION active_sql_transaction 25002 E ERRCODE_BRANCH_TRANSACTION_ALREADY_ACTIVE branch_transaction_already_active 25008 E ERRCODE_HELD_CURSOR_REQUIRES_SAME_ISOLATION_LEVEL held_cursor_requires_same_isolation_level 25003 E ERRCODE_INAPPROPRIATE_ACCESS_MODE_FOR_BRANCH_TRANSACTION inappropriate_access_mode_for_branch_transaction 25004 E ERRCODE_INAPPROPRIATE_ISOLATION_LEVEL_FOR_BRANCH_TRANSACTION inappropriate_isolation_level_for_branch_transaction 25005 E ERRCODE_NO_ACTIVE_SQL_TRANSACTION_FOR_BRANCH_TRANSACTION no_active_sql_transaction_for_branch_transaction 25006 E ERRCODE_READ_ONLY_SQL_TRANSACTION read_only_sql_transaction 25007 E ERRCODE_SCHEMA_AND_DATA_STATEMENT_MIXING_NOT_SUPPORTED schema_and_data_statement_mixing_not_supported 25P01 E ERRCODE_NO_ACTIVE_SQL_TRANSACTION no_active_sql_transaction 25P02 E ERRCODE_IN_FAILED_SQL_TRANSACTION in_failed_sql_transaction 25P03 E ERRCODE_IDLE_IN_TRANSACTION_SESSION_TIMEOUT idle_in_transaction_session_timeout 25P04 E ERRCODE_TRANSACTION_TIMEOUT transaction_timeout Section: Class 26 - Invalid SQL Statement Name # (we take this to mean prepared statements 26000 E ERRCODE_INVALID_SQL_STATEMENT_NAME invalid_sql_statement_name Section: Class 27 - Triggered Data Change Violation 27000 E ERRCODE_TRIGGERED_DATA_CHANGE_VIOLATION triggered_data_change_violation Section: Class 28 - Invalid Authorization Specification 28000 E ERRCODE_INVALID_AUTHORIZATION_SPECIFICATION invalid_authorization_specification 28P01 E ERRCODE_INVALID_PASSWORD invalid_password Section: Class 2B - Dependent Privilege Descriptors Still Exist 2B000 E ERRCODE_DEPENDENT_PRIVILEGE_DESCRIPTORS_STILL_EXIST dependent_privilege_descriptors_still_exist 2BP01 E ERRCODE_DEPENDENT_OBJECTS_STILL_EXIST dependent_objects_still_exist Section: Class 2D - Invalid Transaction Termination 2D000 E ERRCODE_INVALID_TRANSACTION_TERMINATION invalid_transaction_termination Section: Class 2F - SQL Routine Exception 2F000 E ERRCODE_SQL_ROUTINE_EXCEPTION sql_routine_exception 2F005 E ERRCODE_S_R_E_FUNCTION_EXECUTED_NO_RETURN_STATEMENT function_executed_no_return_statement 2F002 E ERRCODE_S_R_E_MODIFYING_SQL_DATA_NOT_PERMITTED modifying_sql_data_not_permitted 2F003 E ERRCODE_S_R_E_PROHIBITED_SQL_STATEMENT_ATTEMPTED prohibited_sql_statement_attempted 2F004 E ERRCODE_S_R_E_READING_SQL_DATA_NOT_PERMITTED reading_sql_data_not_permitted Section: Class 34 - Invalid Cursor Name 34000 E ERRCODE_INVALID_CURSOR_NAME invalid_cursor_name Section: Class 38 - External Routine Exception 38000 E ERRCODE_EXTERNAL_ROUTINE_EXCEPTION external_routine_exception 38001 E ERRCODE_E_R_E_CONTAINING_SQL_NOT_PERMITTED containing_sql_not_permitted 38002 E ERRCODE_E_R_E_MODIFYING_SQL_DATA_NOT_PERMITTED modifying_sql_data_not_permitted 38003 E ERRCODE_E_R_E_PROHIBITED_SQL_STATEMENT_ATTEMPTED prohibited_sql_statement_attempted 38004 E ERRCODE_E_R_E_READING_SQL_DATA_NOT_PERMITTED reading_sql_data_not_permitted Section: Class 39 - External Routine Invocation Exception 39000 E ERRCODE_EXTERNAL_ROUTINE_INVOCATION_EXCEPTION external_routine_invocation_exception 39001 E ERRCODE_E_R_I_E_INVALID_SQLSTATE_RETURNED invalid_sqlstate_returned 39004 E ERRCODE_E_R_I_E_NULL_VALUE_NOT_ALLOWED null_value_not_allowed 39P01 E ERRCODE_E_R_I_E_TRIGGER_PROTOCOL_VIOLATED trigger_protocol_violated 39P02 E ERRCODE_E_R_I_E_SRF_PROTOCOL_VIOLATED srf_protocol_violated 39P03 E ERRCODE_E_R_I_E_EVENT_TRIGGER_PROTOCOL_VIOLATED event_trigger_protocol_violated Section: Class 3B - Savepoint Exception 3B000 E ERRCODE_SAVEPOINT_EXCEPTION savepoint_exception 3B001 E ERRCODE_S_E_INVALID_SPECIFICATION invalid_savepoint_specification Section: Class 3D - Invalid Catalog Name 3D000 E ERRCODE_INVALID_CATALOG_NAME invalid_catalog_name Section: Class 3F - Invalid Schema Name 3F000 E ERRCODE_INVALID_SCHEMA_NAME invalid_schema_name Section: Class 40 - Transaction Rollback 40000 E ERRCODE_TRANSACTION_ROLLBACK transaction_rollback 40002 E ERRCODE_T_R_INTEGRITY_CONSTRAINT_VIOLATION transaction_integrity_constraint_violation 40001 E ERRCODE_T_R_SERIALIZATION_FAILURE serialization_failure 40003 E ERRCODE_T_R_STATEMENT_COMPLETION_UNKNOWN statement_completion_unknown 40P01 E ERRCODE_T_R_DEADLOCK_DETECTED deadlock_detected Section: Class 42 - Syntax Error or Access Rule Violation 42000 E ERRCODE_SYNTAX_ERROR_OR_ACCESS_RULE_VIOLATION syntax_error_or_access_rule_violation # never use the above; use one of these two if no specific code exists: 42601 E ERRCODE_SYNTAX_ERROR syntax_error 42501 E ERRCODE_INSUFFICIENT_PRIVILEGE insufficient_privilege 42846 E ERRCODE_CANNOT_COERCE cannot_coerce 42803 E ERRCODE_GROUPING_ERROR grouping_error 42P20 E ERRCODE_WINDOWING_ERROR windowing_error 42P19 E ERRCODE_INVALID_RECURSION invalid_recursion 42830 E ERRCODE_INVALID_FOREIGN_KEY invalid_foreign_key 42602 E ERRCODE_INVALID_NAME invalid_name 42622 E ERRCODE_NAME_TOO_LONG name_too_long 42939 E ERRCODE_RESERVED_NAME reserved_name 42804 E ERRCODE_DATATYPE_MISMATCH datatype_mismatch 42P18 E ERRCODE_INDETERMINATE_DATATYPE indeterminate_datatype 42P21 E ERRCODE_COLLATION_MISMATCH collation_mismatch 42P22 E ERRCODE_INDETERMINATE_COLLATION indeterminate_collation 42809 E ERRCODE_WRONG_OBJECT_TYPE wrong_object_type 428C9 E ERRCODE_GENERATED_ALWAYS generated_always # Note: for ERRCODE purposes, we divide namable objects into these categories: # databases, schemas, prepared statements, cursors, tables, columns, # functions (including operators), and all else (lumped as "objects"). # (The first four categories are mandated by the existence of separate # SQLSTATE classes for them in the spec; in this file, however, we group # the ERRCODE names with all the rest under class 42.) Parameters are # sort-of-named objects and get their own ERRCODE. # # The same breakdown is used for "duplicate" and "ambiguous" complaints, # as well as complaints associated with incorrect declarations. 42703 E ERRCODE_UNDEFINED_COLUMN undefined_column 34000 E ERRCODE_UNDEFINED_CURSOR 3D000 E ERRCODE_UNDEFINED_DATABASE 42883 E ERRCODE_UNDEFINED_FUNCTION undefined_function 26000 E ERRCODE_UNDEFINED_PSTATEMENT 3F000 E ERRCODE_UNDEFINED_SCHEMA 42P01 E ERRCODE_UNDEFINED_TABLE undefined_table 42P02 E ERRCODE_UNDEFINED_PARAMETER undefined_parameter 42704 E ERRCODE_UNDEFINED_OBJECT undefined_object 42701 E ERRCODE_DUPLICATE_COLUMN duplicate_column 42P03 E ERRCODE_DUPLICATE_CURSOR duplicate_cursor 42P04 E ERRCODE_DUPLICATE_DATABASE duplicate_database 42723 E ERRCODE_DUPLICATE_FUNCTION duplicate_function 42P05 E ERRCODE_DUPLICATE_PSTATEMENT duplicate_prepared_statement 42P06 E ERRCODE_DUPLICATE_SCHEMA duplicate_schema 42P07 E ERRCODE_DUPLICATE_TABLE duplicate_table 42712 E ERRCODE_DUPLICATE_ALIAS duplicate_alias 42710 E ERRCODE_DUPLICATE_OBJECT duplicate_object 42702 E ERRCODE_AMBIGUOUS_COLUMN ambiguous_column 42725 E ERRCODE_AMBIGUOUS_FUNCTION ambiguous_function 42P08 E ERRCODE_AMBIGUOUS_PARAMETER ambiguous_parameter 42P09 E ERRCODE_AMBIGUOUS_ALIAS ambiguous_alias 42P10 E ERRCODE_INVALID_COLUMN_REFERENCE invalid_column_reference 42611 E ERRCODE_INVALID_COLUMN_DEFINITION invalid_column_definition 42P11 E ERRCODE_INVALID_CURSOR_DEFINITION invalid_cursor_definition 42P12 E ERRCODE_INVALID_DATABASE_DEFINITION invalid_database_definition 42P13 E ERRCODE_INVALID_FUNCTION_DEFINITION invalid_function_definition 42P14 E ERRCODE_INVALID_PSTATEMENT_DEFINITION invalid_prepared_statement_definition 42P15 E ERRCODE_INVALID_SCHEMA_DEFINITION invalid_schema_definition 42P16 E ERRCODE_INVALID_TABLE_DEFINITION invalid_table_definition 42P17 E ERRCODE_INVALID_OBJECT_DEFINITION invalid_object_definition Section: Class 44 - WITH CHECK OPTION Violation 44000 E ERRCODE_WITH_CHECK_OPTION_VIOLATION with_check_option_violation Section: Class 53 - Insufficient Resources # (PostgreSQL-specific error class) 53000 E ERRCODE_INSUFFICIENT_RESOURCES insufficient_resources 53100 E ERRCODE_DISK_FULL disk_full 53200 E ERRCODE_OUT_OF_MEMORY out_of_memory 53300 E ERRCODE_TOO_MANY_CONNECTIONS too_many_connections 53400 E ERRCODE_CONFIGURATION_LIMIT_EXCEEDED configuration_limit_exceeded Section: Class 54 - Program Limit Exceeded # this is for wired-in limits, not resource exhaustion problems (class borrowed from DB2) 54000 E ERRCODE_PROGRAM_LIMIT_EXCEEDED program_limit_exceeded 54001 E ERRCODE_STATEMENT_TOO_COMPLEX statement_too_complex 54011 E ERRCODE_TOO_MANY_COLUMNS too_many_columns 54023 E ERRCODE_TOO_MANY_ARGUMENTS too_many_arguments Section: Class 55 - Object Not In Prerequisite State # (class borrowed from DB2) 55000 E ERRCODE_OBJECT_NOT_IN_PREREQUISITE_STATE object_not_in_prerequisite_state 55006 E ERRCODE_OBJECT_IN_USE object_in_use 55P02 E ERRCODE_CANT_CHANGE_RUNTIME_PARAM cant_change_runtime_param 55P03 E ERRCODE_LOCK_NOT_AVAILABLE lock_not_available 55P04 E ERRCODE_UNSAFE_NEW_ENUM_VALUE_USAGE unsafe_new_enum_value_usage Section: Class 57 - Operator Intervention # (class borrowed from DB2) 57000 E ERRCODE_OPERATOR_INTERVENTION operator_intervention 57014 E ERRCODE_QUERY_CANCELED query_canceled 57P01 E ERRCODE_ADMIN_SHUTDOWN admin_shutdown 57P02 E ERRCODE_CRASH_SHUTDOWN crash_shutdown 57P03 E ERRCODE_CANNOT_CONNECT_NOW cannot_connect_now 57P04 E ERRCODE_DATABASE_DROPPED database_dropped 57P05 E ERRCODE_IDLE_SESSION_TIMEOUT idle_session_timeout Section: Class 58 - System Error (errors external to PostgreSQL itself) # (class borrowed from DB2) 58000 E ERRCODE_SYSTEM_ERROR system_error 58030 E ERRCODE_IO_ERROR io_error 58P01 E ERRCODE_UNDEFINED_FILE undefined_file 58P02 E ERRCODE_DUPLICATE_FILE duplicate_file Section: Class F0 - Configuration File Error # (PostgreSQL-specific error class) F0000 E ERRCODE_CONFIG_FILE_ERROR config_file_error F0001 E ERRCODE_LOCK_FILE_EXISTS lock_file_exists Section: Class HV - Foreign Data Wrapper Error (SQL/MED) # (SQL/MED-specific error class) HV000 E ERRCODE_FDW_ERROR fdw_error HV005 E ERRCODE_FDW_COLUMN_NAME_NOT_FOUND fdw_column_name_not_found HV002 E ERRCODE_FDW_DYNAMIC_PARAMETER_VALUE_NEEDED fdw_dynamic_parameter_value_needed HV010 E ERRCODE_FDW_FUNCTION_SEQUENCE_ERROR fdw_function_sequence_error HV021 E ERRCODE_FDW_INCONSISTENT_DESCRIPTOR_INFORMATION fdw_inconsistent_descriptor_information HV024 E ERRCODE_FDW_INVALID_ATTRIBUTE_VALUE fdw_invalid_attribute_value HV007 E ERRCODE_FDW_INVALID_COLUMN_NAME fdw_invalid_column_name HV008 E ERRCODE_FDW_INVALID_COLUMN_NUMBER fdw_invalid_column_number HV004 E ERRCODE_FDW_INVALID_DATA_TYPE fdw_invalid_data_type HV006 E ERRCODE_FDW_INVALID_DATA_TYPE_DESCRIPTORS fdw_invalid_data_type_descriptors HV091 E ERRCODE_FDW_INVALID_DESCRIPTOR_FIELD_IDENTIFIER fdw_invalid_descriptor_field_identifier HV00B E ERRCODE_FDW_INVALID_HANDLE fdw_invalid_handle HV00C E ERRCODE_FDW_INVALID_OPTION_INDEX fdw_invalid_option_index HV00D E ERRCODE_FDW_INVALID_OPTION_NAME fdw_invalid_option_name HV090 E ERRCODE_FDW_INVALID_STRING_LENGTH_OR_BUFFER_LENGTH fdw_invalid_string_length_or_buffer_length HV00A E ERRCODE_FDW_INVALID_STRING_FORMAT fdw_invalid_string_format HV009 E ERRCODE_FDW_INVALID_USE_OF_NULL_POINTER fdw_invalid_use_of_null_pointer HV014 E ERRCODE_FDW_TOO_MANY_HANDLES fdw_too_many_handles HV001 E ERRCODE_FDW_OUT_OF_MEMORY fdw_out_of_memory HV00P E ERRCODE_FDW_NO_SCHEMAS fdw_no_schemas HV00J E ERRCODE_FDW_OPTION_NAME_NOT_FOUND fdw_option_name_not_found HV00K E ERRCODE_FDW_REPLY_HANDLE fdw_reply_handle HV00Q E ERRCODE_FDW_SCHEMA_NOT_FOUND fdw_schema_not_found HV00R E ERRCODE_FDW_TABLE_NOT_FOUND fdw_table_not_found HV00L E ERRCODE_FDW_UNABLE_TO_CREATE_EXECUTION fdw_unable_to_create_execution HV00M E ERRCODE_FDW_UNABLE_TO_CREATE_REPLY fdw_unable_to_create_reply HV00N E ERRCODE_FDW_UNABLE_TO_ESTABLISH_CONNECTION fdw_unable_to_establish_connection Section: Class P0 - PL/pgSQL Error # (PostgreSQL-specific error class) P0000 E ERRCODE_PLPGSQL_ERROR plpgsql_error P0001 E ERRCODE_RAISE_EXCEPTION raise_exception P0002 E ERRCODE_NO_DATA_FOUND no_data_found P0003 E ERRCODE_TOO_MANY_ROWS too_many_rows P0004 E ERRCODE_ASSERT_FAILURE assert_failure Section: Class XX - Internal Error # this is for "can't-happen" conditions and software bugs (PostgreSQL-specific error class) XX000 E ERRCODE_INTERNAL_ERROR internal_error XX001 E ERRCODE_DATA_CORRUPTED data_corrupted XX002 E ERRCODE_INDEX_CORRUPTED index_corrupted /* src/pl/plpgsql/src/plpgsql--1.0.sql */ CREATE FUNCTION plpgsql_call_handler() RETURNS language_handler LANGUAGE c AS 'MODULE_PATHNAME'; CREATE FUNCTION plpgsql_inline_handler(internal) RETURNS void STRICT LANGUAGE c AS 'MODULE_PATHNAME'; CREATE FUNCTION plpgsql_validator(oid) RETURNS void STRICT LANGUAGE c AS 'MODULE_PATHNAME'; CREATE TRUSTED LANGUAGE plpgsql HANDLER plpgsql_call_handler INLINE plpgsql_inline_handler VALIDATOR plpgsql_validator; -- The language object, but not the functions, can be owned by a non-superuser. ALTER LANGUAGE plpgsql OWNER TO @extowner@; COMMENT ON LANGUAGE plpgsql IS 'PL/pgSQL procedural language'; # plpgsql extension comment = 'PL/pgSQL procedural language' default_version = '1.0' module_pathname = '$libdir/plpgsql' relocatable = false schema = pg_catalog superuser = true trusted = true /* * SQL Information Schema * as defined in ISO/IEC 9075-11:2023 * * Copyright (c) 2003-2024, PostgreSQL Global Development Group * * src/backend/catalog/information_schema.sql * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ /* * Note: Generally, the definitions in this file should be ordered * according to the clause numbers in the SQL standard, which is also the * alphabetical order. In some cases it is convenient or necessary to * define one information schema view by using another one; in that case, * put the referencing view at the very end and leave a note where it * should have been put. */ /* * 6.2 * INFORMATION_SCHEMA schema */ CREATE SCHEMA information_schema; GRANT USAGE ON SCHEMA information_schema TO PUBLIC; SET search_path TO information_schema; /* * A few supporting functions first ... */ /* Expand any 1-D array into a set with integers 1..N */ CREATE FUNCTION _pg_expandarray(IN anyarray, OUT x anyelement, OUT n int) RETURNS SETOF RECORD LANGUAGE sql STRICT IMMUTABLE PARALLEL SAFE ROWS 100 SUPPORT pg_catalog.array_unnest_support AS 'SELECT * FROM pg_catalog.unnest($1) WITH ORDINALITY'; /* Given an index's OID and an underlying-table column number, return the * column's position in the index (NULL if not there) */ CREATE FUNCTION _pg_index_position(oid, smallint) RETURNS int LANGUAGE sql STRICT STABLE BEGIN ATOMIC SELECT (ss.a).n FROM (SELECT information_schema._pg_expandarray(indkey) AS a FROM pg_catalog.pg_index WHERE indexrelid = $1) ss WHERE (ss.a).x = $2; END; CREATE FUNCTION _pg_truetypid(pg_attribute, pg_type) RETURNS oid LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $2.typtype = 'd' THEN $2.typbasetype ELSE $1.atttypid END; CREATE FUNCTION _pg_truetypmod(pg_attribute, pg_type) RETURNS int4 LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $2.typtype = 'd' THEN $2.typtypmod ELSE $1.atttypmod END; -- these functions encapsulate knowledge about the encoding of typmod: CREATE FUNCTION _pg_char_max_length(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $2 = -1 /* default typmod */ THEN null WHEN $1 IN (1042, 1043) /* char, varchar */ THEN $2 - 4 WHEN $1 IN (1560, 1562) /* bit, varbit */ THEN $2 ELSE null END; CREATE FUNCTION _pg_char_octet_length(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $1 IN (25, 1042, 1043) /* text, char, varchar */ THEN CASE WHEN $2 = -1 /* default typmod */ THEN CAST(2^30 AS integer) ELSE information_schema._pg_char_max_length($1, $2) * pg_catalog.pg_encoding_max_length((SELECT encoding FROM pg_catalog.pg_database WHERE datname = pg_catalog.current_database())) END ELSE null END; CREATE FUNCTION _pg_numeric_precision(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE $1 WHEN 21 /*int2*/ THEN 16 WHEN 23 /*int4*/ THEN 32 WHEN 20 /*int8*/ THEN 64 WHEN 1700 /*numeric*/ THEN CASE WHEN $2 = -1 THEN null ELSE (($2 - 4) >> 16) & 0xFFFF END WHEN 700 /*float4*/ THEN 24 /*FLT_MANT_DIG*/ WHEN 701 /*float8*/ THEN 53 /*DBL_MANT_DIG*/ ELSE null END; CREATE FUNCTION _pg_numeric_precision_radix(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $1 IN (21, 23, 20, 700, 701) THEN 2 WHEN $1 IN (1700) THEN 10 ELSE null END; CREATE FUNCTION _pg_numeric_scale(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $1 IN (21, 23, 20) THEN 0 WHEN $1 IN (1700) THEN CASE WHEN $2 = -1 THEN null ELSE ($2 - 4) & 0xFFFF END ELSE null END; CREATE FUNCTION _pg_datetime_precision(typid oid, typmod int4) RETURNS integer LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $1 IN (1082) /* date */ THEN 0 WHEN $1 IN (1083, 1114, 1184, 1266) /* time, timestamp, same + tz */ THEN CASE WHEN $2 < 0 THEN 6 ELSE $2 END WHEN $1 IN (1186) /* interval */ THEN CASE WHEN $2 < 0 OR $2 & 0xFFFF = 0xFFFF THEN 6 ELSE $2 & 0xFFFF END ELSE null END; CREATE FUNCTION _pg_interval_type(typid oid, mod int4) RETURNS text LANGUAGE sql IMMUTABLE PARALLEL SAFE RETURNS NULL ON NULL INPUT RETURN CASE WHEN $1 IN (1186) /* interval */ THEN pg_catalog.upper(substring(pg_catalog.format_type($1, $2) similar 'interval[()0-9]* #"%#"' escape '#')) ELSE null END; -- 6.3 INFORMATION_SCHEMA_CATALOG_NAME view appears later. /* * 6.4 * CARDINAL_NUMBER domain */ CREATE DOMAIN cardinal_number AS integer CONSTRAINT cardinal_number_domain_check CHECK (value >= 0); /* * 6.5 * CHARACTER_DATA domain */ CREATE DOMAIN character_data AS character varying COLLATE "C"; /* * 6.6 * SQL_IDENTIFIER domain */ CREATE DOMAIN sql_identifier AS name; /* * 6.3 * INFORMATION_SCHEMA_CATALOG_NAME view */ CREATE VIEW information_schema_catalog_name AS SELECT CAST(current_database() AS sql_identifier) AS catalog_name; GRANT SELECT ON information_schema_catalog_name TO PUBLIC; /* * 6.7 * TIME_STAMP domain */ CREATE DOMAIN time_stamp AS timestamp(2) with time zone DEFAULT current_timestamp(2); /* * 6.8 * YES_OR_NO domain */ CREATE DOMAIN yes_or_no AS character varying(3) COLLATE "C" CONSTRAINT yes_or_no_check CHECK (value IN ('YES', 'NO')); -- 6.9 ADMINISTRABLE_ROLE_AUTHORIZATIONS view appears later. /* * 6.10 * APPLICABLE_ROLES view */ CREATE VIEW applicable_roles AS SELECT CAST(a.rolname AS sql_identifier) AS grantee, CAST(b.rolname AS sql_identifier) AS role_name, CAST(CASE WHEN m.admin_option THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM (SELECT member, roleid, admin_option FROM pg_auth_members -- This UNION could be UNION ALL, but UNION works even if we start -- to allow explicit pg_database_owner membership. UNION SELECT datdba, pg_authid.oid, false FROM pg_database, pg_authid WHERE datname = current_database() AND rolname = 'pg_database_owner' ) m JOIN pg_authid a ON (m.member = a.oid) JOIN pg_authid b ON (m.roleid = b.oid) WHERE pg_has_role(a.oid, 'USAGE'); GRANT SELECT ON applicable_roles TO PUBLIC; /* * 6.9 * ADMINISTRABLE_ROLE_AUTHORIZATIONS view */ CREATE VIEW administrable_role_authorizations AS SELECT * FROM applicable_roles WHERE is_grantable = 'YES'; GRANT SELECT ON administrable_role_authorizations TO PUBLIC; /* * 6.11 * ASSERTIONS view */ -- feature not supported /* * 6.12 * ATTRIBUTES view */ CREATE VIEW attributes AS SELECT CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nc.nspname AS sql_identifier) AS udt_schema, CAST(c.relname AS sql_identifier) AS udt_name, CAST(a.attname AS sql_identifier) AS attribute_name, CAST(a.attnum AS cardinal_number) AS ordinal_position, CAST(pg_get_expr(ad.adbin, ad.adrelid) AS character_data) AS attribute_default, CAST(CASE WHEN a.attnotnull OR (t.typtype = 'd' AND t.typnotnull) THEN 'NO' ELSE 'YES' END AS yes_or_no) AS is_nullable, -- This column was apparently removed between SQL:2003 and SQL:2008. CAST( CASE WHEN t.typelem <> 0 AND t.typlen = -1 THEN 'ARRAY' WHEN nt.nspname = 'pg_catalog' THEN format_type(a.atttypid, null) ELSE 'USER-DEFINED' END AS character_data) AS data_type, CAST( _pg_char_max_length(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS character_maximum_length, CAST( _pg_char_octet_length(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(CASE WHEN nco.nspname IS NOT NULL THEN current_database() END AS sql_identifier) AS collation_catalog, CAST(nco.nspname AS sql_identifier) AS collation_schema, CAST(co.collname AS sql_identifier) AS collation_name, CAST( _pg_numeric_precision(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_precision, CAST( _pg_numeric_precision_radix(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_precision_radix, CAST( _pg_numeric_scale(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_scale, CAST( _pg_datetime_precision(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS datetime_precision, CAST( _pg_interval_type(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(current_database() AS sql_identifier) AS attribute_udt_catalog, CAST(nt.nspname AS sql_identifier) AS attribute_udt_schema, CAST(t.typname AS sql_identifier) AS attribute_udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST(a.attnum AS sql_identifier) AS dtd_identifier, CAST('NO' AS yes_or_no) AS is_derived_reference_attribute FROM (pg_attribute a LEFT JOIN pg_attrdef ad ON attrelid = adrelid AND attnum = adnum) JOIN (pg_class c JOIN pg_namespace nc ON (c.relnamespace = nc.oid)) ON a.attrelid = c.oid JOIN (pg_type t JOIN pg_namespace nt ON (t.typnamespace = nt.oid)) ON a.atttypid = t.oid LEFT JOIN (pg_collation co JOIN pg_namespace nco ON (co.collnamespace = nco.oid)) ON a.attcollation = co.oid AND (nco.nspname, co.collname) <> ('pg_catalog', 'default') WHERE a.attnum > 0 AND NOT a.attisdropped AND c.relkind IN ('c') AND (pg_has_role(c.relowner, 'USAGE') OR has_type_privilege(c.reltype, 'USAGE')); GRANT SELECT ON attributes TO PUBLIC; /* * 6.13 * CHARACTER_SETS view */ CREATE VIEW character_sets AS SELECT CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(getdatabaseencoding() AS sql_identifier) AS character_set_name, CAST(CASE WHEN getdatabaseencoding() = 'UTF8' THEN 'UCS' ELSE getdatabaseencoding() END AS sql_identifier) AS character_repertoire, CAST(getdatabaseencoding() AS sql_identifier) AS form_of_use, CAST(current_database() AS sql_identifier) AS default_collate_catalog, CAST(nc.nspname AS sql_identifier) AS default_collate_schema, CAST(c.collname AS sql_identifier) AS default_collate_name FROM pg_database d LEFT JOIN (pg_collation c JOIN pg_namespace nc ON (c.collnamespace = nc.oid)) ON (datcollate = collcollate AND datctype = collctype) WHERE d.datname = current_database() ORDER BY char_length(c.collname) DESC, c.collname ASC -- prefer full/canonical name LIMIT 1; GRANT SELECT ON character_sets TO PUBLIC; /* * 6.14 * CHECK_CONSTRAINT_ROUTINE_USAGE view */ CREATE VIEW check_constraint_routine_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(nc.nspname AS sql_identifier) AS constraint_schema, CAST(c.conname AS sql_identifier) AS constraint_name, CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name FROM pg_namespace nc, pg_constraint c, pg_depend d, pg_proc p, pg_namespace np WHERE nc.oid = c.connamespace AND c.contype = 'c' AND c.oid = d.objid AND d.classid = 'pg_catalog.pg_constraint'::regclass AND d.refobjid = p.oid AND d.refclassid = 'pg_catalog.pg_proc'::regclass AND p.pronamespace = np.oid AND pg_has_role(p.proowner, 'USAGE'); GRANT SELECT ON check_constraint_routine_usage TO PUBLIC; /* * 6.15 * CHECK_CONSTRAINTS view */ CREATE VIEW check_constraints AS SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(rs.nspname AS sql_identifier) AS constraint_schema, CAST(con.conname AS sql_identifier) AS constraint_name, CAST(pg_get_expr(con.conbin, coalesce(c.oid, 0)) AS character_data) AS check_clause FROM pg_constraint con LEFT OUTER JOIN pg_namespace rs ON (rs.oid = con.connamespace) LEFT OUTER JOIN pg_class c ON (c.oid = con.conrelid) LEFT OUTER JOIN pg_type t ON (t.oid = con.contypid) WHERE pg_has_role(coalesce(c.relowner, t.typowner), 'USAGE') AND con.contype = 'c' UNION -- not-null constraints on domains SELECT current_database()::information_schema.sql_identifier AS constraint_catalog, rs.nspname::information_schema.sql_identifier AS constraint_schema, con.conname::information_schema.sql_identifier AS constraint_name, pg_catalog.format('%s IS NOT NULL', coalesce(at.attname, 'VALUE'))::information_schema.character_data AS check_clause FROM pg_constraint con LEFT JOIN pg_namespace rs ON rs.oid = con.connamespace LEFT JOIN pg_class c ON c.oid = con.conrelid LEFT JOIN pg_type t ON t.oid = con.contypid LEFT JOIN pg_attribute at ON (con.conrelid = at.attrelid AND con.conkey[1] = at.attnum) WHERE pg_has_role(coalesce(c.relowner, t.typowner), 'USAGE'::text) AND con.contype = 'n' UNION -- not-null constraints on relations SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(n.nspname AS sql_identifier) AS constraint_schema, CAST(CAST(n.oid AS text) || '_' || CAST(r.oid AS text) || '_' || CAST(a.attnum AS text) || '_not_null' AS sql_identifier) AS constraint_name, -- XXX CAST(a.attname || ' IS NOT NULL' AS character_data) AS check_clause FROM pg_namespace n, pg_class r, pg_attribute a WHERE n.oid = r.relnamespace AND r.oid = a.attrelid AND a.attnum > 0 AND NOT a.attisdropped AND a.attnotnull AND r.relkind IN ('r', 'p') AND pg_has_role(r.relowner, 'USAGE'); GRANT SELECT ON check_constraints TO PUBLIC; /* * 6.16 * COLLATIONS view */ CREATE VIEW collations AS SELECT CAST(current_database() AS sql_identifier) AS collation_catalog, CAST(nc.nspname AS sql_identifier) AS collation_schema, CAST(c.collname AS sql_identifier) AS collation_name, CAST('NO PAD' AS character_data) AS pad_attribute FROM pg_collation c, pg_namespace nc WHERE c.collnamespace = nc.oid AND collencoding IN (-1, (SELECT encoding FROM pg_database WHERE datname = current_database())); GRANT SELECT ON collations TO PUBLIC; /* * 6.17 * COLLATION_CHARACTER_SET_APPLICABILITY view */ CREATE VIEW collation_character_set_applicability AS SELECT CAST(current_database() AS sql_identifier) AS collation_catalog, CAST(nc.nspname AS sql_identifier) AS collation_schema, CAST(c.collname AS sql_identifier) AS collation_name, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(getdatabaseencoding() AS sql_identifier) AS character_set_name FROM pg_collation c, pg_namespace nc WHERE c.collnamespace = nc.oid AND collencoding IN (-1, (SELECT encoding FROM pg_database WHERE datname = current_database())); GRANT SELECT ON collation_character_set_applicability TO PUBLIC; /* * 6.18 * COLUMN_COLUMN_USAGE view */ CREATE VIEW column_column_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(n.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(ac.attname AS sql_identifier) AS column_name, CAST(ad.attname AS sql_identifier) AS dependent_column FROM pg_namespace n, pg_class c, pg_depend d, pg_attribute ac, pg_attribute ad, pg_attrdef atd WHERE n.oid = c.relnamespace AND c.oid = ac.attrelid AND c.oid = ad.attrelid AND ac.attnum <> ad.attnum AND ad.attrelid = atd.adrelid AND ad.attnum = atd.adnum AND d.classid = 'pg_catalog.pg_attrdef'::regclass AND d.refclassid = 'pg_catalog.pg_class'::regclass AND d.objid = atd.oid AND d.refobjid = ac.attrelid AND d.refobjsubid = ac.attnum AND ad.attgenerated <> '' AND pg_has_role(c.relowner, 'USAGE'); GRANT SELECT ON column_column_usage TO PUBLIC; /* * 6.19 * COLUMN_DOMAIN_USAGE view */ CREATE VIEW column_domain_usage AS SELECT CAST(current_database() AS sql_identifier) AS domain_catalog, CAST(nt.nspname AS sql_identifier) AS domain_schema, CAST(t.typname AS sql_identifier) AS domain_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name FROM pg_type t, pg_namespace nt, pg_class c, pg_namespace nc, pg_attribute a WHERE t.typnamespace = nt.oid AND c.relnamespace = nc.oid AND a.attrelid = c.oid AND a.atttypid = t.oid AND t.typtype = 'd' AND c.relkind IN ('r', 'v', 'f', 'p') AND a.attnum > 0 AND NOT a.attisdropped AND pg_has_role(t.typowner, 'USAGE'); GRANT SELECT ON column_domain_usage TO PUBLIC; /* * 6.20 * COLUMN_PRIVILEGES */ CREATE VIEW column_privileges AS SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(x.relname AS sql_identifier) AS table_name, CAST(x.attname AS sql_identifier) AS column_name, CAST(x.prtype AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(x.grantee, x.relowner, 'USAGE') OR x.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT pr_c.grantor, pr_c.grantee, attname, relname, relnamespace, pr_c.prtype, pr_c.grantable, pr_c.relowner FROM (SELECT oid, relname, relnamespace, relowner, (aclexplode(coalesce(relacl, acldefault('r', relowner)))).* FROM pg_class WHERE relkind IN ('r', 'v', 'f', 'p') ) pr_c (oid, relname, relnamespace, relowner, grantor, grantee, prtype, grantable), pg_attribute a WHERE a.attrelid = pr_c.oid AND a.attnum > 0 AND NOT a.attisdropped UNION SELECT pr_a.grantor, pr_a.grantee, attname, relname, relnamespace, pr_a.prtype, pr_a.grantable, c.relowner FROM (SELECT attrelid, attname, (aclexplode(coalesce(attacl, acldefault('c', relowner)))).* FROM pg_attribute a JOIN pg_class cc ON (a.attrelid = cc.oid) WHERE attnum > 0 AND NOT attisdropped ) pr_a (attrelid, attname, grantor, grantee, prtype, grantable), pg_class c WHERE pr_a.attrelid = c.oid AND relkind IN ('r', 'v', 'f', 'p') ) x, pg_namespace nc, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE x.relnamespace = nc.oid AND x.grantee = grantee.oid AND x.grantor = u_grantor.oid AND x.prtype IN ('INSERT', 'SELECT', 'UPDATE', 'REFERENCES') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC'); GRANT SELECT ON column_privileges TO PUBLIC; /* * 6.21 * COLUMN_UDT_USAGE view */ CREATE VIEW column_udt_usage AS SELECT CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(coalesce(nbt.nspname, nt.nspname) AS sql_identifier) AS udt_schema, CAST(coalesce(bt.typname, t.typname) AS sql_identifier) AS udt_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name FROM pg_attribute a, pg_class c, pg_namespace nc, (pg_type t JOIN pg_namespace nt ON (t.typnamespace = nt.oid)) LEFT JOIN (pg_type bt JOIN pg_namespace nbt ON (bt.typnamespace = nbt.oid)) ON (t.typtype = 'd' AND t.typbasetype = bt.oid) WHERE a.attrelid = c.oid AND a.atttypid = t.oid AND nc.oid = c.relnamespace AND a.attnum > 0 AND NOT a.attisdropped AND c.relkind in ('r', 'v', 'f', 'p') AND pg_has_role(coalesce(bt.typowner, t.typowner), 'USAGE'); GRANT SELECT ON column_udt_usage TO PUBLIC; /* * 6.22 * COLUMNS view */ CREATE VIEW columns AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name, CAST(a.attnum AS cardinal_number) AS ordinal_position, CAST(CASE WHEN a.attgenerated = '' THEN pg_get_expr(ad.adbin, ad.adrelid) END AS character_data) AS column_default, CAST(CASE WHEN a.attnotnull OR (t.typtype = 'd' AND t.typnotnull) THEN 'NO' ELSE 'YES' END AS yes_or_no) AS is_nullable, CAST( CASE WHEN t.typtype = 'd' THEN CASE WHEN bt.typelem <> 0 AND bt.typlen = -1 THEN 'ARRAY' WHEN nbt.nspname = 'pg_catalog' THEN format_type(t.typbasetype, null) ELSE 'USER-DEFINED' END ELSE CASE WHEN t.typelem <> 0 AND t.typlen = -1 THEN 'ARRAY' WHEN nt.nspname = 'pg_catalog' THEN format_type(a.atttypid, null) ELSE 'USER-DEFINED' END END AS character_data) AS data_type, CAST( _pg_char_max_length(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS character_maximum_length, CAST( _pg_char_octet_length(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS character_octet_length, CAST( _pg_numeric_precision(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_precision, CAST( _pg_numeric_precision_radix(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_precision_radix, CAST( _pg_numeric_scale(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS numeric_scale, CAST( _pg_datetime_precision(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS cardinal_number) AS datetime_precision, CAST( _pg_interval_type(_pg_truetypid(a, t), _pg_truetypmod(a, t)) AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(CASE WHEN nco.nspname IS NOT NULL THEN current_database() END AS sql_identifier) AS collation_catalog, CAST(nco.nspname AS sql_identifier) AS collation_schema, CAST(co.collname AS sql_identifier) AS collation_name, CAST(CASE WHEN t.typtype = 'd' THEN current_database() ELSE null END AS sql_identifier) AS domain_catalog, CAST(CASE WHEN t.typtype = 'd' THEN nt.nspname ELSE null END AS sql_identifier) AS domain_schema, CAST(CASE WHEN t.typtype = 'd' THEN t.typname ELSE null END AS sql_identifier) AS domain_name, CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(coalesce(nbt.nspname, nt.nspname) AS sql_identifier) AS udt_schema, CAST(coalesce(bt.typname, t.typname) AS sql_identifier) AS udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST(a.attnum AS sql_identifier) AS dtd_identifier, CAST('NO' AS yes_or_no) AS is_self_referencing, CAST(CASE WHEN a.attidentity IN ('a', 'd') THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_identity, CAST(CASE a.attidentity WHEN 'a' THEN 'ALWAYS' WHEN 'd' THEN 'BY DEFAULT' END AS character_data) AS identity_generation, CAST(seq.seqstart AS character_data) AS identity_start, CAST(seq.seqincrement AS character_data) AS identity_increment, CAST(seq.seqmax AS character_data) AS identity_maximum, CAST(seq.seqmin AS character_data) AS identity_minimum, CAST(CASE WHEN seq.seqcycle THEN 'YES' ELSE 'NO' END AS yes_or_no) AS identity_cycle, CAST(CASE WHEN a.attgenerated <> '' THEN 'ALWAYS' ELSE 'NEVER' END AS character_data) AS is_generated, CAST(CASE WHEN a.attgenerated <> '' THEN pg_get_expr(ad.adbin, ad.adrelid) END AS character_data) AS generation_expression, CAST(CASE WHEN c.relkind IN ('r', 'p') OR (c.relkind IN ('v', 'f') AND pg_column_is_updatable(c.oid, a.attnum, false)) THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_updatable FROM (pg_attribute a LEFT JOIN pg_attrdef ad ON attrelid = adrelid AND attnum = adnum) JOIN (pg_class c JOIN pg_namespace nc ON (c.relnamespace = nc.oid)) ON a.attrelid = c.oid JOIN (pg_type t JOIN pg_namespace nt ON (t.typnamespace = nt.oid)) ON a.atttypid = t.oid LEFT JOIN (pg_type bt JOIN pg_namespace nbt ON (bt.typnamespace = nbt.oid)) ON (t.typtype = 'd' AND t.typbasetype = bt.oid) LEFT JOIN (pg_collation co JOIN pg_namespace nco ON (co.collnamespace = nco.oid)) ON a.attcollation = co.oid AND (nco.nspname, co.collname) <> ('pg_catalog', 'default') LEFT JOIN (pg_depend dep JOIN pg_sequence seq ON (dep.classid = 'pg_class'::regclass AND dep.objid = seq.seqrelid AND dep.deptype = 'i')) ON (dep.refclassid = 'pg_class'::regclass AND dep.refobjid = c.oid AND dep.refobjsubid = a.attnum) WHERE (NOT pg_is_other_temp_schema(nc.oid)) AND a.attnum > 0 AND NOT a.attisdropped AND c.relkind IN ('r', 'v', 'f', 'p') AND (pg_has_role(c.relowner, 'USAGE') OR has_column_privilege(c.oid, a.attnum, 'SELECT, INSERT, UPDATE, REFERENCES')); GRANT SELECT ON columns TO PUBLIC; /* * 6.23 * CONSTRAINT_COLUMN_USAGE view */ CREATE VIEW constraint_column_usage AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(tblschema AS sql_identifier) AS table_schema, CAST(tblname AS sql_identifier) AS table_name, CAST(colname AS sql_identifier) AS column_name, CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(cstrschema AS sql_identifier) AS constraint_schema, CAST(cstrname AS sql_identifier) AS constraint_name FROM ( /* check constraints */ SELECT DISTINCT nr.nspname, r.relname, r.relowner, a.attname, nc.nspname, c.conname FROM pg_namespace nr, pg_class r, pg_attribute a, pg_depend d, pg_namespace nc, pg_constraint c WHERE nr.oid = r.relnamespace AND r.oid = a.attrelid AND d.refclassid = 'pg_catalog.pg_class'::regclass AND d.refobjid = r.oid AND d.refobjsubid = a.attnum AND d.classid = 'pg_catalog.pg_constraint'::regclass AND d.objid = c.oid AND c.connamespace = nc.oid AND c.contype = 'c' AND r.relkind IN ('r', 'p') AND NOT a.attisdropped UNION ALL /* unique/primary key/foreign key constraints */ SELECT nr.nspname, r.relname, r.relowner, a.attname, nc.nspname, c.conname FROM pg_namespace nr, pg_class r, pg_attribute a, pg_namespace nc, pg_constraint c WHERE nr.oid = r.relnamespace AND r.oid = a.attrelid AND nc.oid = c.connamespace AND r.oid = CASE c.contype WHEN 'f' THEN c.confrelid ELSE c.conrelid END AND a.attnum = ANY (CASE c.contype WHEN 'f' THEN c.confkey ELSE c.conkey END) AND NOT a.attisdropped AND c.contype IN ('p', 'u', 'f') AND r.relkind IN ('r', 'p') ) AS x (tblschema, tblname, tblowner, colname, cstrschema, cstrname) WHERE pg_has_role(x.tblowner, 'USAGE'); GRANT SELECT ON constraint_column_usage TO PUBLIC; /* * 6.24 * CONSTRAINT_PERIOD_USAGE view */ -- feature not supported /* * 6.25 * CONSTRAINT_TABLE_USAGE view */ CREATE VIEW constraint_table_usage AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nr.nspname AS sql_identifier) AS table_schema, CAST(r.relname AS sql_identifier) AS table_name, CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(nc.nspname AS sql_identifier) AS constraint_schema, CAST(c.conname AS sql_identifier) AS constraint_name FROM pg_constraint c, pg_namespace nc, pg_class r, pg_namespace nr WHERE c.connamespace = nc.oid AND r.relnamespace = nr.oid AND ( (c.contype = 'f' AND c.confrelid = r.oid) OR (c.contype IN ('p', 'u') AND c.conrelid = r.oid) ) AND r.relkind IN ('r', 'p') AND pg_has_role(r.relowner, 'USAGE'); GRANT SELECT ON constraint_table_usage TO PUBLIC; -- 6.26 DATA_TYPE_PRIVILEGES view appears later. /* * 6.27 * DIRECT_SUPERTABLES view */ -- feature not supported /* * 6.28 * DIRECT_SUPERTYPES view */ -- feature not supported /* * 6.29 * DOMAIN_CONSTRAINTS view */ CREATE VIEW domain_constraints AS SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(rs.nspname AS sql_identifier) AS constraint_schema, CAST(con.conname AS sql_identifier) AS constraint_name, CAST(current_database() AS sql_identifier) AS domain_catalog, CAST(n.nspname AS sql_identifier) AS domain_schema, CAST(t.typname AS sql_identifier) AS domain_name, CAST(CASE WHEN condeferrable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_deferrable, CAST(CASE WHEN condeferred THEN 'YES' ELSE 'NO' END AS yes_or_no) AS initially_deferred FROM pg_namespace rs, pg_namespace n, pg_constraint con, pg_type t WHERE rs.oid = con.connamespace AND n.oid = t.typnamespace AND t.oid = con.contypid AND (pg_has_role(t.typowner, 'USAGE') OR has_type_privilege(t.oid, 'USAGE')); GRANT SELECT ON domain_constraints TO PUBLIC; /* * DOMAIN_UDT_USAGE view * apparently removed in SQL:2003 */ CREATE VIEW domain_udt_usage AS SELECT CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nbt.nspname AS sql_identifier) AS udt_schema, CAST(bt.typname AS sql_identifier) AS udt_name, CAST(current_database() AS sql_identifier) AS domain_catalog, CAST(nt.nspname AS sql_identifier) AS domain_schema, CAST(t.typname AS sql_identifier) AS domain_name FROM pg_type t, pg_namespace nt, pg_type bt, pg_namespace nbt WHERE t.typnamespace = nt.oid AND t.typbasetype = bt.oid AND bt.typnamespace = nbt.oid AND t.typtype = 'd' AND pg_has_role(bt.typowner, 'USAGE'); GRANT SELECT ON domain_udt_usage TO PUBLIC; /* * 6.30 * DOMAINS view */ CREATE VIEW domains AS SELECT CAST(current_database() AS sql_identifier) AS domain_catalog, CAST(nt.nspname AS sql_identifier) AS domain_schema, CAST(t.typname AS sql_identifier) AS domain_name, CAST( CASE WHEN t.typelem <> 0 AND t.typlen = -1 THEN 'ARRAY' WHEN nbt.nspname = 'pg_catalog' THEN format_type(t.typbasetype, null) ELSE 'USER-DEFINED' END AS character_data) AS data_type, CAST( _pg_char_max_length(t.typbasetype, t.typtypmod) AS cardinal_number) AS character_maximum_length, CAST( _pg_char_octet_length(t.typbasetype, t.typtypmod) AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(CASE WHEN nco.nspname IS NOT NULL THEN current_database() END AS sql_identifier) AS collation_catalog, CAST(nco.nspname AS sql_identifier) AS collation_schema, CAST(co.collname AS sql_identifier) AS collation_name, CAST( _pg_numeric_precision(t.typbasetype, t.typtypmod) AS cardinal_number) AS numeric_precision, CAST( _pg_numeric_precision_radix(t.typbasetype, t.typtypmod) AS cardinal_number) AS numeric_precision_radix, CAST( _pg_numeric_scale(t.typbasetype, t.typtypmod) AS cardinal_number) AS numeric_scale, CAST( _pg_datetime_precision(t.typbasetype, t.typtypmod) AS cardinal_number) AS datetime_precision, CAST( _pg_interval_type(t.typbasetype, t.typtypmod) AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(t.typdefault AS character_data) AS domain_default, CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nbt.nspname AS sql_identifier) AS udt_schema, CAST(bt.typname AS sql_identifier) AS udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST(1 AS sql_identifier) AS dtd_identifier FROM (pg_type t JOIN pg_namespace nt ON t.typnamespace = nt.oid) JOIN (pg_type bt JOIN pg_namespace nbt ON bt.typnamespace = nbt.oid) ON (t.typbasetype = bt.oid AND t.typtype = 'd') LEFT JOIN (pg_collation co JOIN pg_namespace nco ON (co.collnamespace = nco.oid)) ON t.typcollation = co.oid AND (nco.nspname, co.collname) <> ('pg_catalog', 'default') WHERE (pg_has_role(t.typowner, 'USAGE') OR has_type_privilege(t.oid, 'USAGE')); GRANT SELECT ON domains TO PUBLIC; -- 6.31 ELEMENT_TYPES view appears later. /* * 6.32 * ENABLED_ROLES view */ CREATE VIEW enabled_roles AS SELECT CAST(a.rolname AS sql_identifier) AS role_name FROM pg_authid a WHERE pg_has_role(a.oid, 'USAGE'); GRANT SELECT ON enabled_roles TO PUBLIC; /* * 6.33 * FIELDS view */ -- feature not supported /* * 6.34 * KEY_COLUMN_USAGE view */ CREATE VIEW key_column_usage AS SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(nc_nspname AS sql_identifier) AS constraint_schema, CAST(conname AS sql_identifier) AS constraint_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nr_nspname AS sql_identifier) AS table_schema, CAST(relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name, CAST((ss.x).n AS cardinal_number) AS ordinal_position, CAST(CASE WHEN contype = 'f' THEN _pg_index_position(ss.conindid, ss.confkey[(ss.x).n]) ELSE NULL END AS cardinal_number) AS position_in_unique_constraint FROM pg_attribute a, (SELECT r.oid AS roid, r.relname, r.relowner, nc.nspname AS nc_nspname, nr.nspname AS nr_nspname, c.oid AS coid, c.conname, c.contype, c.conindid, c.confkey, c.confrelid, _pg_expandarray(c.conkey) AS x FROM pg_namespace nr, pg_class r, pg_namespace nc, pg_constraint c WHERE nr.oid = r.relnamespace AND r.oid = c.conrelid AND nc.oid = c.connamespace AND c.contype IN ('p', 'u', 'f') AND r.relkind IN ('r', 'p') AND (NOT pg_is_other_temp_schema(nr.oid)) ) AS ss WHERE ss.roid = a.attrelid AND a.attnum = (ss.x).x AND NOT a.attisdropped AND (pg_has_role(relowner, 'USAGE') OR has_column_privilege(roid, a.attnum, 'SELECT, INSERT, UPDATE, REFERENCES')); GRANT SELECT ON key_column_usage TO PUBLIC; /* * 6.35 * KEY_PERIOD_USAGE view */ -- feature not supported /* * 6.36 * METHOD_SPECIFICATION_PARAMETERS view */ -- feature not supported /* * 6.37 * METHOD_SPECIFICATIONS view */ -- feature not supported /* * 6.38 * PARAMETERS view */ CREATE VIEW parameters AS SELECT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(n_nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(proname, p_oid) AS sql_identifier) AS specific_name, CAST((ss.x).n AS cardinal_number) AS ordinal_position, CAST( CASE WHEN proargmodes IS NULL THEN 'IN' WHEN proargmodes[(ss.x).n] = 'i' THEN 'IN' WHEN proargmodes[(ss.x).n] = 'o' THEN 'OUT' WHEN proargmodes[(ss.x).n] = 'b' THEN 'INOUT' WHEN proargmodes[(ss.x).n] = 'v' THEN 'IN' WHEN proargmodes[(ss.x).n] = 't' THEN 'OUT' END AS character_data) AS parameter_mode, CAST('NO' AS yes_or_no) AS is_result, CAST('NO' AS yes_or_no) AS as_locator, CAST(NULLIF(proargnames[(ss.x).n], '') AS sql_identifier) AS parameter_name, CAST( CASE WHEN t.typelem <> 0 AND t.typlen = -1 THEN 'ARRAY' WHEN nt.nspname = 'pg_catalog' THEN format_type(t.oid, null) ELSE 'USER-DEFINED' END AS character_data) AS data_type, CAST(null AS cardinal_number) AS character_maximum_length, CAST(null AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(null AS sql_identifier) AS collation_catalog, CAST(null AS sql_identifier) AS collation_schema, CAST(null AS sql_identifier) AS collation_name, CAST(null AS cardinal_number) AS numeric_precision, CAST(null AS cardinal_number) AS numeric_precision_radix, CAST(null AS cardinal_number) AS numeric_scale, CAST(null AS cardinal_number) AS datetime_precision, CAST(null AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nt.nspname AS sql_identifier) AS udt_schema, CAST(t.typname AS sql_identifier) AS udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST((ss.x).n AS sql_identifier) AS dtd_identifier, CAST( CASE WHEN pg_has_role(proowner, 'USAGE') THEN pg_get_function_arg_default(p_oid, (ss.x).n) ELSE NULL END AS character_data) AS parameter_default FROM pg_type t, pg_namespace nt, (SELECT n.nspname AS n_nspname, p.proname, p.oid AS p_oid, p.proowner, p.proargnames, p.proargmodes, _pg_expandarray(coalesce(p.proallargtypes, p.proargtypes::oid[])) AS x FROM pg_namespace n, pg_proc p WHERE n.oid = p.pronamespace AND (pg_has_role(p.proowner, 'USAGE') OR has_function_privilege(p.oid, 'EXECUTE'))) AS ss WHERE t.oid = (ss.x).x AND t.typnamespace = nt.oid; GRANT SELECT ON parameters TO PUBLIC; /* * 6.39 * PERIODS view */ -- feature not supported /* * 6.40 * PRIVATE_PARAMETERS view */ -- feature not supported /* * 6.41 * REFERENCED_TYPES view */ -- feature not supported /* * 6.42 * REFERENTIAL_CONSTRAINTS view */ CREATE VIEW referential_constraints AS SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(ncon.nspname AS sql_identifier) AS constraint_schema, CAST(con.conname AS sql_identifier) AS constraint_name, CAST( CASE WHEN npkc.nspname IS NULL THEN NULL ELSE current_database() END AS sql_identifier) AS unique_constraint_catalog, CAST(npkc.nspname AS sql_identifier) AS unique_constraint_schema, CAST(pkc.conname AS sql_identifier) AS unique_constraint_name, CAST( CASE con.confmatchtype WHEN 'f' THEN 'FULL' WHEN 'p' THEN 'PARTIAL' WHEN 's' THEN 'NONE' END AS character_data) AS match_option, CAST( CASE con.confupdtype WHEN 'c' THEN 'CASCADE' WHEN 'n' THEN 'SET NULL' WHEN 'd' THEN 'SET DEFAULT' WHEN 'r' THEN 'RESTRICT' WHEN 'a' THEN 'NO ACTION' END AS character_data) AS update_rule, CAST( CASE con.confdeltype WHEN 'c' THEN 'CASCADE' WHEN 'n' THEN 'SET NULL' WHEN 'd' THEN 'SET DEFAULT' WHEN 'r' THEN 'RESTRICT' WHEN 'a' THEN 'NO ACTION' END AS character_data) AS delete_rule FROM (pg_namespace ncon INNER JOIN pg_constraint con ON ncon.oid = con.connamespace INNER JOIN pg_class c ON con.conrelid = c.oid AND con.contype = 'f') LEFT JOIN pg_depend d1 -- find constraint's dependency on an index ON d1.objid = con.oid AND d1.classid = 'pg_constraint'::regclass AND d1.refclassid = 'pg_class'::regclass AND d1.refobjsubid = 0 LEFT JOIN pg_depend d2 -- find pkey/unique constraint for that index ON d2.refclassid = 'pg_constraint'::regclass AND d2.classid = 'pg_class'::regclass AND d2.objid = d1.refobjid AND d2.objsubid = 0 AND d2.deptype = 'i' LEFT JOIN pg_constraint pkc ON pkc.oid = d2.refobjid AND pkc.contype IN ('p', 'u') AND pkc.conrelid = con.confrelid LEFT JOIN pg_namespace npkc ON pkc.connamespace = npkc.oid WHERE pg_has_role(c.relowner, 'USAGE') -- SELECT privilege omitted, per SQL standard OR has_table_privilege(c.oid, 'INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(c.oid, 'INSERT, UPDATE, REFERENCES') ; GRANT SELECT ON referential_constraints TO PUBLIC; /* * 6.43 * ROLE_COLUMN_GRANTS view */ CREATE VIEW role_column_grants AS SELECT grantor, grantee, table_catalog, table_schema, table_name, column_name, privilege_type, is_grantable FROM column_privileges WHERE grantor IN (SELECT role_name FROM enabled_roles) OR grantee IN (SELECT role_name FROM enabled_roles); GRANT SELECT ON role_column_grants TO PUBLIC; -- 6.44 ROLE_ROUTINE_GRANTS view is based on 6.51 ROUTINE_PRIVILEGES and is defined there instead. -- 6.45 ROLE_TABLE_GRANTS view is based on 6.64 TABLE_PRIVILEGES and is defined there instead. /* * 6.46 * ROLE_TABLE_METHOD_GRANTS view */ -- feature not supported -- 6.47 ROLE_USAGE_GRANTS view is based on 6.76 USAGE_PRIVILEGES and is defined there instead. -- 6.48 ROLE_UDT_GRANTS view is based on 6.75 UDT_PRIVILEGES and is defined there instead. /* * 6.49 * ROUTINE_COLUMN_USAGE view */ CREATE VIEW routine_column_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(np.nspname AS sql_identifier) AS routine_schema, CAST(p.proname AS sql_identifier) AS routine_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nt.nspname AS sql_identifier) AS table_schema, CAST(t.relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name FROM pg_namespace np, pg_proc p, pg_depend d, pg_class t, pg_namespace nt, pg_attribute a WHERE np.oid = p.pronamespace AND p.oid = d.objid AND d.classid = 'pg_catalog.pg_proc'::regclass AND d.refobjid = t.oid AND d.refclassid = 'pg_catalog.pg_class'::regclass AND t.relnamespace = nt.oid AND t.relkind IN ('r', 'v', 'f', 'p') AND t.oid = a.attrelid AND d.refobjsubid = a.attnum AND pg_has_role(t.relowner, 'USAGE'); GRANT SELECT ON routine_column_usage TO PUBLIC; /* * 6.50 * ROUTINE_PERIOD_USAGE view */ -- feature not supported /* * 6.51 * ROUTINE_PRIVILEGES view */ CREATE VIEW routine_privileges AS SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(n.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(n.nspname AS sql_identifier) AS routine_schema, CAST(p.proname AS sql_identifier) AS routine_name, CAST('EXECUTE' AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, p.proowner, 'USAGE') OR p.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT oid, proname, proowner, pronamespace, (aclexplode(coalesce(proacl, acldefault('f', proowner)))).* FROM pg_proc ) p (oid, proname, proowner, pronamespace, grantor, grantee, prtype, grantable), pg_namespace n, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE p.pronamespace = n.oid AND grantee.oid = p.grantee AND u_grantor.oid = p.grantor AND p.prtype IN ('EXECUTE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC'); GRANT SELECT ON routine_privileges TO PUBLIC; /* * 6.43 * ROLE_ROUTINE_GRANTS view */ CREATE VIEW role_routine_grants AS SELECT grantor, grantee, specific_catalog, specific_schema, specific_name, routine_catalog, routine_schema, routine_name, privilege_type, is_grantable FROM routine_privileges WHERE grantor IN (SELECT role_name FROM enabled_roles) OR grantee IN (SELECT role_name FROM enabled_roles); GRANT SELECT ON role_routine_grants TO PUBLIC; /* * 6.52 * ROUTINE_ROUTINE_USAGE view */ CREATE VIEW routine_routine_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(np1.nspname AS sql_identifier) AS routine_schema, CAST(nameconcatoid(p1.proname, p1.oid) AS sql_identifier) AS routine_name FROM pg_namespace np, pg_proc p, pg_depend d, pg_proc p1, pg_namespace np1 WHERE np.oid = p.pronamespace AND p.oid = d.objid AND d.classid = 'pg_catalog.pg_proc'::regclass AND d.refobjid = p1.oid AND d.refclassid = 'pg_catalog.pg_proc'::regclass AND p1.pronamespace = np1.oid AND p.prokind IN ('f', 'p') AND p1.prokind IN ('f', 'p') AND pg_has_role(p1.proowner, 'USAGE'); GRANT SELECT ON routine_routine_usage TO PUBLIC; /* * 6.53 * ROUTINE_SEQUENCE_USAGE view */ CREATE VIEW routine_sequence_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(np.nspname AS sql_identifier) AS routine_schema, CAST(p.proname AS sql_identifier) AS routine_name, CAST(current_database() AS sql_identifier) AS sequence_catalog, CAST(ns.nspname AS sql_identifier) AS sequence_schema, CAST(s.relname AS sql_identifier) AS sequence_name FROM pg_namespace np, pg_proc p, pg_depend d, pg_class s, pg_namespace ns WHERE np.oid = p.pronamespace AND p.oid = d.objid AND d.classid = 'pg_catalog.pg_proc'::regclass AND d.refobjid = s.oid AND d.refclassid = 'pg_catalog.pg_class'::regclass AND s.relnamespace = ns.oid AND s.relkind = 'S' AND pg_has_role(s.relowner, 'USAGE'); GRANT SELECT ON routine_sequence_usage TO PUBLIC; /* * 6.54 * ROUTINE_TABLE_USAGE view */ CREATE VIEW routine_table_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(np.nspname AS sql_identifier) AS routine_schema, CAST(p.proname AS sql_identifier) AS routine_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nt.nspname AS sql_identifier) AS table_schema, CAST(t.relname AS sql_identifier) AS table_name FROM pg_namespace np, pg_proc p, pg_depend d, pg_class t, pg_namespace nt WHERE np.oid = p.pronamespace AND p.oid = d.objid AND d.classid = 'pg_catalog.pg_proc'::regclass AND d.refobjid = t.oid AND d.refclassid = 'pg_catalog.pg_class'::regclass AND t.relnamespace = nt.oid AND t.relkind IN ('r', 'v', 'f', 'p') AND pg_has_role(t.relowner, 'USAGE'); GRANT SELECT ON routine_table_usage TO PUBLIC; /* * 6.55 * ROUTINES view */ CREATE VIEW routines AS SELECT CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(n.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(current_database() AS sql_identifier) AS routine_catalog, CAST(n.nspname AS sql_identifier) AS routine_schema, CAST(p.proname AS sql_identifier) AS routine_name, CAST(CASE p.prokind WHEN 'f' THEN 'FUNCTION' WHEN 'p' THEN 'PROCEDURE' END AS character_data) AS routine_type, CAST(null AS sql_identifier) AS module_catalog, CAST(null AS sql_identifier) AS module_schema, CAST(null AS sql_identifier) AS module_name, CAST(null AS sql_identifier) AS udt_catalog, CAST(null AS sql_identifier) AS udt_schema, CAST(null AS sql_identifier) AS udt_name, CAST( CASE WHEN p.prokind = 'p' THEN NULL WHEN t.typelem <> 0 AND t.typlen = -1 THEN 'ARRAY' WHEN nt.nspname = 'pg_catalog' THEN format_type(t.oid, null) ELSE 'USER-DEFINED' END AS character_data) AS data_type, CAST(null AS cardinal_number) AS character_maximum_length, CAST(null AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(null AS sql_identifier) AS collation_catalog, CAST(null AS sql_identifier) AS collation_schema, CAST(null AS sql_identifier) AS collation_name, CAST(null AS cardinal_number) AS numeric_precision, CAST(null AS cardinal_number) AS numeric_precision_radix, CAST(null AS cardinal_number) AS numeric_scale, CAST(null AS cardinal_number) AS datetime_precision, CAST(null AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(CASE WHEN nt.nspname IS NOT NULL THEN current_database() END AS sql_identifier) AS type_udt_catalog, CAST(nt.nspname AS sql_identifier) AS type_udt_schema, CAST(t.typname AS sql_identifier) AS type_udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST(CASE WHEN p.prokind <> 'p' THEN 0 END AS sql_identifier) AS dtd_identifier, CAST(CASE WHEN l.lanname = 'sql' THEN 'SQL' ELSE 'EXTERNAL' END AS character_data) AS routine_body, CAST( CASE WHEN pg_has_role(p.proowner, 'USAGE') THEN p.prosrc ELSE null END AS character_data) AS routine_definition, CAST( CASE WHEN l.lanname = 'c' THEN p.prosrc ELSE null END AS character_data) AS external_name, CAST(upper(l.lanname) AS character_data) AS external_language, CAST('GENERAL' AS character_data) AS parameter_style, CAST(CASE WHEN p.provolatile = 'i' THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_deterministic, CAST('MODIFIES' AS character_data) AS sql_data_access, CAST(CASE WHEN p.prokind <> 'p' THEN CASE WHEN p.proisstrict THEN 'YES' ELSE 'NO' END END AS yes_or_no) AS is_null_call, CAST(null AS character_data) AS sql_path, CAST('YES' AS yes_or_no) AS schema_level_routine, CAST(0 AS cardinal_number) AS max_dynamic_result_sets, CAST(null AS yes_or_no) AS is_user_defined_cast, CAST(null AS yes_or_no) AS is_implicitly_invocable, CAST(CASE WHEN p.prosecdef THEN 'DEFINER' ELSE 'INVOKER' END AS character_data) AS security_type, CAST(null AS sql_identifier) AS to_sql_specific_catalog, CAST(null AS sql_identifier) AS to_sql_specific_schema, CAST(null AS sql_identifier) AS to_sql_specific_name, CAST('NO' AS yes_or_no) AS as_locator, CAST(null AS time_stamp) AS created, CAST(null AS time_stamp) AS last_altered, CAST(null AS yes_or_no) AS new_savepoint_level, CAST('NO' AS yes_or_no) AS is_udt_dependent, CAST(null AS character_data) AS result_cast_from_data_type, CAST(null AS yes_or_no) AS result_cast_as_locator, CAST(null AS cardinal_number) AS result_cast_char_max_length, CAST(null AS cardinal_number) AS result_cast_char_octet_length, CAST(null AS sql_identifier) AS result_cast_char_set_catalog, CAST(null AS sql_identifier) AS result_cast_char_set_schema, CAST(null AS sql_identifier) AS result_cast_char_set_name, CAST(null AS sql_identifier) AS result_cast_collation_catalog, CAST(null AS sql_identifier) AS result_cast_collation_schema, CAST(null AS sql_identifier) AS result_cast_collation_name, CAST(null AS cardinal_number) AS result_cast_numeric_precision, CAST(null AS cardinal_number) AS result_cast_numeric_precision_radix, CAST(null AS cardinal_number) AS result_cast_numeric_scale, CAST(null AS cardinal_number) AS result_cast_datetime_precision, CAST(null AS character_data) AS result_cast_interval_type, CAST(null AS cardinal_number) AS result_cast_interval_precision, CAST(null AS sql_identifier) AS result_cast_type_udt_catalog, CAST(null AS sql_identifier) AS result_cast_type_udt_schema, CAST(null AS sql_identifier) AS result_cast_type_udt_name, CAST(null AS sql_identifier) AS result_cast_scope_catalog, CAST(null AS sql_identifier) AS result_cast_scope_schema, CAST(null AS sql_identifier) AS result_cast_scope_name, CAST(null AS cardinal_number) AS result_cast_maximum_cardinality, CAST(null AS sql_identifier) AS result_cast_dtd_identifier FROM (pg_namespace n JOIN pg_proc p ON n.oid = p.pronamespace JOIN pg_language l ON p.prolang = l.oid) LEFT JOIN (pg_type t JOIN pg_namespace nt ON t.typnamespace = nt.oid) ON p.prorettype = t.oid AND p.prokind <> 'p' WHERE (pg_has_role(p.proowner, 'USAGE') OR has_function_privilege(p.oid, 'EXECUTE')); GRANT SELECT ON routines TO PUBLIC; /* * 6.56 * SCHEMATA view */ CREATE VIEW schemata AS SELECT CAST(current_database() AS sql_identifier) AS catalog_name, CAST(n.nspname AS sql_identifier) AS schema_name, CAST(u.rolname AS sql_identifier) AS schema_owner, CAST(null AS sql_identifier) AS default_character_set_catalog, CAST(null AS sql_identifier) AS default_character_set_schema, CAST(null AS sql_identifier) AS default_character_set_name, CAST(null AS character_data) AS sql_path FROM pg_namespace n, pg_authid u WHERE n.nspowner = u.oid AND (pg_has_role(n.nspowner, 'USAGE') OR has_schema_privilege(n.oid, 'CREATE, USAGE')); GRANT SELECT ON schemata TO PUBLIC; /* * 6.57 * SEQUENCES view */ CREATE VIEW sequences AS SELECT CAST(current_database() AS sql_identifier) AS sequence_catalog, CAST(nc.nspname AS sql_identifier) AS sequence_schema, CAST(c.relname AS sql_identifier) AS sequence_name, CAST(format_type(s.seqtypid, null) AS character_data) AS data_type, CAST(_pg_numeric_precision(s.seqtypid, -1) AS cardinal_number) AS numeric_precision, CAST(2 AS cardinal_number) AS numeric_precision_radix, CAST(0 AS cardinal_number) AS numeric_scale, CAST(s.seqstart AS character_data) AS start_value, CAST(s.seqmin AS character_data) AS minimum_value, CAST(s.seqmax AS character_data) AS maximum_value, CAST(s.seqincrement AS character_data) AS increment, CAST(CASE WHEN s.seqcycle THEN 'YES' ELSE 'NO' END AS yes_or_no) AS cycle_option FROM pg_namespace nc, pg_class c, pg_sequence s WHERE c.relnamespace = nc.oid AND c.relkind = 'S' AND NOT EXISTS (SELECT 1 FROM pg_depend WHERE classid = 'pg_class'::regclass AND objid = c.oid AND deptype = 'i') AND (NOT pg_is_other_temp_schema(nc.oid)) AND c.oid = s.seqrelid AND (pg_has_role(c.relowner, 'USAGE') OR has_sequence_privilege(c.oid, 'SELECT, UPDATE, USAGE') ); GRANT SELECT ON sequences TO PUBLIC; /* * 6.58 * SQL_FEATURES table */ CREATE TABLE sql_features ( feature_id character_data, feature_name character_data, sub_feature_id character_data, sub_feature_name character_data, is_supported yes_or_no, is_verified_by character_data, comments character_data ); -- Will be filled with external data by initdb. GRANT SELECT ON sql_features TO PUBLIC; /* * 6.59 * SQL_IMPLEMENTATION_INFO table */ CREATE TABLE sql_implementation_info ( implementation_info_id character_data, implementation_info_name character_data, integer_value cardinal_number, character_value character_data, comments character_data ); INSERT INTO sql_implementation_info VALUES ('10003', 'CATALOG NAME', NULL, 'Y', NULL); INSERT INTO sql_implementation_info VALUES ('10004', 'COLLATING SEQUENCE', NULL, (SELECT default_collate_name FROM character_sets), NULL); INSERT INTO sql_implementation_info VALUES ('23', 'CURSOR COMMIT BEHAVIOR', 1, NULL, 'close cursors and retain prepared statements'); INSERT INTO sql_implementation_info VALUES ('2', 'DATA SOURCE NAME', NULL, '', NULL); INSERT INTO sql_implementation_info VALUES ('17', 'DBMS NAME', NULL, (select trim(trailing ' ' from substring(version() from '^[^0-9]*'))), NULL); INSERT INTO sql_implementation_info VALUES ('18', 'DBMS VERSION', NULL, '???', NULL); -- filled by initdb INSERT INTO sql_implementation_info VALUES ('26', 'DEFAULT TRANSACTION ISOLATION', 2, NULL, 'READ COMMITTED; user-settable'); INSERT INTO sql_implementation_info VALUES ('28', 'IDENTIFIER CASE', 3, NULL, 'stored in mixed case - case sensitive'); INSERT INTO sql_implementation_info VALUES ('85', 'NULL COLLATION', 0, NULL, 'nulls higher than non-nulls'); INSERT INTO sql_implementation_info VALUES ('13', 'SERVER NAME', NULL, '', NULL); INSERT INTO sql_implementation_info VALUES ('94', 'SPECIAL CHARACTERS', NULL, '', 'all non-ASCII characters allowed'); INSERT INTO sql_implementation_info VALUES ('46', 'TRANSACTION CAPABLE', 2, NULL, 'both DML and DDL'); GRANT SELECT ON sql_implementation_info TO PUBLIC; /* * 6.60 * SQL_PARTS table */ CREATE TABLE sql_parts ( feature_id character_data, feature_name character_data, is_supported yes_or_no, is_verified_by character_data, comments character_data ); INSERT INTO sql_parts VALUES ('1', 'Framework (SQL/Framework)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('2', 'Foundation (SQL/Foundation)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('3', 'Call-Level Interface (SQL/CLI)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('4', 'Persistent Stored Modules (SQL/PSM)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('9', 'Management of External Data (SQL/MED)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('10', 'Object Language Bindings (SQL/OLB)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('11', 'Information and Definition Schema (SQL/Schemata)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('13', 'Routines and Types Using the Java Programming Language (SQL/JRT)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('14', 'XML-Related Specifications (SQL/XML)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('15', 'Multi-Dimensional Arrays (SQL/MDA)', 'NO', NULL, ''); INSERT INTO sql_parts VALUES ('16', 'Property Graph Queries (SQL/PGQ)', 'NO', NULL, ''); /* * 6.61 * SQL_SIZING table */ CREATE TABLE sql_sizing ( sizing_id cardinal_number, sizing_name character_data, supported_value cardinal_number, comments character_data ); INSERT INTO sql_sizing VALUES (34, 'MAXIMUM CATALOG NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (30, 'MAXIMUM COLUMN NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (97, 'MAXIMUM COLUMNS IN GROUP BY', 0, NULL); INSERT INTO sql_sizing VALUES (99, 'MAXIMUM COLUMNS IN ORDER BY', 0, NULL); INSERT INTO sql_sizing VALUES (100, 'MAXIMUM COLUMNS IN SELECT', 1664, NULL); -- match MaxTupleAttributeNumber INSERT INTO sql_sizing VALUES (101, 'MAXIMUM COLUMNS IN TABLE', 1600, NULL); -- match MaxHeapAttributeNumber INSERT INTO sql_sizing VALUES (1, 'MAXIMUM CONCURRENT ACTIVITIES', 0, NULL); INSERT INTO sql_sizing VALUES (31, 'MAXIMUM CURSOR NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (0, 'MAXIMUM DRIVER CONNECTIONS', NULL, NULL); INSERT INTO sql_sizing VALUES (10005, 'MAXIMUM IDENTIFIER LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (32, 'MAXIMUM SCHEMA NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (20000, 'MAXIMUM STATEMENT OCTETS', 0, NULL); INSERT INTO sql_sizing VALUES (20001, 'MAXIMUM STATEMENT OCTETS DATA', 0, NULL); INSERT INTO sql_sizing VALUES (20002, 'MAXIMUM STATEMENT OCTETS SCHEMA', 0, NULL); INSERT INTO sql_sizing VALUES (35, 'MAXIMUM TABLE NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (106, 'MAXIMUM TABLES IN SELECT', 0, NULL); INSERT INTO sql_sizing VALUES (107, 'MAXIMUM USER NAME LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (25000, 'MAXIMUM CURRENT DEFAULT TRANSFORM GROUP LENGTH', NULL, NULL); INSERT INTO sql_sizing VALUES (25001, 'MAXIMUM CURRENT TRANSFORM GROUP LENGTH', NULL, NULL); INSERT INTO sql_sizing VALUES (25002, 'MAXIMUM CURRENT PATH LENGTH', 0, NULL); INSERT INTO sql_sizing VALUES (25003, 'MAXIMUM CURRENT ROLE LENGTH', NULL, NULL); INSERT INTO sql_sizing VALUES (25004, 'MAXIMUM SESSION USER LENGTH', 63, NULL); INSERT INTO sql_sizing VALUES (25005, 'MAXIMUM SYSTEM USER LENGTH', 63, NULL); UPDATE sql_sizing SET supported_value = (SELECT typlen-1 FROM pg_catalog.pg_type WHERE typname = 'name'), comments = 'Might be less, depending on character set.' WHERE supported_value = 63; GRANT SELECT ON sql_sizing TO PUBLIC; /* * 6.62 * TABLE_CONSTRAINTS view */ CREATE VIEW table_constraints AS SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(nc.nspname AS sql_identifier) AS constraint_schema, CAST(c.conname AS sql_identifier) AS constraint_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nr.nspname AS sql_identifier) AS table_schema, CAST(r.relname AS sql_identifier) AS table_name, CAST( CASE c.contype WHEN 'c' THEN 'CHECK' WHEN 'f' THEN 'FOREIGN KEY' WHEN 'p' THEN 'PRIMARY KEY' WHEN 'u' THEN 'UNIQUE' END AS character_data) AS constraint_type, CAST(CASE WHEN c.condeferrable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_deferrable, CAST(CASE WHEN c.condeferred THEN 'YES' ELSE 'NO' END AS yes_or_no) AS initially_deferred, CAST('YES' AS yes_or_no) AS enforced, CAST(CASE WHEN c.contype = 'u' THEN CASE WHEN (SELECT NOT indnullsnotdistinct FROM pg_index WHERE indexrelid = conindid) THEN 'YES' ELSE 'NO' END END AS yes_or_no) AS nulls_distinct FROM pg_namespace nc, pg_namespace nr, pg_constraint c, pg_class r WHERE nc.oid = c.connamespace AND nr.oid = r.relnamespace AND c.conrelid = r.oid AND c.contype NOT IN ('t', 'x') -- ignore nonstandard constraints AND r.relkind IN ('r', 'p') AND (NOT pg_is_other_temp_schema(nr.oid)) AND (pg_has_role(r.relowner, 'USAGE') -- SELECT privilege omitted, per SQL standard OR has_table_privilege(r.oid, 'INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(r.oid, 'INSERT, UPDATE, REFERENCES') ) UNION ALL -- not-null constraints SELECT CAST(current_database() AS sql_identifier) AS constraint_catalog, CAST(nr.nspname AS sql_identifier) AS constraint_schema, CAST(CAST(nr.oid AS text) || '_' || CAST(r.oid AS text) || '_' || CAST(a.attnum AS text) || '_not_null' AS sql_identifier) AS constraint_name, -- XXX CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nr.nspname AS sql_identifier) AS table_schema, CAST(r.relname AS sql_identifier) AS table_name, CAST('CHECK' AS character_data) AS constraint_type, CAST('NO' AS yes_or_no) AS is_deferrable, CAST('NO' AS yes_or_no) AS initially_deferred, CAST('YES' AS yes_or_no) AS enforced, CAST(NULL AS yes_or_no) AS nulls_distinct FROM pg_namespace nr, pg_class r, pg_attribute a WHERE nr.oid = r.relnamespace AND r.oid = a.attrelid AND a.attnotnull AND a.attnum > 0 AND NOT a.attisdropped AND r.relkind IN ('r', 'p') AND (NOT pg_is_other_temp_schema(nr.oid)) AND (pg_has_role(r.relowner, 'USAGE') -- SELECT privilege omitted, per SQL standard OR has_table_privilege(r.oid, 'INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(r.oid, 'INSERT, UPDATE, REFERENCES') ); GRANT SELECT ON table_constraints TO PUBLIC; /* * 6.63 * TABLE_METHOD_PRIVILEGES view */ -- feature not supported /* * 6.64 * TABLE_PRIVILEGES view */ CREATE VIEW table_privileges AS SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(c.prtype AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, c.relowner, 'USAGE') OR c.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable, CAST(CASE WHEN c.prtype = 'SELECT' THEN 'YES' ELSE 'NO' END AS yes_or_no) AS with_hierarchy FROM ( SELECT oid, relname, relnamespace, relkind, relowner, (aclexplode(coalesce(relacl, acldefault('r', relowner)))).* FROM pg_class ) AS c (oid, relname, relnamespace, relkind, relowner, grantor, grantee, prtype, grantable), pg_namespace nc, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE c.relnamespace = nc.oid AND c.relkind IN ('r', 'v', 'f', 'p') AND c.grantee = grantee.oid AND c.grantor = u_grantor.oid AND c.prtype IN ('INSERT', 'SELECT', 'UPDATE', 'DELETE', 'TRUNCATE', 'REFERENCES', 'TRIGGER') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC'); GRANT SELECT ON table_privileges TO PUBLIC; /* * 6.45 * ROLE_TABLE_GRANTS view */ CREATE VIEW role_table_grants AS SELECT grantor, grantee, table_catalog, table_schema, table_name, privilege_type, is_grantable, with_hierarchy FROM table_privileges WHERE grantor IN (SELECT role_name FROM enabled_roles) OR grantee IN (SELECT role_name FROM enabled_roles); GRANT SELECT ON role_table_grants TO PUBLIC; /* * 6.65 * TABLES view */ CREATE VIEW tables AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST( CASE WHEN nc.oid = pg_my_temp_schema() THEN 'LOCAL TEMPORARY' WHEN c.relkind IN ('r', 'p') THEN 'BASE TABLE' WHEN c.relkind = 'v' THEN 'VIEW' WHEN c.relkind = 'f' THEN 'FOREIGN' ELSE null END AS character_data) AS table_type, CAST(null AS sql_identifier) AS self_referencing_column_name, CAST(null AS character_data) AS reference_generation, CAST(CASE WHEN t.typname IS NOT NULL THEN current_database() ELSE null END AS sql_identifier) AS user_defined_type_catalog, CAST(nt.nspname AS sql_identifier) AS user_defined_type_schema, CAST(t.typname AS sql_identifier) AS user_defined_type_name, CAST(CASE WHEN c.relkind IN ('r', 'p') OR (c.relkind IN ('v', 'f') AND -- 1 << CMD_INSERT pg_relation_is_updatable(c.oid, false) & 8 = 8) THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_insertable_into, CAST(CASE WHEN t.typname IS NOT NULL THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_typed, CAST(null AS character_data) AS commit_action FROM pg_namespace nc JOIN pg_class c ON (nc.oid = c.relnamespace) LEFT JOIN (pg_type t JOIN pg_namespace nt ON (t.typnamespace = nt.oid)) ON (c.reloftype = t.oid) WHERE c.relkind IN ('r', 'v', 'f', 'p') AND (NOT pg_is_other_temp_schema(nc.oid)) AND (pg_has_role(c.relowner, 'USAGE') OR has_table_privilege(c.oid, 'SELECT, INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(c.oid, 'SELECT, INSERT, UPDATE, REFERENCES') ); GRANT SELECT ON tables TO PUBLIC; /* * 6.66 * TRANSFORMS view */ CREATE VIEW transforms AS SELECT CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nt.nspname AS sql_identifier) AS udt_schema, CAST(t.typname AS sql_identifier) AS udt_name, CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(l.lanname AS sql_identifier) AS group_name, CAST('FROM SQL' AS character_data) AS transform_type FROM pg_type t JOIN pg_transform x ON t.oid = x.trftype JOIN pg_language l ON x.trflang = l.oid JOIN pg_proc p ON x.trffromsql = p.oid JOIN pg_namespace nt ON t.typnamespace = nt.oid JOIN pg_namespace np ON p.pronamespace = np.oid UNION SELECT CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nt.nspname AS sql_identifier) AS udt_schema, CAST(t.typname AS sql_identifier) AS udt_name, CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name, CAST(l.lanname AS sql_identifier) AS group_name, CAST('TO SQL' AS character_data) AS transform_type FROM pg_type t JOIN pg_transform x ON t.oid = x.trftype JOIN pg_language l ON x.trflang = l.oid JOIN pg_proc p ON x.trftosql = p.oid JOIN pg_namespace nt ON t.typnamespace = nt.oid JOIN pg_namespace np ON p.pronamespace = np.oid ORDER BY udt_catalog, udt_schema, udt_name, group_name, transform_type -- some sensible grouping for interactive use ; /* * 6.67 * TRANSLATIONS view */ -- feature not supported /* * 6.68 * TRIGGERED_UPDATE_COLUMNS view */ CREATE VIEW triggered_update_columns AS SELECT CAST(current_database() AS sql_identifier) AS trigger_catalog, CAST(n.nspname AS sql_identifier) AS trigger_schema, CAST(t.tgname AS sql_identifier) AS trigger_name, CAST(current_database() AS sql_identifier) AS event_object_catalog, CAST(n.nspname AS sql_identifier) AS event_object_schema, CAST(c.relname AS sql_identifier) AS event_object_table, CAST(a.attname AS sql_identifier) AS event_object_column FROM pg_namespace n, pg_class c, pg_trigger t, (SELECT tgoid, (ta0.tgat).x AS tgattnum, (ta0.tgat).n AS tgattpos FROM (SELECT oid AS tgoid, information_schema._pg_expandarray(tgattr) AS tgat FROM pg_trigger) AS ta0) AS ta, pg_attribute a WHERE n.oid = c.relnamespace AND c.oid = t.tgrelid AND t.oid = ta.tgoid AND (a.attrelid, a.attnum) = (t.tgrelid, ta.tgattnum) AND NOT t.tgisinternal AND (NOT pg_is_other_temp_schema(n.oid)) AND (pg_has_role(c.relowner, 'USAGE') -- SELECT privilege omitted, per SQL standard OR has_column_privilege(c.oid, a.attnum, 'INSERT, UPDATE, REFERENCES') ); GRANT SELECT ON triggered_update_columns TO PUBLIC; /* * 6.69 * TRIGGER_COLUMN_USAGE view */ -- not tracked by PostgreSQL /* * 6.70 * TRIGGER_PERIOD_USAGE view */ -- feature not supported /* * 6.71 * TRIGGER_ROUTINE_USAGE view */ -- not tracked by PostgreSQL /* * 6.72 * TRIGGER_SEQUENCE_USAGE view */ -- not tracked by PostgreSQL /* * 6.73 * TRIGGER_TABLE_USAGE view */ -- not tracked by PostgreSQL /* * 6.74 * TRIGGERS view */ CREATE VIEW triggers AS SELECT CAST(current_database() AS sql_identifier) AS trigger_catalog, CAST(n.nspname AS sql_identifier) AS trigger_schema, CAST(t.tgname AS sql_identifier) AS trigger_name, CAST(em.text AS character_data) AS event_manipulation, CAST(current_database() AS sql_identifier) AS event_object_catalog, CAST(n.nspname AS sql_identifier) AS event_object_schema, CAST(c.relname AS sql_identifier) AS event_object_table, CAST( -- To determine action order, partition by schema, table, -- event_manipulation (INSERT/DELETE/UPDATE), ROW/STATEMENT (1), -- BEFORE/AFTER (66), then order by trigger name. It's preferable -- to partition by view output columns, so that query constraints -- can be pushed down below the window function. rank() OVER (PARTITION BY CAST(n.nspname AS sql_identifier), CAST(c.relname AS sql_identifier), em.num, t.tgtype & 1, t.tgtype & 66 ORDER BY t.tgname) AS cardinal_number) AS action_order, CAST( CASE WHEN pg_has_role(c.relowner, 'USAGE') THEN (regexp_match(pg_get_triggerdef(t.oid), E'.{35,} WHEN \\((.+)\\) EXECUTE FUNCTION'))[1] ELSE null END AS character_data) AS action_condition, CAST( substring(pg_get_triggerdef(t.oid) from position('EXECUTE FUNCTION' in substring(pg_get_triggerdef(t.oid) from 48)) + 47) AS character_data) AS action_statement, CAST( -- hard-wired reference to TRIGGER_TYPE_ROW CASE t.tgtype & 1 WHEN 1 THEN 'ROW' ELSE 'STATEMENT' END AS character_data) AS action_orientation, CAST( -- hard-wired refs to TRIGGER_TYPE_BEFORE, TRIGGER_TYPE_INSTEAD CASE t.tgtype & 66 WHEN 2 THEN 'BEFORE' WHEN 64 THEN 'INSTEAD OF' ELSE 'AFTER' END AS character_data) AS action_timing, CAST(tgoldtable AS sql_identifier) AS action_reference_old_table, CAST(tgnewtable AS sql_identifier) AS action_reference_new_table, CAST(null AS sql_identifier) AS action_reference_old_row, CAST(null AS sql_identifier) AS action_reference_new_row, CAST(null AS time_stamp) AS created FROM pg_namespace n, pg_class c, pg_trigger t, -- hard-wired refs to TRIGGER_TYPE_INSERT, TRIGGER_TYPE_DELETE, -- TRIGGER_TYPE_UPDATE; we intentionally omit TRIGGER_TYPE_TRUNCATE (VALUES (4, 'INSERT'), (8, 'DELETE'), (16, 'UPDATE')) AS em (num, text) WHERE n.oid = c.relnamespace AND c.oid = t.tgrelid AND t.tgtype & em.num <> 0 AND NOT t.tgisinternal AND (NOT pg_is_other_temp_schema(n.oid)) AND (pg_has_role(c.relowner, 'USAGE') -- SELECT privilege omitted, per SQL standard OR has_table_privilege(c.oid, 'INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(c.oid, 'INSERT, UPDATE, REFERENCES') ); GRANT SELECT ON triggers TO PUBLIC; /* * 6.75 * UDT_PRIVILEGES view */ CREATE VIEW udt_privileges AS SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(n.nspname AS sql_identifier) AS udt_schema, CAST(t.typname AS sql_identifier) AS udt_name, CAST('TYPE USAGE' AS character_data) AS privilege_type, -- sic CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, t.typowner, 'USAGE') OR t.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT oid, typname, typnamespace, typtype, typowner, (aclexplode(coalesce(typacl, acldefault('T', typowner)))).* FROM pg_type ) AS t (oid, typname, typnamespace, typtype, typowner, grantor, grantee, prtype, grantable), pg_namespace n, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE t.typnamespace = n.oid AND t.typtype = 'c' AND t.grantee = grantee.oid AND t.grantor = u_grantor.oid AND t.prtype IN ('USAGE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC'); GRANT SELECT ON udt_privileges TO PUBLIC; /* * 6.48 * ROLE_UDT_GRANTS view */ CREATE VIEW role_udt_grants AS SELECT grantor, grantee, udt_catalog, udt_schema, udt_name, privilege_type, is_grantable FROM udt_privileges WHERE grantor IN (SELECT role_name FROM enabled_roles) OR grantee IN (SELECT role_name FROM enabled_roles); GRANT SELECT ON role_udt_grants TO PUBLIC; /* * 6.76 * USAGE_PRIVILEGES view */ CREATE VIEW usage_privileges AS /* collations */ -- Collations have no real privileges, so we represent all collations with implicit usage privilege here. SELECT CAST(u.rolname AS sql_identifier) AS grantor, CAST('PUBLIC' AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS object_catalog, CAST(n.nspname AS sql_identifier) AS object_schema, CAST(c.collname AS sql_identifier) AS object_name, CAST('COLLATION' AS character_data) AS object_type, CAST('USAGE' AS character_data) AS privilege_type, CAST('NO' AS yes_or_no) AS is_grantable FROM pg_authid u, pg_namespace n, pg_collation c WHERE u.oid = c.collowner AND c.collnamespace = n.oid AND collencoding IN (-1, (SELECT encoding FROM pg_database WHERE datname = current_database())) UNION ALL /* domains */ SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS object_catalog, CAST(n.nspname AS sql_identifier) AS object_schema, CAST(t.typname AS sql_identifier) AS object_name, CAST('DOMAIN' AS character_data) AS object_type, CAST('USAGE' AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, t.typowner, 'USAGE') OR t.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT oid, typname, typnamespace, typtype, typowner, (aclexplode(coalesce(typacl, acldefault('T', typowner)))).* FROM pg_type ) AS t (oid, typname, typnamespace, typtype, typowner, grantor, grantee, prtype, grantable), pg_namespace n, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE t.typnamespace = n.oid AND t.typtype = 'd' AND t.grantee = grantee.oid AND t.grantor = u_grantor.oid AND t.prtype IN ('USAGE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC') UNION ALL /* foreign-data wrappers */ SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS object_catalog, CAST('' AS sql_identifier) AS object_schema, CAST(fdw.fdwname AS sql_identifier) AS object_name, CAST('FOREIGN DATA WRAPPER' AS character_data) AS object_type, CAST('USAGE' AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, fdw.fdwowner, 'USAGE') OR fdw.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT fdwname, fdwowner, (aclexplode(coalesce(fdwacl, acldefault('F', fdwowner)))).* FROM pg_foreign_data_wrapper ) AS fdw (fdwname, fdwowner, grantor, grantee, prtype, grantable), pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE u_grantor.oid = fdw.grantor AND grantee.oid = fdw.grantee AND fdw.prtype IN ('USAGE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC') UNION ALL /* foreign servers */ SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS object_catalog, CAST('' AS sql_identifier) AS object_schema, CAST(srv.srvname AS sql_identifier) AS object_name, CAST('FOREIGN SERVER' AS character_data) AS object_type, CAST('USAGE' AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, srv.srvowner, 'USAGE') OR srv.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT srvname, srvowner, (aclexplode(coalesce(srvacl, acldefault('S', srvowner)))).* FROM pg_foreign_server ) AS srv (srvname, srvowner, grantor, grantee, prtype, grantable), pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE u_grantor.oid = srv.grantor AND grantee.oid = srv.grantee AND srv.prtype IN ('USAGE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC') UNION ALL /* sequences */ SELECT CAST(u_grantor.rolname AS sql_identifier) AS grantor, CAST(grantee.rolname AS sql_identifier) AS grantee, CAST(current_database() AS sql_identifier) AS object_catalog, CAST(n.nspname AS sql_identifier) AS object_schema, CAST(c.relname AS sql_identifier) AS object_name, CAST('SEQUENCE' AS character_data) AS object_type, CAST('USAGE' AS character_data) AS privilege_type, CAST( CASE WHEN -- object owner always has grant options pg_has_role(grantee.oid, c.relowner, 'USAGE') OR c.grantable THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_grantable FROM ( SELECT oid, relname, relnamespace, relkind, relowner, (aclexplode(coalesce(relacl, acldefault('r', relowner)))).* FROM pg_class ) AS c (oid, relname, relnamespace, relkind, relowner, grantor, grantee, prtype, grantable), pg_namespace n, pg_authid u_grantor, ( SELECT oid, rolname FROM pg_authid UNION ALL SELECT 0::oid, 'PUBLIC' ) AS grantee (oid, rolname) WHERE c.relnamespace = n.oid AND c.relkind = 'S' AND c.grantee = grantee.oid AND c.grantor = u_grantor.oid AND c.prtype IN ('USAGE') AND (pg_has_role(u_grantor.oid, 'USAGE') OR pg_has_role(grantee.oid, 'USAGE') OR grantee.rolname = 'PUBLIC'); GRANT SELECT ON usage_privileges TO PUBLIC; /* * 6.47 * ROLE_USAGE_GRANTS view */ CREATE VIEW role_usage_grants AS SELECT grantor, grantee, object_catalog, object_schema, object_name, object_type, privilege_type, is_grantable FROM usage_privileges WHERE grantor IN (SELECT role_name FROM enabled_roles) OR grantee IN (SELECT role_name FROM enabled_roles); GRANT SELECT ON role_usage_grants TO PUBLIC; /* * 6.77 * USER_DEFINED_TYPES view */ CREATE VIEW user_defined_types AS SELECT CAST(current_database() AS sql_identifier) AS user_defined_type_catalog, CAST(n.nspname AS sql_identifier) AS user_defined_type_schema, CAST(c.relname AS sql_identifier) AS user_defined_type_name, CAST('STRUCTURED' AS character_data) AS user_defined_type_category, CAST('YES' AS yes_or_no) AS is_instantiable, CAST(null AS yes_or_no) AS is_final, CAST(null AS character_data) AS ordering_form, CAST(null AS character_data) AS ordering_category, CAST(null AS sql_identifier) AS ordering_routine_catalog, CAST(null AS sql_identifier) AS ordering_routine_schema, CAST(null AS sql_identifier) AS ordering_routine_name, CAST(null AS character_data) AS reference_type, CAST(null AS character_data) AS data_type, CAST(null AS cardinal_number) AS character_maximum_length, CAST(null AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(null AS sql_identifier) AS collation_catalog, CAST(null AS sql_identifier) AS collation_schema, CAST(null AS sql_identifier) AS collation_name, CAST(null AS cardinal_number) AS numeric_precision, CAST(null AS cardinal_number) AS numeric_precision_radix, CAST(null AS cardinal_number) AS numeric_scale, CAST(null AS cardinal_number) AS datetime_precision, CAST(null AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(null AS sql_identifier) AS source_dtd_identifier, CAST(null AS sql_identifier) AS ref_dtd_identifier FROM pg_namespace n, pg_class c, pg_type t WHERE n.oid = c.relnamespace AND t.typrelid = c.oid AND c.relkind = 'c' AND (pg_has_role(t.typowner, 'USAGE') OR has_type_privilege(t.oid, 'USAGE')); GRANT SELECT ON user_defined_types TO PUBLIC; /* * 6.78 * VIEW_COLUMN_USAGE */ CREATE VIEW view_column_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS view_catalog, CAST(nv.nspname AS sql_identifier) AS view_schema, CAST(v.relname AS sql_identifier) AS view_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nt.nspname AS sql_identifier) AS table_schema, CAST(t.relname AS sql_identifier) AS table_name, CAST(a.attname AS sql_identifier) AS column_name FROM pg_namespace nv, pg_class v, pg_depend dv, pg_depend dt, pg_class t, pg_namespace nt, pg_attribute a WHERE nv.oid = v.relnamespace AND v.relkind = 'v' AND v.oid = dv.refobjid AND dv.refclassid = 'pg_catalog.pg_class'::regclass AND dv.classid = 'pg_catalog.pg_rewrite'::regclass AND dv.deptype = 'i' AND dv.objid = dt.objid AND dv.refobjid <> dt.refobjid AND dt.classid = 'pg_catalog.pg_rewrite'::regclass AND dt.refclassid = 'pg_catalog.pg_class'::regclass AND dt.refobjid = t.oid AND t.relnamespace = nt.oid AND t.relkind IN ('r', 'v', 'f', 'p') AND t.oid = a.attrelid AND dt.refobjsubid = a.attnum AND pg_has_role(t.relowner, 'USAGE'); GRANT SELECT ON view_column_usage TO PUBLIC; /* * 6.79 * VIEW_PERIOD_USAGE */ -- feature not supported /* * 6.80 * VIEW_ROUTINE_USAGE */ CREATE VIEW view_routine_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nv.nspname AS sql_identifier) AS table_schema, CAST(v.relname AS sql_identifier) AS table_name, CAST(current_database() AS sql_identifier) AS specific_catalog, CAST(np.nspname AS sql_identifier) AS specific_schema, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier) AS specific_name FROM pg_namespace nv, pg_class v, pg_depend dv, pg_depend dp, pg_proc p, pg_namespace np WHERE nv.oid = v.relnamespace AND v.relkind = 'v' AND v.oid = dv.refobjid AND dv.refclassid = 'pg_catalog.pg_class'::regclass AND dv.classid = 'pg_catalog.pg_rewrite'::regclass AND dv.deptype = 'i' AND dv.objid = dp.objid AND dp.classid = 'pg_catalog.pg_rewrite'::regclass AND dp.refclassid = 'pg_catalog.pg_proc'::regclass AND dp.refobjid = p.oid AND p.pronamespace = np.oid AND pg_has_role(p.proowner, 'USAGE'); GRANT SELECT ON view_routine_usage TO PUBLIC; /* * 6.81 * VIEW_TABLE_USAGE */ CREATE VIEW view_table_usage AS SELECT DISTINCT CAST(current_database() AS sql_identifier) AS view_catalog, CAST(nv.nspname AS sql_identifier) AS view_schema, CAST(v.relname AS sql_identifier) AS view_name, CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nt.nspname AS sql_identifier) AS table_schema, CAST(t.relname AS sql_identifier) AS table_name FROM pg_namespace nv, pg_class v, pg_depend dv, pg_depend dt, pg_class t, pg_namespace nt WHERE nv.oid = v.relnamespace AND v.relkind = 'v' AND v.oid = dv.refobjid AND dv.refclassid = 'pg_catalog.pg_class'::regclass AND dv.classid = 'pg_catalog.pg_rewrite'::regclass AND dv.deptype = 'i' AND dv.objid = dt.objid AND dv.refobjid <> dt.refobjid AND dt.classid = 'pg_catalog.pg_rewrite'::regclass AND dt.refclassid = 'pg_catalog.pg_class'::regclass AND dt.refobjid = t.oid AND t.relnamespace = nt.oid AND t.relkind IN ('r', 'v', 'f', 'p') AND pg_has_role(t.relowner, 'USAGE'); GRANT SELECT ON view_table_usage TO PUBLIC; /* * 6.82 * VIEWS view */ CREATE VIEW views AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(nc.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST( CASE WHEN pg_has_role(c.relowner, 'USAGE') THEN pg_get_viewdef(c.oid) ELSE null END AS character_data) AS view_definition, CAST( CASE WHEN 'check_option=cascaded' = ANY (c.reloptions) THEN 'CASCADED' WHEN 'check_option=local' = ANY (c.reloptions) THEN 'LOCAL' ELSE 'NONE' END AS character_data) AS check_option, CAST( -- (1 << CMD_UPDATE) + (1 << CMD_DELETE) CASE WHEN pg_relation_is_updatable(c.oid, false) & 20 = 20 THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_updatable, CAST( -- 1 << CMD_INSERT CASE WHEN pg_relation_is_updatable(c.oid, false) & 8 = 8 THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_insertable_into, CAST( -- TRIGGER_TYPE_ROW + TRIGGER_TYPE_INSTEAD + TRIGGER_TYPE_UPDATE CASE WHEN EXISTS (SELECT 1 FROM pg_trigger WHERE tgrelid = c.oid AND tgtype & 81 = 81) THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_trigger_updatable, CAST( -- TRIGGER_TYPE_ROW + TRIGGER_TYPE_INSTEAD + TRIGGER_TYPE_DELETE CASE WHEN EXISTS (SELECT 1 FROM pg_trigger WHERE tgrelid = c.oid AND tgtype & 73 = 73) THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_trigger_deletable, CAST( -- TRIGGER_TYPE_ROW + TRIGGER_TYPE_INSTEAD + TRIGGER_TYPE_INSERT CASE WHEN EXISTS (SELECT 1 FROM pg_trigger WHERE tgrelid = c.oid AND tgtype & 69 = 69) THEN 'YES' ELSE 'NO' END AS yes_or_no) AS is_trigger_insertable_into FROM pg_namespace nc, pg_class c WHERE c.relnamespace = nc.oid AND c.relkind = 'v' AND (NOT pg_is_other_temp_schema(nc.oid)) AND (pg_has_role(c.relowner, 'USAGE') OR has_table_privilege(c.oid, 'SELECT, INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(c.oid, 'SELECT, INSERT, UPDATE, REFERENCES') ); GRANT SELECT ON views TO PUBLIC; -- The following views have dependencies that force them to appear out of order. /* * 6.26 * DATA_TYPE_PRIVILEGES view */ CREATE VIEW data_type_privileges AS SELECT CAST(current_database() AS sql_identifier) AS object_catalog, CAST(x.objschema AS sql_identifier) AS object_schema, CAST(x.objname AS sql_identifier) AS object_name, CAST(x.objtype AS character_data) AS object_type, CAST(x.objdtdid AS sql_identifier) AS dtd_identifier FROM ( SELECT udt_schema, udt_name, 'USER-DEFINED TYPE'::text, dtd_identifier FROM attributes UNION ALL SELECT table_schema, table_name, 'TABLE'::text, dtd_identifier FROM columns UNION ALL SELECT domain_schema, domain_name, 'DOMAIN'::text, dtd_identifier FROM domains UNION ALL SELECT specific_schema, specific_name, 'ROUTINE'::text, dtd_identifier FROM parameters UNION ALL SELECT specific_schema, specific_name, 'ROUTINE'::text, dtd_identifier FROM routines ) AS x (objschema, objname, objtype, objdtdid); GRANT SELECT ON data_type_privileges TO PUBLIC; /* * 6.31 * ELEMENT_TYPES view */ CREATE VIEW element_types AS SELECT CAST(current_database() AS sql_identifier) AS object_catalog, CAST(n.nspname AS sql_identifier) AS object_schema, CAST(x.objname AS sql_identifier) AS object_name, CAST(x.objtype AS character_data) AS object_type, CAST(x.objdtdid AS sql_identifier) AS collection_type_identifier, CAST( CASE WHEN nbt.nspname = 'pg_catalog' THEN format_type(bt.oid, null) ELSE 'USER-DEFINED' END AS character_data) AS data_type, CAST(null AS cardinal_number) AS character_maximum_length, CAST(null AS cardinal_number) AS character_octet_length, CAST(null AS sql_identifier) AS character_set_catalog, CAST(null AS sql_identifier) AS character_set_schema, CAST(null AS sql_identifier) AS character_set_name, CAST(CASE WHEN nco.nspname IS NOT NULL THEN current_database() END AS sql_identifier) AS collation_catalog, CAST(nco.nspname AS sql_identifier) AS collation_schema, CAST(co.collname AS sql_identifier) AS collation_name, CAST(null AS cardinal_number) AS numeric_precision, CAST(null AS cardinal_number) AS numeric_precision_radix, CAST(null AS cardinal_number) AS numeric_scale, CAST(null AS cardinal_number) AS datetime_precision, CAST(null AS character_data) AS interval_type, CAST(null AS cardinal_number) AS interval_precision, CAST(current_database() AS sql_identifier) AS udt_catalog, CAST(nbt.nspname AS sql_identifier) AS udt_schema, CAST(bt.typname AS sql_identifier) AS udt_name, CAST(null AS sql_identifier) AS scope_catalog, CAST(null AS sql_identifier) AS scope_schema, CAST(null AS sql_identifier) AS scope_name, CAST(null AS cardinal_number) AS maximum_cardinality, CAST('a' || CAST(x.objdtdid AS text) AS sql_identifier) AS dtd_identifier FROM pg_namespace n, pg_type at, pg_namespace nbt, pg_type bt, ( /* columns, attributes */ SELECT c.relnamespace, CAST(c.relname AS sql_identifier), CASE WHEN c.relkind = 'c' THEN 'USER-DEFINED TYPE'::text ELSE 'TABLE'::text END, a.attnum, a.atttypid, a.attcollation FROM pg_class c, pg_attribute a WHERE c.oid = a.attrelid AND c.relkind IN ('r', 'v', 'f', 'c', 'p') AND attnum > 0 AND NOT attisdropped UNION ALL /* domains */ SELECT t.typnamespace, CAST(t.typname AS sql_identifier), 'DOMAIN'::text, 1, t.typbasetype, t.typcollation FROM pg_type t WHERE t.typtype = 'd' UNION ALL /* parameters */ SELECT pronamespace, CAST(nameconcatoid(proname, oid) AS sql_identifier), 'ROUTINE'::text, (ss.x).n, (ss.x).x, 0 FROM (SELECT p.pronamespace, p.proname, p.oid, _pg_expandarray(coalesce(p.proallargtypes, p.proargtypes::oid[])) AS x FROM pg_proc p) AS ss UNION ALL /* result types */ SELECT p.pronamespace, CAST(nameconcatoid(p.proname, p.oid) AS sql_identifier), 'ROUTINE'::text, 0, p.prorettype, 0 FROM pg_proc p ) AS x (objschema, objname, objtype, objdtdid, objtypeid, objcollation) LEFT JOIN (pg_collation co JOIN pg_namespace nco ON (co.collnamespace = nco.oid)) ON x.objcollation = co.oid AND (nco.nspname, co.collname) <> ('pg_catalog', 'default') WHERE n.oid = x.objschema AND at.oid = x.objtypeid AND (at.typelem <> 0 AND at.typlen = -1) AND at.typelem = bt.oid AND nbt.oid = bt.typnamespace AND (n.nspname, x.objname, x.objtype, CAST(x.objdtdid AS sql_identifier)) IN ( SELECT object_schema, object_name, object_type, dtd_identifier FROM data_type_privileges ); GRANT SELECT ON element_types TO PUBLIC; -- SQL/MED views; these use section numbers from part 9 of the standard. /* Base view for foreign table columns */ CREATE VIEW _pg_foreign_table_columns AS SELECT n.nspname, c.relname, a.attname, a.attfdwoptions FROM pg_foreign_table t, pg_authid u, pg_namespace n, pg_class c, pg_attribute a WHERE u.oid = c.relowner AND (pg_has_role(c.relowner, 'USAGE') OR has_column_privilege(c.oid, a.attnum, 'SELECT, INSERT, UPDATE, REFERENCES')) AND n.oid = c.relnamespace AND c.oid = t.ftrelid AND c.relkind = 'f' AND a.attrelid = c.oid AND a.attnum > 0; /* * 24.3 * COLUMN_OPTIONS view */ CREATE VIEW column_options AS SELECT CAST(current_database() AS sql_identifier) AS table_catalog, CAST(c.nspname AS sql_identifier) AS table_schema, CAST(c.relname AS sql_identifier) AS table_name, CAST(c.attname AS sql_identifier) AS column_name, CAST((pg_options_to_table(c.attfdwoptions)).option_name AS sql_identifier) AS option_name, CAST((pg_options_to_table(c.attfdwoptions)).option_value AS character_data) AS option_value FROM _pg_foreign_table_columns c; GRANT SELECT ON column_options TO PUBLIC; /* Base view for foreign-data wrappers */ CREATE VIEW _pg_foreign_data_wrappers AS SELECT w.oid, w.fdwowner, w.fdwoptions, CAST(current_database() AS sql_identifier) AS foreign_data_wrapper_catalog, CAST(fdwname AS sql_identifier) AS foreign_data_wrapper_name, CAST(u.rolname AS sql_identifier) AS authorization_identifier, CAST('c' AS character_data) AS foreign_data_wrapper_language FROM pg_foreign_data_wrapper w, pg_authid u WHERE u.oid = w.fdwowner AND (pg_has_role(fdwowner, 'USAGE') OR has_foreign_data_wrapper_privilege(w.oid, 'USAGE')); /* * 24.5 * FOREIGN_DATA_WRAPPER_OPTIONS view */ CREATE VIEW foreign_data_wrapper_options AS SELECT foreign_data_wrapper_catalog, foreign_data_wrapper_name, CAST((pg_options_to_table(w.fdwoptions)).option_name AS sql_identifier) AS option_name, CAST((pg_options_to_table(w.fdwoptions)).option_value AS character_data) AS option_value FROM _pg_foreign_data_wrappers w; GRANT SELECT ON foreign_data_wrapper_options TO PUBLIC; /* * 24.6 * FOREIGN_DATA_WRAPPERS view */ CREATE VIEW foreign_data_wrappers AS SELECT foreign_data_wrapper_catalog, foreign_data_wrapper_name, authorization_identifier, CAST(NULL AS character_data) AS library_name, foreign_data_wrapper_language FROM _pg_foreign_data_wrappers w; GRANT SELECT ON foreign_data_wrappers TO PUBLIC; /* Base view for foreign servers */ CREATE VIEW _pg_foreign_servers AS SELECT s.oid, s.srvoptions, CAST(current_database() AS sql_identifier) AS foreign_server_catalog, CAST(srvname AS sql_identifier) AS foreign_server_name, CAST(current_database() AS sql_identifier) AS foreign_data_wrapper_catalog, CAST(w.fdwname AS sql_identifier) AS foreign_data_wrapper_name, CAST(srvtype AS character_data) AS foreign_server_type, CAST(srvversion AS character_data) AS foreign_server_version, CAST(u.rolname AS sql_identifier) AS authorization_identifier FROM pg_foreign_server s, pg_foreign_data_wrapper w, pg_authid u WHERE w.oid = s.srvfdw AND u.oid = s.srvowner AND (pg_has_role(s.srvowner, 'USAGE') OR has_server_privilege(s.oid, 'USAGE')); /* * 24.7 * FOREIGN_SERVER_OPTIONS view */ CREATE VIEW foreign_server_options AS SELECT foreign_server_catalog, foreign_server_name, CAST((pg_options_to_table(s.srvoptions)).option_name AS sql_identifier) AS option_name, CAST((pg_options_to_table(s.srvoptions)).option_value AS character_data) AS option_value FROM _pg_foreign_servers s; GRANT SELECT ON TABLE foreign_server_options TO PUBLIC; /* * 24.8 * FOREIGN_SERVERS view */ CREATE VIEW foreign_servers AS SELECT foreign_server_catalog, foreign_server_name, foreign_data_wrapper_catalog, foreign_data_wrapper_name, foreign_server_type, foreign_server_version, authorization_identifier FROM _pg_foreign_servers; GRANT SELECT ON foreign_servers TO PUBLIC; /* Base view for foreign tables */ CREATE VIEW _pg_foreign_tables AS SELECT CAST(current_database() AS sql_identifier) AS foreign_table_catalog, CAST(n.nspname AS sql_identifier) AS foreign_table_schema, CAST(c.relname AS sql_identifier) AS foreign_table_name, t.ftoptions AS ftoptions, CAST(current_database() AS sql_identifier) AS foreign_server_catalog, CAST(srvname AS sql_identifier) AS foreign_server_name, CAST(u.rolname AS sql_identifier) AS authorization_identifier FROM pg_foreign_table t, pg_foreign_server s, pg_foreign_data_wrapper w, pg_authid u, pg_namespace n, pg_class c WHERE w.oid = s.srvfdw AND u.oid = c.relowner AND (pg_has_role(c.relowner, 'USAGE') OR has_table_privilege(c.oid, 'SELECT, INSERT, UPDATE, DELETE, TRUNCATE, REFERENCES, TRIGGER') OR has_any_column_privilege(c.oid, 'SELECT, INSERT, UPDATE, REFERENCES')) AND n.oid = c.relnamespace AND c.oid = t.ftrelid AND c.relkind = 'f' AND s.oid = t.ftserver; /* * 24.9 * FOREIGN_TABLE_OPTIONS view */ CREATE VIEW foreign_table_options AS SELECT foreign_table_catalog, foreign_table_schema, foreign_table_name, CAST((pg_options_to_table(t.ftoptions)).option_name AS sql_identifier) AS option_name, CAST((pg_options_to_table(t.ftoptions)).option_value AS character_data) AS option_value FROM _pg_foreign_tables t; GRANT SELECT ON TABLE foreign_table_options TO PUBLIC; /* * 24.10 * FOREIGN_TABLES view */ CREATE VIEW foreign_tables AS SELECT foreign_table_catalog, foreign_table_schema, foreign_table_name, foreign_server_catalog, foreign_server_name FROM _pg_foreign_tables; GRANT SELECT ON foreign_tables TO PUBLIC; /* Base view for user mappings */ CREATE VIEW _pg_user_mappings AS SELECT um.oid, um.umoptions, um.umuser, CAST(COALESCE(u.rolname,'PUBLIC') AS sql_identifier ) AS authorization_identifier, s.foreign_server_catalog, s.foreign_server_name, s.authorization_identifier AS srvowner FROM pg_user_mapping um LEFT JOIN pg_authid u ON (u.oid = um.umuser), _pg_foreign_servers s WHERE s.oid = um.umserver; /* * 24.13 * USER_MAPPING_OPTIONS view */ CREATE VIEW user_mapping_options AS SELECT authorization_identifier, foreign_server_catalog, foreign_server_name, CAST(opts.option_name AS sql_identifier) AS option_name, CAST(CASE WHEN (umuser <> 0 AND authorization_identifier = current_user) OR (umuser = 0 AND pg_has_role(srvowner, 'USAGE')) OR (SELECT rolsuper FROM pg_authid WHERE rolname = current_user) THEN opts.option_value ELSE NULL END AS character_data) AS option_value FROM _pg_user_mappings um, pg_options_to_table(um.umoptions) opts; GRANT SELECT ON user_mapping_options TO PUBLIC; /* * 24.14 * USER_MAPPINGS view */ CREATE VIEW user_mappings AS SELECT authorization_identifier, foreign_server_catalog, foreign_server_name FROM _pg_user_mappings; GRANT SELECT ON user_mappings TO PUBLIC; # PostgreSQL Client Authentication Configuration File # =================================================== # # Refer to the "Client Authentication" section in the PostgreSQL # documentation for a complete description of this file. A short # synopsis follows. # # ---------------------- # Authentication Records # ---------------------- # # This file controls: which hosts are allowed to connect, how clients # are authenticated, which PostgreSQL user names they can use, which # databases they can access. Records take one of these forms: # # local DATABASE USER METHOD [OPTIONS] # host DATABASE USER ADDRESS METHOD [OPTIONS] # hostssl DATABASE USER ADDRESS METHOD [OPTIONS] # hostnossl DATABASE USER ADDRESS METHOD [OPTIONS] # hostgssenc DATABASE USER ADDRESS METHOD [OPTIONS] # hostnogssenc DATABASE USER ADDRESS METHOD [OPTIONS] # # (The uppercase items must be replaced by actual values.) # # The first field is the connection type: # - "local" is a Unix-domain socket # - "host" is a TCP/IP socket (encrypted or not) # - "hostssl" is a TCP/IP socket that is SSL-encrypted # - "hostnossl" is a TCP/IP socket that is not SSL-encrypted # - "hostgssenc" is a TCP/IP socket that is GSSAPI-encrypted # - "hostnogssenc" is a TCP/IP socket that is not GSSAPI-encrypted # # DATABASE can be "all", "sameuser", "samerole", "replication", a # database name, a regular expression (if it starts with a slash (/)) # or a comma-separated list thereof. The "all" keyword does not match # "replication". Access to replication must be enabled in a separate # record (see example below). # # USER can be "all", a user name, a group name prefixed with "+", a # regular expression (if it starts with a slash (/)) or a comma-separated # list thereof. In both the DATABASE and USER fields you can also write # a file name prefixed with "@" to include names from a separate file. # # ADDRESS specifies the set of hosts the record matches. It can be a # host name, or it is made up of an IP address and a CIDR mask that is # an integer (between 0 and 32 (IPv4) or 128 (IPv6) inclusive) that # specifies the number of significant bits in the mask. A host name # that starts with a dot (.) matches a suffix of the actual host name. # Alternatively, you can write an IP address and netmask in separate # columns to specify the set of hosts. Instead of a CIDR-address, you # can write "samehost" to match any of the server's own IP addresses, # or "samenet" to match any address in any subnet that the server is # directly connected to. # # METHOD can be "trust", "reject", "md5", "password", "scram-sha-256", # "gss", "sspi", "ident", "peer", "pam", "ldap", "radius" or "cert". # Note that "password" sends passwords in clear text; "md5" or # "scram-sha-256" are preferred since they send encrypted passwords. # # OPTIONS are a set of options for the authentication in the format # NAME=VALUE. The available options depend on the different # authentication methods -- refer to the "Client Authentication" # section in the documentation for a list of which options are # available for which authentication methods. # # Database and user names containing spaces, commas, quotes and other # special characters must be quoted. Quoting one of the keywords # "all", "sameuser", "samerole" or "replication" makes the name lose # its special character, and just match a database or username with # that name. # # --------------- # Include Records # --------------- # # This file allows the inclusion of external files or directories holding # more records, using the following keywords: # # include FILE # include_if_exists FILE # include_dir DIRECTORY # # FILE is the file name to include, and DIR is the directory name containing # the file(s) to include. Any file in a directory will be loaded if suffixed # with ".conf". The files of a directory are ordered by name. # include_if_exists ignores missing files. FILE and DIRECTORY can be # specified as a relative or an absolute path, and can be double-quoted if # they contain spaces. # # ------------- # Miscellaneous # ------------- # # This file is read on server startup and when the server receives a # SIGHUP signal. If you edit the file on a running system, you have to # SIGHUP the server for the changes to take effect, run "pg_ctl reload", # or execute "SELECT pg_reload_conf()". # # ---------------------------------- # Put your actual configuration here # ---------------------------------- # # If you want to allow non-local connections, you need to add more # "host" records. In that case you will also need to make PostgreSQL # listen on a non-local interface via the listen_addresses # configuration parameter, or via the -i or -h command line switches. @authcomment@ # TYPE DATABASE USER ADDRESS METHOD @remove-line-for-nolocal@# "local" is for Unix domain socket connections only @remove-line-for-nolocal@local all all @authmethodlocal@ # IPv4 local connections: host all all 127.0.0.1/32 @authmethodhost@ # IPv6 local connections: host all all ::1/128 @authmethodhost@ # Allow replication connections from localhost, by a user with the # replication privilege. @remove-line-for-nolocal@local replication all @authmethodlocal@ host replication all 127.0.0.1/32 @authmethodhost@ host replication all ::1/128 @authmethodhost@ # PostgreSQL User Name Maps # ========================= # # --------------- # Mapping Records # --------------- # # Refer to the PostgreSQL documentation, chapter "Client # Authentication" for a complete description. A short synopsis # follows. # # This file controls PostgreSQL user name mapping. It maps external # user names to their corresponding PostgreSQL user names. Records # are of the form: # # MAPNAME SYSTEM-USERNAME PG-USERNAME # # (The uppercase quantities must be replaced by actual values.) # # MAPNAME is the (otherwise freely chosen) map name that was used in # pg_hba.conf. SYSTEM-USERNAME is the detected user name of the # client. PG-USERNAME is the requested PostgreSQL user name. The # existence of a record specifies that SYSTEM-USERNAME may connect as # PG-USERNAME. # # If SYSTEM-USERNAME starts with a slash (/), it will be treated as a # regular expression. Optionally this can contain a capture (a # parenthesized subexpression). The substring matching the capture # will be substituted for \1 (backslash-one) if present in # PG-USERNAME. # # PG-USERNAME can be "all", a user name, a group name prefixed with "+", or # a regular expression (if it starts with a slash (/)). If it is a regular # expression, the substring matching with \1 has no effect. # # Multiple maps may be specified in this file and used by pg_hba.conf. # # No map names are defined in the default configuration. If all # system user names and PostgreSQL user names are the same, you don't # need anything in this file. # # --------------- # Include Records # --------------- # # This file allows the inclusion of external files or directories holding # more records, using the following keywords: # # include FILE # include_if_exists FILE # include_dir DIRECTORY # # FILE is the file name to include, and DIR is the directory name containing # the file(s) to include. Any file in a directory will be loaded if suffixed # with ".conf". The files of a directory are ordered by name. # include_if_exists ignores missing files. FILE and DIRECTORY can be # specified as a relative or an absolute path, and can be double-quoted if # they contain spaces. # # ------------------------------- # Miscellaneous # ------------------------------- # # This file is read on server startup and when the postmaster receives # a SIGHUP signal. If you edit the file on a running system, you have # to SIGHUP the postmaster for the changes to take effect. You can # use "pg_ctl reload" to do that. # Put your actual configuration here # ---------------------------------- # MAPNAME SYSTEM-USERNAME PG-USERNAME # # Connection configuration file # # A service is a set of named connection parameters. You may specify # multiple services in this file. Each starts with a service name in # brackets. Subsequent lines have connection configuration parameters of # the pattern "param=value" or LDAP URLs starting with "ldap://" # to look up such parameters. A sample configuration for postgres is # included in this file. Lines beginning with '#' are comments. # # Copy this to your sysconf directory (typically /usr/local/pgsql/etc) and # rename it pg_service.conf. # # #[postgres] #dbname=postgres #user=postgres # PostgreSQL 17 create pg_proc 1255 bootstrap rowtype_oid 81 ( oid = oid , proname = name , pronamespace = oid , proowner = oid , prolang = oid , procost = float4 , prorows = float4 , provariadic = oid , prosupport = regproc , prokind = char , prosecdef = bool , proleakproof = bool , proisstrict = bool , proretset = bool , provolatile = char , proparallel = char , pronargs = int2 , pronargdefaults = int2 , prorettype = oid , proargtypes = oidvector FORCE NOT NULL , proallargtypes = _oid , proargmodes = _char , proargnames = _text , proargdefaults = pg_node_tree , protrftypes = _oid , prosrc = text FORCE NOT NULL , probin = text , prosqlbody = pg_node_tree , proconfig = _text , proacl = _aclitem ) insert ( 1242 boolin 11 10 12 1 0 0 0 f f f t f i s 1 0 16 2275 _null_ _null_ _null_ _null_ _null_ boolin _null_ _null_ _null_ _null_ ) insert ( 1243 boolout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 16 _null_ _null_ _null_ _null_ _null_ boolout _null_ _null_ _null_ _null_ ) insert ( 1244 byteain 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2275 _null_ _null_ _null_ _null_ _null_ byteain _null_ _null_ _null_ _null_ ) insert ( 31 byteaout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 17 _null_ _null_ _null_ _null_ _null_ byteaout _null_ _null_ _null_ _null_ ) insert ( 1245 charin 11 10 12 1 0 0 0 f f f t f i s 1 0 18 2275 _null_ _null_ _null_ _null_ _null_ charin _null_ _null_ _null_ _null_ ) insert ( 33 charout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 18 _null_ _null_ _null_ _null_ _null_ charout _null_ _null_ _null_ _null_ ) insert ( 34 namein 11 10 12 1 0 0 0 f f f t f i s 1 0 19 2275 _null_ _null_ _null_ _null_ _null_ namein _null_ _null_ _null_ _null_ ) insert ( 35 nameout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 19 _null_ _null_ _null_ _null_ _null_ nameout _null_ _null_ _null_ _null_ ) insert ( 38 int2in 11 10 12 1 0 0 0 f f f t f i s 1 0 21 2275 _null_ _null_ _null_ _null_ _null_ int2in _null_ _null_ _null_ _null_ ) insert ( 39 int2out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 21 _null_ _null_ _null_ _null_ _null_ int2out _null_ _null_ _null_ _null_ ) insert ( 40 int2vectorin 11 10 12 1 0 0 0 f f f t f i s 1 0 22 2275 _null_ _null_ _null_ _null_ _null_ int2vectorin _null_ _null_ _null_ _null_ ) insert ( 41 int2vectorout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 22 _null_ _null_ _null_ _null_ _null_ int2vectorout _null_ _null_ _null_ _null_ ) insert ( 42 int4in 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2275 _null_ _null_ _null_ _null_ _null_ int4in _null_ _null_ _null_ _null_ ) insert ( 43 int4out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ int4out _null_ _null_ _null_ _null_ ) insert ( 44 regprocin 11 10 12 1 0 0 0 f f f t f s s 1 0 24 2275 _null_ _null_ _null_ _null_ _null_ regprocin _null_ _null_ _null_ _null_ ) insert ( 45 regprocout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 24 _null_ _null_ _null_ _null_ _null_ regprocout _null_ _null_ _null_ _null_ ) insert ( 3494 to_regproc 11 10 12 1 0 0 0 f f f t f s s 1 0 24 25 _null_ _null_ _null_ _null_ _null_ to_regproc _null_ _null_ _null_ _null_ ) insert ( 3479 to_regprocedure 11 10 12 1 0 0 0 f f f t f s s 1 0 2202 25 _null_ _null_ _null_ _null_ _null_ to_regprocedure _null_ _null_ _null_ _null_ ) insert ( 46 textin 11 10 12 1 0 0 0 f f f t f i s 1 0 25 2275 _null_ _null_ _null_ _null_ _null_ textin _null_ _null_ _null_ _null_ ) insert ( 47 textout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 25 _null_ _null_ _null_ _null_ _null_ textout _null_ _null_ _null_ _null_ ) insert ( 48 tidin 11 10 12 1 0 0 0 f f f t f i s 1 0 27 2275 _null_ _null_ _null_ _null_ _null_ tidin _null_ _null_ _null_ _null_ ) insert ( 49 tidout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 27 _null_ _null_ _null_ _null_ _null_ tidout _null_ _null_ _null_ _null_ ) insert ( 50 xidin 11 10 12 1 0 0 0 f f f t f i s 1 0 28 2275 _null_ _null_ _null_ _null_ _null_ xidin _null_ _null_ _null_ _null_ ) insert ( 51 xidout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 28 _null_ _null_ _null_ _null_ _null_ xidout _null_ _null_ _null_ _null_ ) insert ( 5070 xid8in 11 10 12 1 0 0 0 f f f t f i s 1 0 5069 2275 _null_ _null_ _null_ _null_ _null_ xid8in _null_ _null_ _null_ _null_ ) insert ( 5081 xid8out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 5069 _null_ _null_ _null_ _null_ _null_ xid8out _null_ _null_ _null_ _null_ ) insert ( 5082 xid8recv 11 10 12 1 0 0 0 f f f t f i s 1 0 5069 2281 _null_ _null_ _null_ _null_ _null_ xid8recv _null_ _null_ _null_ _null_ ) insert ( 5083 xid8send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 5069 _null_ _null_ _null_ _null_ _null_ xid8send _null_ _null_ _null_ _null_ ) insert ( 52 cidin 11 10 12 1 0 0 0 f f f t f i s 1 0 29 2275 _null_ _null_ _null_ _null_ _null_ cidin _null_ _null_ _null_ _null_ ) insert ( 53 cidout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 29 _null_ _null_ _null_ _null_ _null_ cidout _null_ _null_ _null_ _null_ ) insert ( 54 oidvectorin 11 10 12 1 0 0 0 f f f t f i s 1 0 30 2275 _null_ _null_ _null_ _null_ _null_ oidvectorin _null_ _null_ _null_ _null_ ) insert ( 55 oidvectorout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 30 _null_ _null_ _null_ _null_ _null_ oidvectorout _null_ _null_ _null_ _null_ ) insert ( 56 boollt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boollt _null_ _null_ _null_ _null_ ) insert ( 57 boolgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boolgt _null_ _null_ _null_ _null_ ) insert ( 60 booleq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ booleq _null_ _null_ _null_ _null_ ) insert ( 61 chareq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ chareq _null_ _null_ _null_ _null_ ) insert ( 62 nameeq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ nameeq _null_ _null_ _null_ _null_ ) insert ( 63 int2eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2eq _null_ _null_ _null_ _null_ ) insert ( 64 int2lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2lt _null_ _null_ _null_ _null_ ) insert ( 65 int4eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4eq _null_ _null_ _null_ _null_ ) insert ( 66 int4lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4lt _null_ _null_ _null_ _null_ ) insert ( 67 texteq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ texteq _null_ _null_ _null_ _null_ ) insert ( 3696 starts_with 11 10 12 1 0 0 6242 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_starts_with _null_ _null_ _null_ _null_ ) insert ( 6242 text_starts_with_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ text_starts_with_support _null_ _null_ _null_ _null_ ) insert ( 68 xideq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '28 28' _null_ _null_ _null_ _null_ _null_ xideq _null_ _null_ _null_ _null_ ) insert ( 3308 xidneq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '28 28' _null_ _null_ _null_ _null_ _null_ xidneq _null_ _null_ _null_ _null_ ) insert ( 5084 xid8eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8eq _null_ _null_ _null_ _null_ ) insert ( 5085 xid8ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8ne _null_ _null_ _null_ _null_ ) insert ( 5034 xid8lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8lt _null_ _null_ _null_ _null_ ) insert ( 5035 xid8gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8gt _null_ _null_ _null_ _null_ ) insert ( 5036 xid8le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8le _null_ _null_ _null_ _null_ ) insert ( 5037 xid8ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8ge _null_ _null_ _null_ _null_ ) insert ( 5096 xid8cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8cmp _null_ _null_ _null_ _null_ ) insert ( 5071 xid 11 10 12 1 0 0 0 f f f t f i s 1 0 28 5069 _null_ _null_ _null_ _null_ _null_ xid8toxid _null_ _null_ _null_ _null_ ) insert ( 5097 xid8_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 5069 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8_larger _null_ _null_ _null_ _null_ ) insert ( 5098 xid8_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 5069 '5069 5069' _null_ _null_ _null_ _null_ _null_ xid8_smaller _null_ _null_ _null_ _null_ ) insert ( 69 cideq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '29 29' _null_ _null_ _null_ _null_ _null_ cideq _null_ _null_ _null_ _null_ ) insert ( 70 charne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ charne _null_ _null_ _null_ _null_ ) insert ( 1246 charlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ charlt _null_ _null_ _null_ _null_ ) insert ( 72 charle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ charle _null_ _null_ _null_ _null_ ) insert ( 73 chargt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ chargt _null_ _null_ _null_ _null_ ) insert ( 74 charge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '18 18' _null_ _null_ _null_ _null_ _null_ charge _null_ _null_ _null_ _null_ ) insert ( 77 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 18 _null_ _null_ _null_ _null_ _null_ chartoi4 _null_ _null_ _null_ _null_ ) insert ( 78 char 11 10 12 1 0 0 0 f f f t f i s 1 0 18 23 _null_ _null_ _null_ _null_ _null_ i4tochar _null_ _null_ _null_ _null_ ) insert ( 79 nameregexeq 11 10 12 1 0 0 1364 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameregexeq _null_ _null_ _null_ _null_ ) insert ( 1252 nameregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameregexne _null_ _null_ _null_ _null_ ) insert ( 1254 textregexeq 11 10 12 1 0 0 1364 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textregexeq _null_ _null_ _null_ _null_ ) insert ( 1256 textregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textregexne _null_ _null_ _null_ _null_ ) insert ( 1364 textregexeq_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ textregexeq_support _null_ _null_ _null_ _null_ ) insert ( 1257 textlen 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ textlen _null_ _null_ _null_ _null_ ) insert ( 1258 textcat 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ textcat _null_ _null_ _null_ _null_ ) insert ( 84 boolne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boolne _null_ _null_ _null_ _null_ ) insert ( 89 version 11 10 12 1 0 0 0 f f f t f s s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ pgsql_version _null_ _null_ _null_ _null_ ) insert ( 86 pg_ddl_command_in 11 10 12 1 0 0 0 f f f t f i s 1 0 32 2275 _null_ _null_ _null_ _null_ _null_ pg_ddl_command_in _null_ _null_ _null_ _null_ ) insert ( 87 pg_ddl_command_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 32 _null_ _null_ _null_ _null_ _null_ pg_ddl_command_out _null_ _null_ _null_ _null_ ) insert ( 88 pg_ddl_command_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 32 2281 _null_ _null_ _null_ _null_ _null_ pg_ddl_command_recv _null_ _null_ _null_ _null_ ) insert ( 90 pg_ddl_command_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 32 _null_ _null_ _null_ _null_ _null_ pg_ddl_command_send _null_ _null_ _null_ _null_ ) insert ( 101 eqsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ eqsel _null_ _null_ _null_ _null_ ) insert ( 102 neqsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ neqsel _null_ _null_ _null_ _null_ ) insert ( 103 scalarltsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ scalarltsel _null_ _null_ _null_ _null_ ) insert ( 104 scalargtsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ scalargtsel _null_ _null_ _null_ _null_ ) insert ( 105 eqjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ eqjoinsel _null_ _null_ _null_ _null_ ) insert ( 106 neqjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ neqjoinsel _null_ _null_ _null_ _null_ ) insert ( 107 scalarltjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ scalarltjoinsel _null_ _null_ _null_ _null_ ) insert ( 108 scalargtjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ scalargtjoinsel _null_ _null_ _null_ _null_ ) insert ( 336 scalarlesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ scalarlesel _null_ _null_ _null_ _null_ ) insert ( 337 scalargesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ scalargesel _null_ _null_ _null_ _null_ ) insert ( 386 scalarlejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ scalarlejoinsel _null_ _null_ _null_ _null_ ) insert ( 398 scalargejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ scalargejoinsel _null_ _null_ _null_ _null_ ) insert ( 109 unknownin 11 10 12 1 0 0 0 f f f t f i s 1 0 705 2275 _null_ _null_ _null_ _null_ _null_ unknownin _null_ _null_ _null_ _null_ ) insert ( 110 unknownout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 705 _null_ _null_ _null_ _null_ _null_ unknownout _null_ _null_ _null_ _null_ ) insert ( 115 box_above_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_above_eq _null_ _null_ _null_ _null_ ) insert ( 116 box_below_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_below_eq _null_ _null_ _null_ _null_ ) insert ( 117 point_in 11 10 12 1 0 0 0 f f f t f i s 1 0 600 2275 _null_ _null_ _null_ _null_ _null_ point_in _null_ _null_ _null_ _null_ ) insert ( 118 point_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 600 _null_ _null_ _null_ _null_ _null_ point_out _null_ _null_ _null_ _null_ ) insert ( 119 lseg_in 11 10 12 1 0 0 0 f f f t f i s 1 0 601 2275 _null_ _null_ _null_ _null_ _null_ lseg_in _null_ _null_ _null_ _null_ ) insert ( 120 lseg_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 601 _null_ _null_ _null_ _null_ _null_ lseg_out _null_ _null_ _null_ _null_ ) insert ( 121 path_in 11 10 12 1 0 0 0 f f f t f i s 1 0 602 2275 _null_ _null_ _null_ _null_ _null_ path_in _null_ _null_ _null_ _null_ ) insert ( 122 path_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 602 _null_ _null_ _null_ _null_ _null_ path_out _null_ _null_ _null_ _null_ ) insert ( 123 box_in 11 10 12 1 0 0 0 f f f t f i s 1 0 603 2275 _null_ _null_ _null_ _null_ _null_ box_in _null_ _null_ _null_ _null_ ) insert ( 124 box_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 603 _null_ _null_ _null_ _null_ _null_ box_out _null_ _null_ _null_ _null_ ) insert ( 125 box_overlap 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_overlap _null_ _null_ _null_ _null_ ) insert ( 126 box_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_ge _null_ _null_ _null_ _null_ ) insert ( 127 box_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_gt _null_ _null_ _null_ _null_ ) insert ( 128 box_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_eq _null_ _null_ _null_ _null_ ) insert ( 129 box_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_lt _null_ _null_ _null_ _null_ ) insert ( 130 box_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_le _null_ _null_ _null_ _null_ ) insert ( 131 point_above 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_above _null_ _null_ _null_ _null_ ) insert ( 132 point_left 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_left _null_ _null_ _null_ _null_ ) insert ( 133 point_right 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_right _null_ _null_ _null_ _null_ ) insert ( 134 point_below 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_below _null_ _null_ _null_ _null_ ) insert ( 135 point_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_eq _null_ _null_ _null_ _null_ ) insert ( 136 on_pb 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 603' _null_ _null_ _null_ _null_ _null_ on_pb _null_ _null_ _null_ _null_ ) insert ( 137 on_ppath 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 602' _null_ _null_ _null_ _null_ _null_ on_ppath _null_ _null_ _null_ _null_ ) insert ( 138 box_center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 603 _null_ _null_ _null_ _null_ _null_ box_center _null_ _null_ _null_ _null_ ) insert ( 139 areasel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ areasel _null_ _null_ _null_ _null_ ) insert ( 140 areajoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ areajoinsel _null_ _null_ _null_ _null_ ) insert ( 141 int4mul 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4mul _null_ _null_ _null_ _null_ ) insert ( 144 int4ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4ne _null_ _null_ _null_ _null_ ) insert ( 145 int2ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2ne _null_ _null_ _null_ _null_ ) insert ( 146 int2gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2gt _null_ _null_ _null_ _null_ ) insert ( 147 int4gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4gt _null_ _null_ _null_ _null_ ) insert ( 148 int2le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2le _null_ _null_ _null_ _null_ ) insert ( 149 int4le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4le _null_ _null_ _null_ _null_ ) insert ( 150 int4ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ int4ge _null_ _null_ _null_ _null_ ) insert ( 151 int2ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 21' _null_ _null_ _null_ _null_ _null_ int2ge _null_ _null_ _null_ _null_ ) insert ( 152 int2mul 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2mul _null_ _null_ _null_ _null_ ) insert ( 153 int2div 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2div _null_ _null_ _null_ _null_ ) insert ( 154 int4div 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4div _null_ _null_ _null_ _null_ ) insert ( 155 int2mod 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2mod _null_ _null_ _null_ _null_ ) insert ( 156 int4mod 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4mod _null_ _null_ _null_ _null_ ) insert ( 157 textne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textne _null_ _null_ _null_ _null_ ) insert ( 158 int24eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24eq _null_ _null_ _null_ _null_ ) insert ( 159 int42eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42eq _null_ _null_ _null_ _null_ ) insert ( 160 int24lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24lt _null_ _null_ _null_ _null_ ) insert ( 161 int42lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42lt _null_ _null_ _null_ _null_ ) insert ( 162 int24gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24gt _null_ _null_ _null_ _null_ ) insert ( 163 int42gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42gt _null_ _null_ _null_ _null_ ) insert ( 164 int24ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24ne _null_ _null_ _null_ _null_ ) insert ( 165 int42ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42ne _null_ _null_ _null_ _null_ ) insert ( 166 int24le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24le _null_ _null_ _null_ _null_ ) insert ( 167 int42le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42le _null_ _null_ _null_ _null_ ) insert ( 168 int24ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 23' _null_ _null_ _null_ _null_ _null_ int24ge _null_ _null_ _null_ _null_ ) insert ( 169 int42ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 21' _null_ _null_ _null_ _null_ _null_ int42ge _null_ _null_ _null_ _null_ ) insert ( 170 int24mul 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '21 23' _null_ _null_ _null_ _null_ _null_ int24mul _null_ _null_ _null_ _null_ ) insert ( 171 int42mul 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 21' _null_ _null_ _null_ _null_ _null_ int42mul _null_ _null_ _null_ _null_ ) insert ( 172 int24div 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '21 23' _null_ _null_ _null_ _null_ _null_ int24div _null_ _null_ _null_ _null_ ) insert ( 173 int42div 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 21' _null_ _null_ _null_ _null_ _null_ int42div _null_ _null_ _null_ _null_ ) insert ( 176 int2pl 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2pl _null_ _null_ _null_ _null_ ) insert ( 177 int4pl 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4pl _null_ _null_ _null_ _null_ ) insert ( 178 int24pl 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '21 23' _null_ _null_ _null_ _null_ _null_ int24pl _null_ _null_ _null_ _null_ ) insert ( 179 int42pl 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 21' _null_ _null_ _null_ _null_ _null_ int42pl _null_ _null_ _null_ _null_ ) insert ( 180 int2mi 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2mi _null_ _null_ _null_ _null_ ) insert ( 181 int4mi 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4mi _null_ _null_ _null_ _null_ ) insert ( 182 int24mi 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '21 23' _null_ _null_ _null_ _null_ _null_ int24mi _null_ _null_ _null_ _null_ ) insert ( 183 int42mi 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 21' _null_ _null_ _null_ _null_ _null_ int42mi _null_ _null_ _null_ _null_ ) insert ( 184 oideq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oideq _null_ _null_ _null_ _null_ ) insert ( 185 oidne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oidne _null_ _null_ _null_ _null_ ) insert ( 186 box_same 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_same _null_ _null_ _null_ _null_ ) insert ( 187 box_contain 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_contain _null_ _null_ _null_ _null_ ) insert ( 188 box_left 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_left _null_ _null_ _null_ _null_ ) insert ( 189 box_overleft 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_overleft _null_ _null_ _null_ _null_ ) insert ( 190 box_overright 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_overright _null_ _null_ _null_ _null_ ) insert ( 191 box_right 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_right _null_ _null_ _null_ _null_ ) insert ( 192 box_contained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_contained _null_ _null_ _null_ _null_ ) insert ( 193 box_contain_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 600' _null_ _null_ _null_ _null_ _null_ box_contain_pt _null_ _null_ _null_ _null_ ) insert ( 195 pg_node_tree_in 11 10 12 1 0 0 0 f f f t f i s 1 0 194 2275 _null_ _null_ _null_ _null_ _null_ pg_node_tree_in _null_ _null_ _null_ _null_ ) insert ( 196 pg_node_tree_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 194 _null_ _null_ _null_ _null_ _null_ pg_node_tree_out _null_ _null_ _null_ _null_ ) insert ( 197 pg_node_tree_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 194 2281 _null_ _null_ _null_ _null_ _null_ pg_node_tree_recv _null_ _null_ _null_ _null_ ) insert ( 198 pg_node_tree_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 194 _null_ _null_ _null_ _null_ _null_ pg_node_tree_send _null_ _null_ _null_ _null_ ) insert ( 200 float4in 11 10 12 1 0 0 0 f f f t f i s 1 0 700 2275 _null_ _null_ _null_ _null_ _null_ float4in _null_ _null_ _null_ _null_ ) insert ( 201 float4out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 700 _null_ _null_ _null_ _null_ _null_ float4out _null_ _null_ _null_ _null_ ) insert ( 202 float4mul 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4mul _null_ _null_ _null_ _null_ ) insert ( 203 float4div 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4div _null_ _null_ _null_ _null_ ) insert ( 204 float4pl 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4pl _null_ _null_ _null_ _null_ ) insert ( 205 float4mi 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4mi _null_ _null_ _null_ _null_ ) insert ( 206 float4um 11 10 12 1 0 0 0 f f f t f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ float4um _null_ _null_ _null_ _null_ ) insert ( 207 float4abs 11 10 12 1 0 0 0 f f f t f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ float4abs _null_ _null_ _null_ _null_ ) insert ( 208 float4_accum 11 10 12 1 0 0 0 f f f t f i s 2 0 1022 '1022 700' _null_ _null_ _null_ _null_ _null_ float4_accum _null_ _null_ _null_ _null_ ) insert ( 209 float4larger 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4larger _null_ _null_ _null_ _null_ ) insert ( 211 float4smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '700 700' _null_ _null_ _null_ _null_ _null_ float4smaller _null_ _null_ _null_ _null_ ) insert ( 212 int4um 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4um _null_ _null_ _null_ _null_ ) insert ( 213 int2um 11 10 12 1 0 0 0 f f f t f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ int2um _null_ _null_ _null_ _null_ ) insert ( 214 float8in 11 10 12 1 0 0 0 f f f t f i s 1 0 701 2275 _null_ _null_ _null_ _null_ _null_ float8in _null_ _null_ _null_ _null_ ) insert ( 215 float8out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 701 _null_ _null_ _null_ _null_ _null_ float8out _null_ _null_ _null_ _null_ ) insert ( 216 float8mul 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8mul _null_ _null_ _null_ _null_ ) insert ( 217 float8div 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8div _null_ _null_ _null_ _null_ ) insert ( 218 float8pl 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8pl _null_ _null_ _null_ _null_ ) insert ( 219 float8mi 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8mi _null_ _null_ _null_ _null_ ) insert ( 220 float8um 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ float8um _null_ _null_ _null_ _null_ ) insert ( 221 float8abs 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ float8abs _null_ _null_ _null_ _null_ ) insert ( 222 float8_accum 11 10 12 1 0 0 0 f f f t f i s 2 0 1022 '1022 701' _null_ _null_ _null_ _null_ _null_ float8_accum _null_ _null_ _null_ _null_ ) insert ( 276 float8_combine 11 10 12 1 0 0 0 f f f t f i s 2 0 1022 '1022 1022' _null_ _null_ _null_ _null_ _null_ float8_combine _null_ _null_ _null_ _null_ ) insert ( 223 float8larger 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8larger _null_ _null_ _null_ _null_ ) insert ( 224 float8smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ float8smaller _null_ _null_ _null_ _null_ ) insert ( 225 lseg_center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 601 _null_ _null_ _null_ _null_ _null_ lseg_center _null_ _null_ _null_ _null_ ) insert ( 227 poly_center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 604 _null_ _null_ _null_ _null_ _null_ poly_center _null_ _null_ _null_ _null_ ) insert ( 228 dround 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dround _null_ _null_ _null_ _null_ ) insert ( 229 dtrunc 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dtrunc _null_ _null_ _null_ _null_ ) insert ( 2308 ceil 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dceil _null_ _null_ _null_ _null_ ) insert ( 2320 ceiling 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dceil _null_ _null_ _null_ _null_ ) insert ( 2309 floor 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dfloor _null_ _null_ _null_ _null_ ) insert ( 2310 sign 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsign _null_ _null_ _null_ _null_ ) insert ( 230 dsqrt 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsqrt _null_ _null_ _null_ _null_ ) insert ( 231 dcbrt 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcbrt _null_ _null_ _null_ _null_ ) insert ( 232 dpow 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ dpow _null_ _null_ _null_ _null_ ) insert ( 233 dexp 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dexp _null_ _null_ _null_ _null_ ) insert ( 234 dlog1 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dlog1 _null_ _null_ _null_ _null_ ) insert ( 235 float8 11 10 12 1 0 0 0 f f t t f i s 1 0 701 21 _null_ _null_ _null_ _null_ _null_ i2tod _null_ _null_ _null_ _null_ ) insert ( 236 float4 11 10 12 1 0 0 0 f f t t f i s 1 0 700 21 _null_ _null_ _null_ _null_ _null_ i2tof _null_ _null_ _null_ _null_ ) insert ( 237 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 701 _null_ _null_ _null_ _null_ _null_ dtoi2 _null_ _null_ _null_ _null_ ) insert ( 238 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 700 _null_ _null_ _null_ _null_ _null_ ftoi2 _null_ _null_ _null_ _null_ ) insert ( 239 line_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '628 628' _null_ _null_ _null_ _null_ _null_ line_distance _null_ _null_ _null_ _null_ ) insert ( 240 nameeqtext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameeqtext _null_ _null_ _null_ _null_ ) insert ( 241 namelttext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namelttext _null_ _null_ _null_ _null_ ) insert ( 242 nameletext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameletext _null_ _null_ _null_ _null_ ) insert ( 243 namegetext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namegetext _null_ _null_ _null_ _null_ ) insert ( 244 namegttext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namegttext _null_ _null_ _null_ _null_ ) insert ( 245 namenetext 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namenetext _null_ _null_ _null_ _null_ ) insert ( 246 btnametextcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '19 25' _null_ _null_ _null_ _null_ _null_ btnametextcmp _null_ _null_ _null_ _null_ ) insert ( 247 texteqname 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ texteqname _null_ _null_ _null_ _null_ ) insert ( 248 textltname 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ textltname _null_ _null_ _null_ _null_ ) insert ( 249 textlename 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ textlename _null_ _null_ _null_ _null_ ) insert ( 250 textgename 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ textgename _null_ _null_ _null_ _null_ ) insert ( 251 textgtname 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ textgtname _null_ _null_ _null_ _null_ ) insert ( 252 textnename 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 19' _null_ _null_ _null_ _null_ _null_ textnename _null_ _null_ _null_ _null_ ) insert ( 253 bttextnamecmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '25 19' _null_ _null_ _null_ _null_ _null_ bttextnamecmp _null_ _null_ _null_ _null_ ) insert ( 266 nameconcatoid 11 10 12 1 0 0 0 f f f t f i s 2 0 19 '19 26' _null_ _null_ _null_ _null_ _null_ nameconcatoid _null_ _null_ _null_ _null_ ) insert ( 274 timeofday 11 10 12 1 0 0 0 f f f t f v s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ timeofday _null_ _null_ _null_ _null_ ) insert ( 277 inter_sl 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 628' _null_ _null_ _null_ _null_ _null_ inter_sl _null_ _null_ _null_ _null_ ) insert ( 278 inter_lb 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 603' _null_ _null_ _null_ _null_ _null_ inter_lb _null_ _null_ _null_ _null_ ) insert ( 279 float48mul 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '700 701' _null_ _null_ _null_ _null_ _null_ float48mul _null_ _null_ _null_ _null_ ) insert ( 280 float48div 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '700 701' _null_ _null_ _null_ _null_ _null_ float48div _null_ _null_ _null_ _null_ ) insert ( 281 float48pl 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '700 701' _null_ _null_ _null_ _null_ _null_ float48pl _null_ _null_ _null_ _null_ ) insert ( 282 float48mi 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '700 701' _null_ _null_ _null_ _null_ _null_ float48mi _null_ _null_ _null_ _null_ ) insert ( 283 float84mul 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 700' _null_ _null_ _null_ _null_ _null_ float84mul _null_ _null_ _null_ _null_ ) insert ( 284 float84div 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 700' _null_ _null_ _null_ _null_ _null_ float84div _null_ _null_ _null_ _null_ ) insert ( 285 float84pl 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 700' _null_ _null_ _null_ _null_ _null_ float84pl _null_ _null_ _null_ _null_ ) insert ( 286 float84mi 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 700' _null_ _null_ _null_ _null_ _null_ float84mi _null_ _null_ _null_ _null_ ) insert ( 287 float4eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4eq _null_ _null_ _null_ _null_ ) insert ( 288 float4ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4ne _null_ _null_ _null_ _null_ ) insert ( 289 float4lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4lt _null_ _null_ _null_ _null_ ) insert ( 290 float4le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4le _null_ _null_ _null_ _null_ ) insert ( 291 float4gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4gt _null_ _null_ _null_ _null_ ) insert ( 292 float4ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 700' _null_ _null_ _null_ _null_ _null_ float4ge _null_ _null_ _null_ _null_ ) insert ( 293 float8eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8eq _null_ _null_ _null_ _null_ ) insert ( 294 float8ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8ne _null_ _null_ _null_ _null_ ) insert ( 295 float8lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8lt _null_ _null_ _null_ _null_ ) insert ( 296 float8le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8le _null_ _null_ _null_ _null_ ) insert ( 297 float8gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8gt _null_ _null_ _null_ _null_ ) insert ( 298 float8ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 701' _null_ _null_ _null_ _null_ _null_ float8ge _null_ _null_ _null_ _null_ ) insert ( 299 float48eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48eq _null_ _null_ _null_ _null_ ) insert ( 300 float48ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48ne _null_ _null_ _null_ _null_ ) insert ( 301 float48lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48lt _null_ _null_ _null_ _null_ ) insert ( 302 float48le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48le _null_ _null_ _null_ _null_ ) insert ( 303 float48gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48gt _null_ _null_ _null_ _null_ ) insert ( 304 float48ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '700 701' _null_ _null_ _null_ _null_ _null_ float48ge _null_ _null_ _null_ _null_ ) insert ( 305 float84eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84eq _null_ _null_ _null_ _null_ ) insert ( 306 float84ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84ne _null_ _null_ _null_ _null_ ) insert ( 307 float84lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84lt _null_ _null_ _null_ _null_ ) insert ( 308 float84le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84le _null_ _null_ _null_ _null_ ) insert ( 309 float84gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84gt _null_ _null_ _null_ _null_ ) insert ( 310 float84ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '701 700' _null_ _null_ _null_ _null_ _null_ float84ge _null_ _null_ _null_ _null_ ) insert ( 320 width_bucket 11 10 12 1 0 0 0 f f f t f i s 4 0 23 '701 701 701 23' _null_ _null_ _null_ _null_ _null_ width_bucket_float8 _null_ _null_ _null_ _null_ ) insert ( 311 float8 11 10 12 1 0 0 0 f f t t f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ ftod _null_ _null_ _null_ _null_ ) insert ( 312 float4 11 10 12 1 0 0 0 f f f t f i s 1 0 700 701 _null_ _null_ _null_ _null_ _null_ dtof _null_ _null_ _null_ _null_ ) insert ( 313 int4 11 10 12 1 0 0 0 f f t t f i s 1 0 23 21 _null_ _null_ _null_ _null_ _null_ i2toi4 _null_ _null_ _null_ _null_ ) insert ( 314 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 23 _null_ _null_ _null_ _null_ _null_ i4toi2 _null_ _null_ _null_ _null_ ) insert ( 316 float8 11 10 12 1 0 0 0 f f t t f i s 1 0 701 23 _null_ _null_ _null_ _null_ _null_ i4tod _null_ _null_ _null_ _null_ ) insert ( 317 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 701 _null_ _null_ _null_ _null_ _null_ dtoi4 _null_ _null_ _null_ _null_ ) insert ( 318 float4 11 10 12 1 0 0 0 f f t t f i s 1 0 700 23 _null_ _null_ _null_ _null_ _null_ i4tof _null_ _null_ _null_ _null_ ) insert ( 319 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 700 _null_ _null_ _null_ _null_ _null_ ftoi4 _null_ _null_ _null_ _null_ ) insert ( 3 heap_tableam_handler 11 10 12 1 0 0 0 f f f t f v s 1 0 269 2281 _null_ _null_ _null_ _null_ _null_ heap_tableam_handler _null_ _null_ _null_ _null_ ) insert ( 330 bthandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ bthandler _null_ _null_ _null_ _null_ ) insert ( 331 hashhandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ hashhandler _null_ _null_ _null_ _null_ ) insert ( 332 gisthandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ gisthandler _null_ _null_ _null_ _null_ ) insert ( 333 ginhandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ ginhandler _null_ _null_ _null_ _null_ ) insert ( 334 spghandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ spghandler _null_ _null_ _null_ _null_ ) insert ( 335 brinhandler 11 10 12 1 0 0 0 f f f t f v s 1 0 325 2281 _null_ _null_ _null_ _null_ _null_ brinhandler _null_ _null_ _null_ _null_ ) insert ( 3952 brin_summarize_new_values 11 10 12 1 0 0 0 f f f t f v u 1 0 23 2205 _null_ _null_ _null_ _null_ _null_ brin_summarize_new_values _null_ _null_ _null_ _null_ ) insert ( 3999 brin_summarize_range 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '2205 20' _null_ _null_ _null_ _null_ _null_ brin_summarize_range _null_ _null_ _null_ _null_ ) insert ( 4014 brin_desummarize_range 11 10 12 1 0 0 0 f f f t f v u 2 0 2278 '2205 20' _null_ _null_ _null_ _null_ _null_ brin_desummarize_range _null_ _null_ _null_ _null_ ) insert ( 338 amvalidate 11 10 12 1 0 0 0 f f f t f v s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ amvalidate _null_ _null_ _null_ _null_ ) insert ( 636 pg_indexam_has_property 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ pg_indexam_has_property _null_ _null_ _null_ _null_ ) insert ( 637 pg_index_has_property 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '2205 25' _null_ _null_ _null_ _null_ _null_ pg_index_has_property _null_ _null_ _null_ _null_ ) insert ( 638 pg_index_column_has_property 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '2205 23 25' _null_ _null_ _null_ _null_ _null_ pg_index_column_has_property _null_ _null_ _null_ _null_ ) insert ( 676 pg_indexam_progress_phasename 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '26 20' _null_ _null_ _null_ _null_ _null_ pg_indexam_progress_phasename _null_ _null_ _null_ _null_ ) insert ( 339 poly_same 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_same _null_ _null_ _null_ _null_ ) insert ( 340 poly_contain 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_contain _null_ _null_ _null_ _null_ ) insert ( 341 poly_left 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_left _null_ _null_ _null_ _null_ ) insert ( 342 poly_overleft 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_overleft _null_ _null_ _null_ _null_ ) insert ( 343 poly_overright 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_overright _null_ _null_ _null_ _null_ ) insert ( 344 poly_right 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_right _null_ _null_ _null_ _null_ ) insert ( 345 poly_contained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_contained _null_ _null_ _null_ _null_ ) insert ( 346 poly_overlap 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_overlap _null_ _null_ _null_ _null_ ) insert ( 347 poly_in 11 10 12 1 0 0 0 f f f t f i s 1 0 604 2275 _null_ _null_ _null_ _null_ _null_ poly_in _null_ _null_ _null_ _null_ ) insert ( 348 poly_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 604 _null_ _null_ _null_ _null_ _null_ poly_out _null_ _null_ _null_ _null_ ) insert ( 350 btint2cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '21 21' _null_ _null_ _null_ _null_ _null_ btint2cmp _null_ _null_ _null_ _null_ ) insert ( 3129 btint2sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btint2sortsupport _null_ _null_ _null_ _null_ ) insert ( 351 btint4cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ btint4cmp _null_ _null_ _null_ _null_ ) insert ( 3130 btint4sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btint4sortsupport _null_ _null_ _null_ _null_ ) insert ( 842 btint8cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '20 20' _null_ _null_ _null_ _null_ _null_ btint8cmp _null_ _null_ _null_ _null_ ) insert ( 3131 btint8sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btint8sortsupport _null_ _null_ _null_ _null_ ) insert ( 354 btfloat4cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '700 700' _null_ _null_ _null_ _null_ _null_ btfloat4cmp _null_ _null_ _null_ _null_ ) insert ( 3132 btfloat4sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btfloat4sortsupport _null_ _null_ _null_ _null_ ) insert ( 355 btfloat8cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '701 701' _null_ _null_ _null_ _null_ _null_ btfloat8cmp _null_ _null_ _null_ _null_ ) insert ( 3133 btfloat8sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btfloat8sortsupport _null_ _null_ _null_ _null_ ) insert ( 356 btoidcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '26 26' _null_ _null_ _null_ _null_ _null_ btoidcmp _null_ _null_ _null_ _null_ ) insert ( 3134 btoidsortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btoidsortsupport _null_ _null_ _null_ _null_ ) insert ( 404 btoidvectorcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '30 30' _null_ _null_ _null_ _null_ _null_ btoidvectorcmp _null_ _null_ _null_ _null_ ) insert ( 358 btcharcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '18 18' _null_ _null_ _null_ _null_ _null_ btcharcmp _null_ _null_ _null_ _null_ ) insert ( 359 btnamecmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '19 19' _null_ _null_ _null_ _null_ _null_ btnamecmp _null_ _null_ _null_ _null_ ) insert ( 3135 btnamesortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btnamesortsupport _null_ _null_ _null_ _null_ ) insert ( 360 bttextcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ bttextcmp _null_ _null_ _null_ _null_ ) insert ( 3255 bttextsortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ bttextsortsupport _null_ _null_ _null_ _null_ ) insert ( 5050 btvarstrequalimage 11 10 12 1 0 0 0 f f f t f i s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ btvarstrequalimage _null_ _null_ _null_ _null_ ) insert ( 377 cash_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '790 790' _null_ _null_ _null_ _null_ _null_ cash_cmp _null_ _null_ _null_ _null_ ) insert ( 382 btarraycmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2277 2277' _null_ _null_ _null_ _null_ _null_ btarraycmp _null_ _null_ _null_ _null_ ) insert ( 4126 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '20 20 20 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int8_int8 _null_ _null_ _null_ _null_ ) insert ( 4127 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '23 23 20 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int4_int8 _null_ _null_ _null_ _null_ ) insert ( 4128 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '23 23 23 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int4_int4 _null_ _null_ _null_ _null_ ) insert ( 4129 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '23 23 21 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int4_int2 _null_ _null_ _null_ _null_ ) insert ( 4130 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '21 21 20 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int2_int8 _null_ _null_ _null_ _null_ ) insert ( 4131 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '21 21 23 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int2_int4 _null_ _null_ _null_ _null_ ) insert ( 4132 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '21 21 21 16 16' _null_ _null_ _null_ _null_ _null_ in_range_int2_int2 _null_ _null_ _null_ _null_ ) insert ( 4139 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '701 701 701 16 16' _null_ _null_ _null_ _null_ _null_ in_range_float8_float8 _null_ _null_ _null_ _null_ ) insert ( 4140 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '700 700 701 16 16' _null_ _null_ _null_ _null_ _null_ in_range_float4_float8 _null_ _null_ _null_ _null_ ) insert ( 4141 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1700 1700 1700 16 16' _null_ _null_ _null_ _null_ _null_ in_range_numeric_numeric _null_ _null_ _null_ _null_ ) insert ( 361 lseg_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_distance _null_ _null_ _null_ _null_ ) insert ( 362 lseg_interpt 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_interpt _null_ _null_ _null_ _null_ ) insert ( 363 dist_ps 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 601' _null_ _null_ _null_ _null_ _null_ dist_ps _null_ _null_ _null_ _null_ ) insert ( 380 dist_sp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '601 600' _null_ _null_ _null_ _null_ _null_ dist_sp _null_ _null_ _null_ _null_ ) insert ( 364 dist_pb 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 603' _null_ _null_ _null_ _null_ _null_ dist_pb _null_ _null_ _null_ _null_ ) insert ( 357 dist_bp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '603 600' _null_ _null_ _null_ _null_ _null_ dist_bp _null_ _null_ _null_ _null_ ) insert ( 365 dist_sb 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '601 603' _null_ _null_ _null_ _null_ _null_ dist_sb _null_ _null_ _null_ _null_ ) insert ( 381 dist_bs 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '603 601' _null_ _null_ _null_ _null_ _null_ dist_bs _null_ _null_ _null_ _null_ ) insert ( 366 close_ps 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 601' _null_ _null_ _null_ _null_ _null_ close_ps _null_ _null_ _null_ _null_ ) insert ( 367 close_pb 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 603' _null_ _null_ _null_ _null_ _null_ close_pb _null_ _null_ _null_ _null_ ) insert ( 368 close_sb 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '601 603' _null_ _null_ _null_ _null_ _null_ close_sb _null_ _null_ _null_ _null_ ) insert ( 369 on_ps 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 601' _null_ _null_ _null_ _null_ _null_ on_ps _null_ _null_ _null_ _null_ ) insert ( 370 path_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '602 602' _null_ _null_ _null_ _null_ _null_ path_distance _null_ _null_ _null_ _null_ ) insert ( 371 dist_ppath 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 602' _null_ _null_ _null_ _null_ _null_ dist_ppath _null_ _null_ _null_ _null_ ) insert ( 421 dist_pathp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '602 600' _null_ _null_ _null_ _null_ _null_ dist_pathp _null_ _null_ _null_ _null_ ) insert ( 372 on_sb 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 603' _null_ _null_ _null_ _null_ _null_ on_sb _null_ _null_ _null_ _null_ ) insert ( 373 inter_sb 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 603' _null_ _null_ _null_ _null_ _null_ inter_sb _null_ _null_ _null_ _null_ ) insert ( 401 text 11 10 12 1 0 0 0 f f f t f i s 1 0 25 1042 _null_ _null_ _null_ _null_ _null_ rtrim1 _null_ _null_ _null_ _null_ ) insert ( 406 text 11 10 12 1 0 0 0 f f t t f i s 1 0 25 19 _null_ _null_ _null_ _null_ _null_ name_text _null_ _null_ _null_ _null_ ) insert ( 407 name 11 10 12 1 0 0 0 f f t t f i s 1 0 19 25 _null_ _null_ _null_ _null_ _null_ text_name _null_ _null_ _null_ _null_ ) insert ( 408 bpchar 11 10 12 1 0 0 0 f f f t f i s 1 0 1042 19 _null_ _null_ _null_ _null_ _null_ name_bpchar _null_ _null_ _null_ _null_ ) insert ( 409 name 11 10 12 1 0 0 0 f f t t f i s 1 0 19 1042 _null_ _null_ _null_ _null_ _null_ bpchar_name _null_ _null_ _null_ _null_ ) insert ( 449 hashint2 11 10 12 1 0 0 0 f f f t f i s 1 0 23 21 _null_ _null_ _null_ _null_ _null_ hashint2 _null_ _null_ _null_ _null_ ) insert ( 441 hashint2extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '21 20' _null_ _null_ _null_ _null_ _null_ hashint2extended _null_ _null_ _null_ _null_ ) insert ( 450 hashint4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ hashint4 _null_ _null_ _null_ _null_ ) insert ( 425 hashint4extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '23 20' _null_ _null_ _null_ _null_ _null_ hashint4extended _null_ _null_ _null_ _null_ ) insert ( 949 hashint8 11 10 12 1 0 0 0 f f f t f i s 1 0 23 20 _null_ _null_ _null_ _null_ _null_ hashint8 _null_ _null_ _null_ _null_ ) insert ( 442 hashint8extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ hashint8extended _null_ _null_ _null_ _null_ ) insert ( 451 hashfloat4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 700 _null_ _null_ _null_ _null_ _null_ hashfloat4 _null_ _null_ _null_ _null_ ) insert ( 443 hashfloat4extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '700 20' _null_ _null_ _null_ _null_ _null_ hashfloat4extended _null_ _null_ _null_ _null_ ) insert ( 452 hashfloat8 11 10 12 1 0 0 0 f f f t f i s 1 0 23 701 _null_ _null_ _null_ _null_ _null_ hashfloat8 _null_ _null_ _null_ _null_ ) insert ( 444 hashfloat8extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '701 20' _null_ _null_ _null_ _null_ _null_ hashfloat8extended _null_ _null_ _null_ _null_ ) insert ( 453 hashoid 11 10 12 1 0 0 0 f f f t f i s 1 0 23 26 _null_ _null_ _null_ _null_ _null_ hashoid _null_ _null_ _null_ _null_ ) insert ( 445 hashoidextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '26 20' _null_ _null_ _null_ _null_ _null_ hashoidextended _null_ _null_ _null_ _null_ ) insert ( 454 hashchar 11 10 12 1 0 0 0 f f f t f i s 1 0 23 18 _null_ _null_ _null_ _null_ _null_ hashchar _null_ _null_ _null_ _null_ ) insert ( 446 hashcharextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '18 20' _null_ _null_ _null_ _null_ _null_ hashcharextended _null_ _null_ _null_ _null_ ) insert ( 455 hashname 11 10 12 1 0 0 0 f f f t f i s 1 0 23 19 _null_ _null_ _null_ _null_ _null_ hashname _null_ _null_ _null_ _null_ ) insert ( 447 hashnameextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '19 20' _null_ _null_ _null_ _null_ _null_ hashnameextended _null_ _null_ _null_ _null_ ) insert ( 400 hashtext 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ hashtext _null_ _null_ _null_ _null_ ) insert ( 448 hashtextextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '25 20' _null_ _null_ _null_ _null_ _null_ hashtextextended _null_ _null_ _null_ _null_ ) insert ( 456 hashvarlena 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2281 _null_ _null_ _null_ _null_ _null_ hashvarlena _null_ _null_ _null_ _null_ ) insert ( 772 hashvarlenaextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '2281 20' _null_ _null_ _null_ _null_ _null_ hashvarlenaextended _null_ _null_ _null_ _null_ ) insert ( 457 hashoidvector 11 10 12 1 0 0 0 f f f t f i s 1 0 23 30 _null_ _null_ _null_ _null_ _null_ hashoidvector _null_ _null_ _null_ _null_ ) insert ( 776 hashoidvectorextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '30 20' _null_ _null_ _null_ _null_ _null_ hashoidvectorextended _null_ _null_ _null_ _null_ ) insert ( 329 hash_aclitem 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1033 _null_ _null_ _null_ _null_ _null_ hash_aclitem _null_ _null_ _null_ _null_ ) insert ( 777 hash_aclitem_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1033 20' _null_ _null_ _null_ _null_ _null_ hash_aclitem_extended _null_ _null_ _null_ _null_ ) insert ( 399 hashmacaddr 11 10 12 1 0 0 0 f f f t f i s 1 0 23 829 _null_ _null_ _null_ _null_ _null_ hashmacaddr _null_ _null_ _null_ _null_ ) insert ( 778 hashmacaddrextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '829 20' _null_ _null_ _null_ _null_ _null_ hashmacaddrextended _null_ _null_ _null_ _null_ ) insert ( 422 hashinet 11 10 12 1 0 0 0 f f f t f i s 1 0 23 869 _null_ _null_ _null_ _null_ _null_ hashinet _null_ _null_ _null_ _null_ ) insert ( 779 hashinetextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '869 20' _null_ _null_ _null_ _null_ _null_ hashinetextended _null_ _null_ _null_ _null_ ) insert ( 432 hash_numeric 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1700 _null_ _null_ _null_ _null_ _null_ hash_numeric _null_ _null_ _null_ _null_ ) insert ( 780 hash_numeric_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1700 20' _null_ _null_ _null_ _null_ _null_ hash_numeric_extended _null_ _null_ _null_ _null_ ) insert ( 328 hashmacaddr8 11 10 12 1 0 0 0 f f f t f i s 1 0 23 774 _null_ _null_ _null_ _null_ _null_ hashmacaddr8 _null_ _null_ _null_ _null_ ) insert ( 781 hashmacaddr8extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '774 20' _null_ _null_ _null_ _null_ _null_ hashmacaddr8extended _null_ _null_ _null_ _null_ ) insert ( 438 num_nulls 11 10 12 1 0 2276 0 f f f f f i s 1 0 23 2276 '{2276}' '{v}' _null_ _null_ _null_ pg_num_nulls _null_ _null_ _null_ _null_ ) insert ( 440 num_nonnulls 11 10 12 1 0 2276 0 f f f f f i s 1 0 23 2276 '{2276}' '{v}' _null_ _null_ _null_ pg_num_nonnulls _null_ _null_ _null_ _null_ ) insert ( 458 text_larger 11 10 12 1 0 0 0 f f t t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ text_larger _null_ _null_ _null_ _null_ ) insert ( 459 text_smaller 11 10 12 1 0 0 0 f f t t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ text_smaller _null_ _null_ _null_ _null_ ) insert ( 460 int8in 11 10 12 1 0 0 0 f f f t f i s 1 0 20 2275 _null_ _null_ _null_ _null_ _null_ int8in _null_ _null_ _null_ _null_ ) insert ( 461 int8out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 20 _null_ _null_ _null_ _null_ _null_ int8out _null_ _null_ _null_ _null_ ) insert ( 462 int8um 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8um _null_ _null_ _null_ _null_ ) insert ( 463 int8pl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8pl _null_ _null_ _null_ _null_ ) insert ( 464 int8mi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8mi _null_ _null_ _null_ _null_ ) insert ( 465 int8mul 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8mul _null_ _null_ _null_ _null_ ) insert ( 466 int8div 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8div _null_ _null_ _null_ _null_ ) insert ( 467 int8eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8eq _null_ _null_ _null_ _null_ ) insert ( 468 int8ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8ne _null_ _null_ _null_ _null_ ) insert ( 469 int8lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8lt _null_ _null_ _null_ _null_ ) insert ( 470 int8gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8gt _null_ _null_ _null_ _null_ ) insert ( 471 int8le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8le _null_ _null_ _null_ _null_ ) insert ( 472 int8ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 20' _null_ _null_ _null_ _null_ _null_ int8ge _null_ _null_ _null_ _null_ ) insert ( 474 int84eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84eq _null_ _null_ _null_ _null_ ) insert ( 475 int84ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84ne _null_ _null_ _null_ _null_ ) insert ( 476 int84lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84lt _null_ _null_ _null_ _null_ ) insert ( 477 int84gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84gt _null_ _null_ _null_ _null_ ) insert ( 478 int84le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84le _null_ _null_ _null_ _null_ ) insert ( 479 int84ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 23' _null_ _null_ _null_ _null_ _null_ int84ge _null_ _null_ _null_ _null_ ) insert ( 480 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 20 _null_ _null_ _null_ _null_ _null_ int84 _null_ _null_ _null_ _null_ ) insert ( 481 int8 11 10 12 1 0 0 0 f f t t f i s 1 0 20 23 _null_ _null_ _null_ _null_ _null_ int48 _null_ _null_ _null_ _null_ ) insert ( 482 float8 11 10 12 1 0 0 0 f f t t f i s 1 0 701 20 _null_ _null_ _null_ _null_ _null_ i8tod _null_ _null_ _null_ _null_ ) insert ( 483 int8 11 10 12 1 0 0 0 f f f t f i s 1 0 20 701 _null_ _null_ _null_ _null_ _null_ dtoi8 _null_ _null_ _null_ _null_ ) insert ( 626 hash_array 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2277 _null_ _null_ _null_ _null_ _null_ hash_array _null_ _null_ _null_ _null_ ) insert ( 782 hash_array_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '2277 20' _null_ _null_ _null_ _null_ _null_ hash_array_extended _null_ _null_ _null_ _null_ ) insert ( 652 float4 11 10 12 1 0 0 0 f f t t f i s 1 0 700 20 _null_ _null_ _null_ _null_ _null_ i8tof _null_ _null_ _null_ _null_ ) insert ( 653 int8 11 10 12 1 0 0 0 f f f t f i s 1 0 20 700 _null_ _null_ _null_ _null_ _null_ ftoi8 _null_ _null_ _null_ _null_ ) insert ( 714 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 20 _null_ _null_ _null_ _null_ _null_ int82 _null_ _null_ _null_ _null_ ) insert ( 754 int8 11 10 12 1 0 0 0 f f t t f i s 1 0 20 21 _null_ _null_ _null_ _null_ _null_ int28 _null_ _null_ _null_ _null_ ) insert ( 655 namelt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ namelt _null_ _null_ _null_ _null_ ) insert ( 656 namele 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ namele _null_ _null_ _null_ _null_ ) insert ( 657 namegt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ namegt _null_ _null_ _null_ _null_ ) insert ( 658 namege 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ namege _null_ _null_ _null_ _null_ ) insert ( 659 namene 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '19 19' _null_ _null_ _null_ _null_ _null_ namene _null_ _null_ _null_ _null_ ) insert ( 668 bpchar 11 10 12 1 0 0 0 f f f t f i s 3 0 1042 '1042 23 16' _null_ _null_ _null_ _null_ _null_ bpchar _null_ _null_ _null_ _null_ ) insert ( 3097 varchar_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ varchar_support _null_ _null_ _null_ _null_ ) insert ( 669 varchar 11 10 12 1 0 0 3097 f f f t f i s 3 0 1043 '1043 23 16' _null_ _null_ _null_ _null_ _null_ varchar _null_ _null_ _null_ _null_ ) insert ( 619 oidvectorne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectorne _null_ _null_ _null_ _null_ ) insert ( 677 oidvectorlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectorlt _null_ _null_ _null_ _null_ ) insert ( 678 oidvectorle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectorle _null_ _null_ _null_ _null_ ) insert ( 679 oidvectoreq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectoreq _null_ _null_ _null_ _null_ ) insert ( 680 oidvectorge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectorge _null_ _null_ _null_ _null_ ) insert ( 681 oidvectorgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '30 30' _null_ _null_ _null_ _null_ _null_ oidvectorgt _null_ _null_ _null_ _null_ ) insert ( 710 getpgusername 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ current_user _null_ _null_ _null_ _null_ ) insert ( 716 oidlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oidlt _null_ _null_ _null_ _null_ ) insert ( 717 oidle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oidle _null_ _null_ _null_ _null_ ) insert ( 720 octet_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 17 _null_ _null_ _null_ _null_ _null_ byteaoctetlen _null_ _null_ _null_ _null_ ) insert ( 721 get_byte 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '17 23' _null_ _null_ _null_ _null_ _null_ byteaGetByte _null_ _null_ _null_ _null_ ) insert ( 722 set_byte 11 10 12 1 0 0 0 f f f t f i s 3 0 17 '17 23 23' _null_ _null_ _null_ _null_ _null_ byteaSetByte _null_ _null_ _null_ _null_ ) insert ( 723 get_bit 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '17 20' _null_ _null_ _null_ _null_ _null_ byteaGetBit _null_ _null_ _null_ _null_ ) insert ( 724 set_bit 11 10 12 1 0 0 0 f f f t f i s 3 0 17 '17 20 23' _null_ _null_ _null_ _null_ _null_ byteaSetBit _null_ _null_ _null_ _null_ ) insert ( 749 overlay 11 10 12 1 0 0 0 f f f t f i s 4 0 17 '17 17 23 23' _null_ _null_ _null_ _null_ _null_ byteaoverlay _null_ _null_ _null_ _null_ ) insert ( 752 overlay 11 10 12 1 0 0 0 f f f t f i s 3 0 17 '17 17 23' _null_ _null_ _null_ _null_ _null_ byteaoverlay_no_len _null_ _null_ _null_ _null_ ) insert ( 6163 bit_count 11 10 12 1 0 0 0 f f f t f i s 1 0 20 17 _null_ _null_ _null_ _null_ _null_ bytea_bit_count _null_ _null_ _null_ _null_ ) insert ( 725 dist_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 628' _null_ _null_ _null_ _null_ _null_ dist_pl _null_ _null_ _null_ _null_ ) insert ( 702 dist_lp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '628 600' _null_ _null_ _null_ _null_ _null_ dist_lp _null_ _null_ _null_ _null_ ) insert ( 727 dist_sl 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '601 628' _null_ _null_ _null_ _null_ _null_ dist_sl _null_ _null_ _null_ _null_ ) insert ( 704 dist_ls 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '628 601' _null_ _null_ _null_ _null_ _null_ dist_ls _null_ _null_ _null_ _null_ ) insert ( 728 dist_cpoly 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '718 604' _null_ _null_ _null_ _null_ _null_ dist_cpoly _null_ _null_ _null_ _null_ ) insert ( 785 dist_polyc 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '604 718' _null_ _null_ _null_ _null_ _null_ dist_polyc _null_ _null_ _null_ _null_ ) insert ( 729 poly_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '604 604' _null_ _null_ _null_ _null_ _null_ poly_distance _null_ _null_ _null_ _null_ ) insert ( 3275 dist_ppoly 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 604' _null_ _null_ _null_ _null_ _null_ dist_ppoly _null_ _null_ _null_ _null_ ) insert ( 3292 dist_polyp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '604 600' _null_ _null_ _null_ _null_ _null_ dist_polyp _null_ _null_ _null_ _null_ ) insert ( 3290 dist_cpoint 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '718 600' _null_ _null_ _null_ _null_ _null_ dist_cpoint _null_ _null_ _null_ _null_ ) insert ( 740 text_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_lt _null_ _null_ _null_ _null_ ) insert ( 741 text_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_le _null_ _null_ _null_ _null_ ) insert ( 742 text_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_gt _null_ _null_ _null_ _null_ ) insert ( 743 text_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_ge _null_ _null_ _null_ _null_ ) insert ( 745 current_user 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ current_user _null_ _null_ _null_ _null_ ) insert ( 746 session_user 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ session_user _null_ _null_ _null_ _null_ ) insert ( 6311 system_user 11 10 12 1 0 0 0 f f f t f s s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ system_user _null_ _null_ _null_ _null_ ) insert ( 744 array_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_eq _null_ _null_ _null_ _null_ ) insert ( 390 array_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_ne _null_ _null_ _null_ _null_ ) insert ( 391 array_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_lt _null_ _null_ _null_ _null_ ) insert ( 392 array_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_gt _null_ _null_ _null_ _null_ ) insert ( 393 array_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_le _null_ _null_ _null_ _null_ ) insert ( 396 array_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_ge _null_ _null_ _null_ _null_ ) insert ( 747 array_dims 11 10 12 1 0 0 0 f f f t f i s 1 0 25 2277 _null_ _null_ _null_ _null_ _null_ array_dims _null_ _null_ _null_ _null_ ) insert ( 748 array_ndims 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2277 _null_ _null_ _null_ _null_ _null_ array_ndims _null_ _null_ _null_ _null_ ) insert ( 750 array_in 11 10 12 1 0 0 0 f f f t f s s 3 0 2277 '2275 26 23' _null_ _null_ _null_ _null_ _null_ array_in _null_ _null_ _null_ _null_ ) insert ( 751 array_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2277 _null_ _null_ _null_ _null_ _null_ array_out _null_ _null_ _null_ _null_ ) insert ( 2091 array_lower 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2277 23' _null_ _null_ _null_ _null_ _null_ array_lower _null_ _null_ _null_ _null_ ) insert ( 2092 array_upper 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2277 23' _null_ _null_ _null_ _null_ _null_ array_upper _null_ _null_ _null_ _null_ ) insert ( 2176 array_length 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2277 23' _null_ _null_ _null_ _null_ _null_ array_length _null_ _null_ _null_ _null_ ) insert ( 3179 cardinality 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2277 _null_ _null_ _null_ _null_ _null_ array_cardinality _null_ _null_ _null_ _null_ ) insert ( 378 array_append 11 10 12 1 0 0 0 f f f f f i s 2 0 5078 '5078 5077' _null_ _null_ _null_ _null_ _null_ array_append _null_ _null_ _null_ _null_ ) insert ( 379 array_prepend 11 10 12 1 0 0 0 f f f f f i s 2 0 5078 '5077 5078' _null_ _null_ _null_ _null_ _null_ array_prepend _null_ _null_ _null_ _null_ ) insert ( 383 array_cat 11 10 12 1 0 0 0 f f f f f i s 2 0 5078 '5078 5078' _null_ _null_ _null_ _null_ _null_ array_cat _null_ _null_ _null_ _null_ ) insert ( 394 string_to_array 11 10 12 1 0 0 0 f f f f f i s 2 0 1009 '25 25' _null_ _null_ _null_ _null_ _null_ text_to_array _null_ _null_ _null_ _null_ ) insert ( 376 string_to_array 11 10 12 1 0 0 0 f f f f f i s 3 0 1009 '25 25 25' _null_ _null_ _null_ _null_ _null_ text_to_array_null _null_ _null_ _null_ _null_ ) insert ( 6160 string_to_table 11 10 12 1 1000 0 0 f f f f t i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ text_to_table _null_ _null_ _null_ _null_ ) insert ( 6161 string_to_table 11 10 12 1 1000 0 0 f f f f t i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ text_to_table_null _null_ _null_ _null_ _null_ ) insert ( 395 array_to_string 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '2277 25' _null_ _null_ _null_ _null_ _null_ array_to_text _null_ _null_ _null_ _null_ ) insert ( 384 array_to_string 11 10 12 1 0 0 0 f f f f f s s 3 0 25 '2277 25 25' _null_ _null_ _null_ _null_ _null_ array_to_text_null _null_ _null_ _null_ _null_ ) insert ( 515 array_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 2277 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_larger _null_ _null_ _null_ _null_ ) insert ( 516 array_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 2277 '2277 2277' _null_ _null_ _null_ _null_ _null_ array_smaller _null_ _null_ _null_ _null_ ) insert ( 3277 array_position 11 10 12 1 0 0 0 f f f f f i s 2 0 23 '5078 5077' _null_ _null_ _null_ _null_ _null_ array_position _null_ _null_ _null_ _null_ ) insert ( 3278 array_position 11 10 12 1 0 0 0 f f f f f i s 3 0 23 '5078 5077 23' _null_ _null_ _null_ _null_ _null_ array_position_start _null_ _null_ _null_ _null_ ) insert ( 3279 array_positions 11 10 12 1 0 0 0 f f f f f i s 2 0 1007 '5078 5077' _null_ _null_ _null_ _null_ _null_ array_positions _null_ _null_ _null_ _null_ ) insert ( 1191 generate_subscripts 11 10 12 1 1000 0 0 f f f t t i s 3 0 23 '2277 23 16' _null_ _null_ _null_ _null_ _null_ generate_subscripts _null_ _null_ _null_ _null_ ) insert ( 1192 generate_subscripts 11 10 12 1 1000 0 0 f f f t t i s 2 0 23 '2277 23' _null_ _null_ _null_ _null_ _null_ generate_subscripts_nodir _null_ _null_ _null_ _null_ ) insert ( 1193 array_fill 11 10 12 1 0 0 0 f f f f f i s 2 0 2277 '2283 1007' _null_ _null_ _null_ _null_ _null_ array_fill _null_ _null_ _null_ _null_ ) insert ( 1286 array_fill 11 10 12 1 0 0 0 f f f f f i s 3 0 2277 '2283 1007 1007' _null_ _null_ _null_ _null_ _null_ array_fill_with_lower_bounds _null_ _null_ _null_ _null_ ) insert ( 2331 unnest 11 10 12 1 100 0 3996 f f f t t i s 1 0 2283 2277 _null_ _null_ _null_ _null_ _null_ array_unnest _null_ _null_ _null_ _null_ ) insert ( 3996 array_unnest_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ array_unnest_support _null_ _null_ _null_ _null_ ) insert ( 3167 array_remove 11 10 12 1 0 0 0 f f f f f i s 2 0 5078 '5078 5077' _null_ _null_ _null_ _null_ _null_ array_remove _null_ _null_ _null_ _null_ ) insert ( 3168 array_replace 11 10 12 1 0 0 0 f f f f f i s 3 0 5078 '5078 5077 5077' _null_ _null_ _null_ _null_ _null_ array_replace _null_ _null_ _null_ _null_ ) insert ( 2333 array_agg_transfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2776' _null_ _null_ _null_ _null_ _null_ array_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6293 array_agg_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ array_agg_combine _null_ _null_ _null_ _null_ ) insert ( 6294 array_agg_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ array_agg_serialize _null_ _null_ _null_ _null_ ) insert ( 6295 array_agg_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ array_agg_deserialize _null_ _null_ _null_ _null_ ) insert ( 2334 array_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2277 '2281 2776' _null_ _null_ _null_ _null_ _null_ array_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 2335 array_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 2277 2776 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 4051 array_agg_array_transfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2277' _null_ _null_ _null_ _null_ _null_ array_agg_array_transfn _null_ _null_ _null_ _null_ ) insert ( 6296 array_agg_array_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ array_agg_array_combine _null_ _null_ _null_ _null_ ) insert ( 6297 array_agg_array_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ array_agg_array_serialize _null_ _null_ _null_ _null_ ) insert ( 6298 array_agg_array_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ array_agg_array_deserialize _null_ _null_ _null_ _null_ ) insert ( 4052 array_agg_array_finalfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2277 '2281 2277' _null_ _null_ _null_ _null_ _null_ array_agg_array_finalfn _null_ _null_ _null_ _null_ ) insert ( 4053 array_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 2277 2277 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3218 width_bucket 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '5077 5078' _null_ _null_ _null_ _null_ _null_ width_bucket_array _null_ _null_ _null_ _null_ ) insert ( 6172 trim_array 11 10 12 1 0 0 0 f f f t f i s 2 0 2277 '2277 23' _null_ _null_ _null_ _null_ _null_ trim_array _null_ _null_ _null_ _null_ ) insert ( 6215 array_shuffle 11 10 12 1 0 0 0 f f f t f v s 1 0 2277 2277 _null_ _null_ _null_ _null_ _null_ array_shuffle _null_ _null_ _null_ _null_ ) insert ( 6216 array_sample 11 10 12 1 0 0 0 f f f t f v s 2 0 2277 '2277 23' _null_ _null_ _null_ _null_ _null_ array_sample _null_ _null_ _null_ _null_ ) insert ( 3816 array_typanalyze 11 10 12 1 0 0 0 f f f t f s s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ array_typanalyze _null_ _null_ _null_ _null_ ) insert ( 3817 arraycontsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ arraycontsel _null_ _null_ _null_ _null_ ) insert ( 3818 arraycontjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ arraycontjoinsel _null_ _null_ _null_ _null_ ) insert ( 764 lo_import 11 10 12 1 0 0 0 f f f t f v u 1 0 26 25 _null_ _null_ _null_ _null_ _null_ be_lo_import _null_ _null_ _null_ _null_ ) insert ( 767 lo_import 11 10 12 1 0 0 0 f f f t f v u 2 0 26 '25 26' _null_ _null_ _null_ _null_ _null_ be_lo_import_with_oid _null_ _null_ _null_ _null_ ) insert ( 765 lo_export 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '26 25' _null_ _null_ _null_ _null_ _null_ be_lo_export _null_ _null_ _null_ _null_ ) insert ( 766 int4inc 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4inc _null_ _null_ _null_ _null_ ) insert ( 768 int4larger 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4larger _null_ _null_ _null_ _null_ ) insert ( 769 int4smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4smaller _null_ _null_ _null_ _null_ ) insert ( 770 int2larger 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2larger _null_ _null_ _null_ _null_ ) insert ( 771 int2smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2smaller _null_ _null_ _null_ _null_ ) insert ( 846 cash_mul_flt4 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 700' _null_ _null_ _null_ _null_ _null_ cash_mul_flt4 _null_ _null_ _null_ _null_ ) insert ( 847 cash_div_flt4 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 700' _null_ _null_ _null_ _null_ _null_ cash_div_flt4 _null_ _null_ _null_ _null_ ) insert ( 848 flt4_mul_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '700 790' _null_ _null_ _null_ _null_ _null_ flt4_mul_cash _null_ _null_ _null_ _null_ ) insert ( 849 position 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ textpos _null_ _null_ _null_ _null_ ) insert ( 850 textlike 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textlike _null_ _null_ _null_ _null_ ) insert ( 1023 textlike_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ textlike_support _null_ _null_ _null_ _null_ ) insert ( 851 textnlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textnlike _null_ _null_ _null_ _null_ ) insert ( 852 int48eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48eq _null_ _null_ _null_ _null_ ) insert ( 853 int48ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48ne _null_ _null_ _null_ _null_ ) insert ( 854 int48lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48lt _null_ _null_ _null_ _null_ ) insert ( 855 int48gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48gt _null_ _null_ _null_ _null_ ) insert ( 856 int48le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48le _null_ _null_ _null_ _null_ ) insert ( 857 int48ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '23 20' _null_ _null_ _null_ _null_ _null_ int48ge _null_ _null_ _null_ _null_ ) insert ( 858 namelike 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namelike _null_ _null_ _null_ _null_ ) insert ( 859 namenlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namenlike _null_ _null_ _null_ _null_ ) insert ( 860 bpchar 11 10 12 1 0 0 0 f f f t f i s 1 0 1042 18 _null_ _null_ _null_ _null_ _null_ char_bpchar _null_ _null_ _null_ _null_ ) insert ( 861 current_database 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ current_database _null_ _null_ _null_ _null_ ) insert ( 817 current_query 11 10 12 1 0 0 0 f f f f f v r 0 0 25 '' _null_ _null_ _null_ _null_ _null_ current_query _null_ _null_ _null_ _null_ ) insert ( 3399 int8_mul_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '20 790' _null_ _null_ _null_ _null_ _null_ int8_mul_cash _null_ _null_ _null_ _null_ ) insert ( 862 int4_mul_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '23 790' _null_ _null_ _null_ _null_ _null_ int4_mul_cash _null_ _null_ _null_ _null_ ) insert ( 863 int2_mul_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '21 790' _null_ _null_ _null_ _null_ _null_ int2_mul_cash _null_ _null_ _null_ _null_ ) insert ( 3344 cash_mul_int8 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 20' _null_ _null_ _null_ _null_ _null_ cash_mul_int8 _null_ _null_ _null_ _null_ ) insert ( 3345 cash_div_int8 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 20' _null_ _null_ _null_ _null_ _null_ cash_div_int8 _null_ _null_ _null_ _null_ ) insert ( 864 cash_mul_int4 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 23' _null_ _null_ _null_ _null_ _null_ cash_mul_int4 _null_ _null_ _null_ _null_ ) insert ( 865 cash_div_int4 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 23' _null_ _null_ _null_ _null_ _null_ cash_div_int4 _null_ _null_ _null_ _null_ ) insert ( 866 cash_mul_int2 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 21' _null_ _null_ _null_ _null_ _null_ cash_mul_int2 _null_ _null_ _null_ _null_ ) insert ( 867 cash_div_int2 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 21' _null_ _null_ _null_ _null_ _null_ cash_div_int2 _null_ _null_ _null_ _null_ ) insert ( 886 cash_in 11 10 12 1 0 0 0 f f f t f s s 1 0 790 2275 _null_ _null_ _null_ _null_ _null_ cash_in _null_ _null_ _null_ _null_ ) insert ( 887 cash_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 790 _null_ _null_ _null_ _null_ _null_ cash_out _null_ _null_ _null_ _null_ ) insert ( 888 cash_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_eq _null_ _null_ _null_ _null_ ) insert ( 889 cash_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_ne _null_ _null_ _null_ _null_ ) insert ( 890 cash_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_lt _null_ _null_ _null_ _null_ ) insert ( 891 cash_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_le _null_ _null_ _null_ _null_ ) insert ( 892 cash_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_gt _null_ _null_ _null_ _null_ ) insert ( 893 cash_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '790 790' _null_ _null_ _null_ _null_ _null_ cash_ge _null_ _null_ _null_ _null_ ) insert ( 894 cash_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 790' _null_ _null_ _null_ _null_ _null_ cash_pl _null_ _null_ _null_ _null_ ) insert ( 895 cash_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 790' _null_ _null_ _null_ _null_ _null_ cash_mi _null_ _null_ _null_ _null_ ) insert ( 896 cash_mul_flt8 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 701' _null_ _null_ _null_ _null_ _null_ cash_mul_flt8 _null_ _null_ _null_ _null_ ) insert ( 897 cash_div_flt8 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 701' _null_ _null_ _null_ _null_ _null_ cash_div_flt8 _null_ _null_ _null_ _null_ ) insert ( 898 cashlarger 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 790' _null_ _null_ _null_ _null_ _null_ cashlarger _null_ _null_ _null_ _null_ ) insert ( 899 cashsmaller 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '790 790' _null_ _null_ _null_ _null_ _null_ cashsmaller _null_ _null_ _null_ _null_ ) insert ( 919 flt8_mul_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 790 '701 790' _null_ _null_ _null_ _null_ _null_ flt8_mul_cash _null_ _null_ _null_ _null_ ) insert ( 935 cash_words 11 10 12 1 0 0 0 f f f t f i s 1 0 25 790 _null_ _null_ _null_ _null_ _null_ cash_words _null_ _null_ _null_ _null_ ) insert ( 3822 cash_div_cash 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '790 790' _null_ _null_ _null_ _null_ _null_ cash_div_cash _null_ _null_ _null_ _null_ ) insert ( 3823 numeric 11 10 12 1 0 0 0 f f f t f s s 1 0 1700 790 _null_ _null_ _null_ _null_ _null_ cash_numeric _null_ _null_ _null_ _null_ ) insert ( 3824 money 11 10 12 1 0 0 0 f f f t f s s 1 0 790 1700 _null_ _null_ _null_ _null_ _null_ numeric_cash _null_ _null_ _null_ _null_ ) insert ( 3811 money 11 10 12 1 0 0 0 f f f t f s s 1 0 790 23 _null_ _null_ _null_ _null_ _null_ int4_cash _null_ _null_ _null_ _null_ ) insert ( 3812 money 11 10 12 1 0 0 0 f f f t f s s 1 0 790 20 _null_ _null_ _null_ _null_ _null_ int8_cash _null_ _null_ _null_ _null_ ) insert ( 940 mod 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2mod _null_ _null_ _null_ _null_ ) insert ( 941 mod 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4mod _null_ _null_ _null_ _null_ ) insert ( 945 int8mod 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8mod _null_ _null_ _null_ _null_ ) insert ( 947 mod 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8mod _null_ _null_ _null_ _null_ ) insert ( 5044 gcd 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4gcd _null_ _null_ _null_ _null_ ) insert ( 5045 gcd 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8gcd _null_ _null_ _null_ _null_ ) insert ( 5046 lcm 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4lcm _null_ _null_ _null_ _null_ ) insert ( 5047 lcm 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8lcm _null_ _null_ _null_ _null_ ) insert ( 944 char 11 10 12 1 0 0 0 f f f t f i s 1 0 18 25 _null_ _null_ _null_ _null_ _null_ text_char _null_ _null_ _null_ _null_ ) insert ( 946 text 11 10 12 1 0 0 0 f f f t f i s 1 0 25 18 _null_ _null_ _null_ _null_ _null_ char_text _null_ _null_ _null_ _null_ ) insert ( 952 lo_open 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '26 23' _null_ _null_ _null_ _null_ _null_ be_lo_open _null_ _null_ _null_ _null_ ) insert ( 953 lo_close 11 10 12 1 0 0 0 f f f t f v u 1 0 23 23 _null_ _null_ _null_ _null_ _null_ be_lo_close _null_ _null_ _null_ _null_ ) insert ( 954 loread 11 10 12 1 0 0 0 f f f t f v u 2 0 17 '23 23' _null_ _null_ _null_ _null_ _null_ be_loread _null_ _null_ _null_ _null_ ) insert ( 955 lowrite 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '23 17' _null_ _null_ _null_ _null_ _null_ be_lowrite _null_ _null_ _null_ _null_ ) insert ( 956 lo_lseek 11 10 12 1 0 0 0 f f f t f v u 3 0 23 '23 23 23' _null_ _null_ _null_ _null_ _null_ be_lo_lseek _null_ _null_ _null_ _null_ ) insert ( 3170 lo_lseek64 11 10 12 1 0 0 0 f f f t f v u 3 0 20 '23 20 23' _null_ _null_ _null_ _null_ _null_ be_lo_lseek64 _null_ _null_ _null_ _null_ ) insert ( 957 lo_creat 11 10 12 1 0 0 0 f f f t f v u 1 0 26 23 _null_ _null_ _null_ _null_ _null_ be_lo_creat _null_ _null_ _null_ _null_ ) insert ( 715 lo_create 11 10 12 1 0 0 0 f f f t f v u 1 0 26 26 _null_ _null_ _null_ _null_ _null_ be_lo_create _null_ _null_ _null_ _null_ ) insert ( 958 lo_tell 11 10 12 1 0 0 0 f f f t f v u 1 0 23 23 _null_ _null_ _null_ _null_ _null_ be_lo_tell _null_ _null_ _null_ _null_ ) insert ( 3171 lo_tell64 11 10 12 1 0 0 0 f f f t f v u 1 0 20 23 _null_ _null_ _null_ _null_ _null_ be_lo_tell64 _null_ _null_ _null_ _null_ ) insert ( 1004 lo_truncate 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ be_lo_truncate _null_ _null_ _null_ _null_ ) insert ( 3172 lo_truncate64 11 10 12 1 0 0 0 f f f t f v u 2 0 23 '23 20' _null_ _null_ _null_ _null_ _null_ be_lo_truncate64 _null_ _null_ _null_ _null_ ) insert ( 3457 lo_from_bytea 11 10 12 1 0 0 0 f f f t f v u 2 0 26 '26 17' _null_ _null_ _null_ _null_ _null_ be_lo_from_bytea _null_ _null_ _null_ _null_ ) insert ( 3458 lo_get 11 10 12 1 0 0 0 f f f t f v u 1 0 17 26 _null_ _null_ _null_ _null_ _null_ be_lo_get _null_ _null_ _null_ _null_ ) insert ( 3459 lo_get 11 10 12 1 0 0 0 f f f t f v u 3 0 17 '26 20 23' _null_ _null_ _null_ _null_ _null_ be_lo_get_fragment _null_ _null_ _null_ _null_ ) insert ( 3460 lo_put 11 10 12 1 0 0 0 f f f t f v u 3 0 2278 '26 20 17' _null_ _null_ _null_ _null_ _null_ be_lo_put _null_ _null_ _null_ _null_ ) insert ( 959 on_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 628' _null_ _null_ _null_ _null_ _null_ on_pl _null_ _null_ _null_ _null_ ) insert ( 960 on_sl 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 628' _null_ _null_ _null_ _null_ _null_ on_sl _null_ _null_ _null_ _null_ ) insert ( 961 close_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 628' _null_ _null_ _null_ _null_ _null_ close_pl _null_ _null_ _null_ _null_ ) insert ( 964 lo_unlink 11 10 12 1 0 0 0 f f f t f v u 1 0 23 26 _null_ _null_ _null_ _null_ _null_ be_lo_unlink _null_ _null_ _null_ _null_ ) insert ( 973 path_inter 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_inter _null_ _null_ _null_ _null_ ) insert ( 975 area 11 10 12 1 0 0 0 f f f t f i s 1 0 701 603 _null_ _null_ _null_ _null_ _null_ box_area _null_ _null_ _null_ _null_ ) insert ( 976 width 11 10 12 1 0 0 0 f f f t f i s 1 0 701 603 _null_ _null_ _null_ _null_ _null_ box_width _null_ _null_ _null_ _null_ ) insert ( 977 height 11 10 12 1 0 0 0 f f f t f i s 1 0 701 603 _null_ _null_ _null_ _null_ _null_ box_height _null_ _null_ _null_ _null_ ) insert ( 978 box_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '603 603' _null_ _null_ _null_ _null_ _null_ box_distance _null_ _null_ _null_ _null_ ) insert ( 979 area 11 10 12 1 0 0 0 f f f t f i s 1 0 701 602 _null_ _null_ _null_ _null_ _null_ path_area _null_ _null_ _null_ _null_ ) insert ( 980 box_intersect 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 603' _null_ _null_ _null_ _null_ _null_ box_intersect _null_ _null_ _null_ _null_ ) insert ( 4067 bound_box 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 603' _null_ _null_ _null_ _null_ _null_ boxes_bound_box _null_ _null_ _null_ _null_ ) insert ( 981 diagonal 11 10 12 1 0 0 0 f f f t f i s 1 0 601 603 _null_ _null_ _null_ _null_ _null_ box_diagonal _null_ _null_ _null_ _null_ ) insert ( 982 path_n_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_n_lt _null_ _null_ _null_ _null_ ) insert ( 983 path_n_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_n_gt _null_ _null_ _null_ _null_ ) insert ( 984 path_n_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_n_eq _null_ _null_ _null_ _null_ ) insert ( 985 path_n_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_n_le _null_ _null_ _null_ _null_ ) insert ( 986 path_n_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '602 602' _null_ _null_ _null_ _null_ _null_ path_n_ge _null_ _null_ _null_ _null_ ) insert ( 987 path_length 11 10 12 1 0 0 0 f f f t f i s 1 0 701 602 _null_ _null_ _null_ _null_ _null_ path_length _null_ _null_ _null_ _null_ ) insert ( 988 point_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_ne _null_ _null_ _null_ _null_ ) insert ( 989 point_vert 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_vert _null_ _null_ _null_ _null_ ) insert ( 990 point_horiz 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_horiz _null_ _null_ _null_ _null_ ) insert ( 991 point_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 600' _null_ _null_ _null_ _null_ _null_ point_distance _null_ _null_ _null_ _null_ ) insert ( 992 slope 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 600' _null_ _null_ _null_ _null_ _null_ point_slope _null_ _null_ _null_ _null_ ) insert ( 993 lseg 11 10 12 1 0 0 0 f f f t f i s 2 0 601 '600 600' _null_ _null_ _null_ _null_ _null_ lseg_construct _null_ _null_ _null_ _null_ ) insert ( 994 lseg_intersect 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_intersect _null_ _null_ _null_ _null_ ) insert ( 995 lseg_parallel 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_parallel _null_ _null_ _null_ _null_ ) insert ( 996 lseg_perp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_perp _null_ _null_ _null_ _null_ ) insert ( 997 lseg_vertical 11 10 12 1 0 0 0 f f f t f i s 1 0 16 601 _null_ _null_ _null_ _null_ _null_ lseg_vertical _null_ _null_ _null_ _null_ ) insert ( 998 lseg_horizontal 11 10 12 1 0 0 0 f f f t f i s 1 0 16 601 _null_ _null_ _null_ _null_ _null_ lseg_horizontal _null_ _null_ _null_ _null_ ) insert ( 999 lseg_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_eq _null_ _null_ _null_ _null_ ) insert ( 1026 timezone 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1186 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_izone _null_ _null_ _null_ _null_ ) insert ( 1031 aclitemin 11 10 12 1 0 0 0 f f f t f s s 1 0 1033 2275 _null_ _null_ _null_ _null_ _null_ aclitemin _null_ _null_ _null_ _null_ ) insert ( 1032 aclitemout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 1033 _null_ _null_ _null_ _null_ _null_ aclitemout _null_ _null_ _null_ _null_ ) insert ( 1035 aclinsert 11 10 12 1 0 0 0 f f f t f i s 2 0 1034 '1034 1033' _null_ _null_ _null_ _null_ _null_ aclinsert _null_ _null_ _null_ _null_ ) insert ( 1036 aclremove 11 10 12 1 0 0 0 f f f t f i s 2 0 1034 '1034 1033' _null_ _null_ _null_ _null_ _null_ aclremove _null_ _null_ _null_ _null_ ) insert ( 1037 aclcontains 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1034 1033' _null_ _null_ _null_ _null_ _null_ aclcontains _null_ _null_ _null_ _null_ ) insert ( 1062 aclitemeq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1033 1033' _null_ _null_ _null_ _null_ _null_ aclitem_eq _null_ _null_ _null_ _null_ ) insert ( 1365 makeaclitem 11 10 12 1 0 0 0 f f f t f i s 4 0 1033 '26 26 25 16' _null_ _null_ _null_ _null_ _null_ makeaclitem _null_ _null_ _null_ _null_ ) insert ( 3943 acldefault 11 10 12 1 0 0 0 f f f t f i s 2 0 1034 '18 26' _null_ _null_ _null_ _null_ _null_ acldefault_sql _null_ _null_ _null_ _null_ ) insert ( 1689 aclexplode 11 10 12 1 10 0 0 f f f t t s s 1 0 2249 1034 '{1034,26,26,25,16}' '{i,o,o,o,o}' '{acl,grantor,grantee,privilege_type,is_grantable}' _null_ _null_ aclexplode _null_ _null_ _null_ _null_ ) insert ( 1044 bpcharin 11 10 12 1 0 0 0 f f f t f i s 3 0 1042 '2275 26 23' _null_ _null_ _null_ _null_ _null_ bpcharin _null_ _null_ _null_ _null_ ) insert ( 1045 bpcharout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1042 _null_ _null_ _null_ _null_ _null_ bpcharout _null_ _null_ _null_ _null_ ) insert ( 2913 bpchartypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ bpchartypmodin _null_ _null_ _null_ _null_ ) insert ( 2914 bpchartypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ bpchartypmodout _null_ _null_ _null_ _null_ ) insert ( 1046 varcharin 11 10 12 1 0 0 0 f f f t f i s 3 0 1043 '2275 26 23' _null_ _null_ _null_ _null_ _null_ varcharin _null_ _null_ _null_ _null_ ) insert ( 1047 varcharout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1043 _null_ _null_ _null_ _null_ _null_ varcharout _null_ _null_ _null_ _null_ ) insert ( 2915 varchartypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ varchartypmodin _null_ _null_ _null_ _null_ ) insert ( 2916 varchartypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ varchartypmodout _null_ _null_ _null_ _null_ ) insert ( 1048 bpchareq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchareq _null_ _null_ _null_ _null_ ) insert ( 1049 bpcharlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpcharlt _null_ _null_ _null_ _null_ ) insert ( 1050 bpcharle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpcharle _null_ _null_ _null_ _null_ ) insert ( 1051 bpchargt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchargt _null_ _null_ _null_ _null_ ) insert ( 1052 bpcharge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpcharge _null_ _null_ _null_ _null_ ) insert ( 1053 bpcharne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpcharne _null_ _null_ _null_ _null_ ) insert ( 1063 bpchar_larger 11 10 12 1 0 0 0 f f t t f i s 2 0 1042 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_larger _null_ _null_ _null_ _null_ ) insert ( 1064 bpchar_smaller 11 10 12 1 0 0 0 f f t t f i s 2 0 1042 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_smaller _null_ _null_ _null_ _null_ ) insert ( 1078 bpcharcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpcharcmp _null_ _null_ _null_ _null_ ) insert ( 3328 bpchar_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ bpchar_sortsupport _null_ _null_ _null_ _null_ ) insert ( 1080 hashbpchar 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1042 _null_ _null_ _null_ _null_ _null_ hashbpchar _null_ _null_ _null_ _null_ ) insert ( 972 hashbpcharextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1042 20' _null_ _null_ _null_ _null_ _null_ hashbpcharextended _null_ _null_ _null_ _null_ ) insert ( 1081 format_type 11 10 12 1 0 0 0 f f f f f s s 2 0 25 '26 23' _null_ _null_ _null_ _null_ _null_ format_type _null_ _null_ _null_ _null_ ) insert ( 1084 date_in 11 10 12 1 0 0 0 f f f t f s s 1 0 1082 2275 _null_ _null_ _null_ _null_ _null_ date_in _null_ _null_ _null_ _null_ ) insert ( 1085 date_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 1082 _null_ _null_ _null_ _null_ _null_ date_out _null_ _null_ _null_ _null_ ) insert ( 1086 date_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_eq _null_ _null_ _null_ _null_ ) insert ( 1087 date_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_lt _null_ _null_ _null_ _null_ ) insert ( 1088 date_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_le _null_ _null_ _null_ _null_ ) insert ( 1089 date_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_gt _null_ _null_ _null_ _null_ ) insert ( 1090 date_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_ge _null_ _null_ _null_ _null_ ) insert ( 1091 date_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_ne _null_ _null_ _null_ _null_ ) insert ( 1092 date_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_cmp _null_ _null_ _null_ _null_ ) insert ( 3136 date_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ date_sortsupport _null_ _null_ _null_ _null_ ) insert ( 4133 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1082 1082 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_date_interval _null_ _null_ _null_ _null_ ) insert ( 1102 time_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_lt _null_ _null_ _null_ _null_ ) insert ( 1103 time_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_le _null_ _null_ _null_ _null_ ) insert ( 1104 time_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_gt _null_ _null_ _null_ _null_ ) insert ( 1105 time_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_ge _null_ _null_ _null_ _null_ ) insert ( 1106 time_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_ne _null_ _null_ _null_ _null_ ) insert ( 1107 time_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_cmp _null_ _null_ _null_ _null_ ) insert ( 1138 date_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1082 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_larger _null_ _null_ _null_ _null_ ) insert ( 1139 date_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1082 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_smaller _null_ _null_ _null_ _null_ ) insert ( 1140 date_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1082 1082' _null_ _null_ _null_ _null_ _null_ date_mi _null_ _null_ _null_ _null_ ) insert ( 1141 date_pli 11 10 12 1 0 0 0 f f f t f i s 2 0 1082 '1082 23' _null_ _null_ _null_ _null_ _null_ date_pli _null_ _null_ _null_ _null_ ) insert ( 1142 date_mii 11 10 12 1 0 0 0 f f f t f i s 2 0 1082 '1082 23' _null_ _null_ _null_ _null_ _null_ date_mii _null_ _null_ _null_ _null_ ) insert ( 1143 time_in 11 10 12 1 0 0 0 f f f t f s s 3 0 1083 '2275 26 23' _null_ _null_ _null_ _null_ _null_ time_in _null_ _null_ _null_ _null_ ) insert ( 1144 time_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1083 _null_ _null_ _null_ _null_ _null_ time_out _null_ _null_ _null_ _null_ ) insert ( 2909 timetypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ timetypmodin _null_ _null_ _null_ _null_ ) insert ( 2910 timetypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ timetypmodout _null_ _null_ _null_ _null_ ) insert ( 1145 time_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_eq _null_ _null_ _null_ _null_ ) insert ( 1146 circle_add_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 718 '718 600' _null_ _null_ _null_ _null_ _null_ circle_add_pt _null_ _null_ _null_ _null_ ) insert ( 1147 circle_sub_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 718 '718 600' _null_ _null_ _null_ _null_ _null_ circle_sub_pt _null_ _null_ _null_ _null_ ) insert ( 1148 circle_mul_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 718 '718 600' _null_ _null_ _null_ _null_ _null_ circle_mul_pt _null_ _null_ _null_ _null_ ) insert ( 1149 circle_div_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 718 '718 600' _null_ _null_ _null_ _null_ _null_ circle_div_pt _null_ _null_ _null_ _null_ ) insert ( 1150 timestamptz_in 11 10 12 1 0 0 0 f f f t f s s 3 0 1184 '2275 26 23' _null_ _null_ _null_ _null_ _null_ timestamptz_in _null_ _null_ _null_ _null_ ) insert ( 1151 timestamptz_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_out _null_ _null_ _null_ _null_ ) insert ( 2907 timestamptztypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ timestamptztypmodin _null_ _null_ _null_ _null_ ) insert ( 2908 timestamptztypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ timestamptztypmodout _null_ _null_ _null_ _null_ ) insert ( 1152 timestamptz_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_eq _null_ _null_ _null_ _null_ ) insert ( 1153 timestamptz_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_ne _null_ _null_ _null_ _null_ ) insert ( 1154 timestamptz_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_lt _null_ _null_ _null_ _null_ ) insert ( 1155 timestamptz_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_le _null_ _null_ _null_ _null_ ) insert ( 1156 timestamptz_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_ge _null_ _null_ _null_ _null_ ) insert ( 1157 timestamptz_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_gt _null_ _null_ _null_ _null_ ) insert ( 1158 to_timestamp 11 10 12 1 0 0 0 f f f t f i s 1 0 1184 701 _null_ _null_ _null_ _null_ _null_ float8_timestamptz _null_ _null_ _null_ _null_ ) insert ( 1159 timezone 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '25 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_zone _null_ _null_ _null_ _null_ ) insert ( 6334 timezone 11 10 12 1 0 0 0 f f f t f s s 1 0 1114 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_at_local _null_ _null_ _null_ _null_ ) insert ( 1160 interval_in 11 10 12 1 0 0 0 f f f t f s s 3 0 1186 '2275 26 23' _null_ _null_ _null_ _null_ _null_ interval_in _null_ _null_ _null_ _null_ ) insert ( 1161 interval_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 1186 _null_ _null_ _null_ _null_ _null_ interval_out _null_ _null_ _null_ _null_ ) insert ( 2903 intervaltypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ intervaltypmodin _null_ _null_ _null_ _null_ ) insert ( 2904 intervaltypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ intervaltypmodout _null_ _null_ _null_ _null_ ) insert ( 1162 interval_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_eq _null_ _null_ _null_ _null_ ) insert ( 1163 interval_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_ne _null_ _null_ _null_ _null_ ) insert ( 1164 interval_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_lt _null_ _null_ _null_ _null_ ) insert ( 1165 interval_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_le _null_ _null_ _null_ _null_ ) insert ( 1166 interval_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_ge _null_ _null_ _null_ _null_ ) insert ( 1167 interval_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_gt _null_ _null_ _null_ _null_ ) insert ( 1168 interval_um 11 10 12 1 0 0 0 f f f t f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ interval_um _null_ _null_ _null_ _null_ ) insert ( 1169 interval_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_pl _null_ _null_ _null_ _null_ ) insert ( 1170 interval_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_mi _null_ _null_ _null_ _null_ ) insert ( 1171 date_part 11 10 12 1 0 0 0 f f f t f s s 2 0 701 '25 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_part _null_ _null_ _null_ _null_ ) insert ( 6203 extract 11 10 12 1 0 0 0 f f f t f s s 2 0 1700 '25 1184' _null_ _null_ _null_ _null_ _null_ extract_timestamptz _null_ _null_ _null_ _null_ ) insert ( 1172 date_part 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '25 1186' _null_ _null_ _null_ _null_ _null_ interval_part _null_ _null_ _null_ _null_ ) insert ( 6204 extract 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '25 1186' _null_ _null_ _null_ _null_ _null_ extract_interval _null_ _null_ _null_ _null_ ) insert ( 1174 timestamptz 11 10 12 1 0 0 0 f f f t f s s 1 0 1184 1082 _null_ _null_ _null_ _null_ _null_ date_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2711 justify_interval 11 10 12 1 0 0 0 f f f t f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ interval_justify_interval _null_ _null_ _null_ _null_ ) insert ( 1175 justify_hours 11 10 12 1 0 0 0 f f f t f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ interval_justify_hours _null_ _null_ _null_ _null_ ) insert ( 1295 justify_days 11 10 12 1 0 0 0 f f f t f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ interval_justify_days _null_ _null_ _null_ _null_ ) insert ( 1176 timestamptz 11 10 14 1 0 0 0 f f f t f s s 2 0 1184 '1082 1083' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1178 date 11 10 12 1 0 0 0 f f f t f s s 1 0 1082 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_date _null_ _null_ _null_ _null_ ) insert ( 1181 age 11 10 12 1 0 0 0 f f f t f s r 1 0 23 28 _null_ _null_ _null_ _null_ _null_ xid_age _null_ _null_ _null_ _null_ ) insert ( 3939 mxid_age 11 10 12 1 0 0 0 f f f t f s s 1 0 23 28 _null_ _null_ _null_ _null_ _null_ mxid_age _null_ _null_ _null_ _null_ ) insert ( 1188 timestamptz_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_mi _null_ _null_ _null_ _null_ ) insert ( 1189 timestamptz_pl_interval 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '1184 1186' _null_ _null_ _null_ _null_ _null_ timestamptz_pl_interval _null_ _null_ _null_ _null_ ) insert ( 6221 date_add 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '1184 1186' _null_ _null_ _null_ _null_ _null_ timestamptz_pl_interval _null_ _null_ _null_ _null_ ) insert ( 6222 date_add 11 10 12 1 0 0 0 f f f t f i s 3 0 1184 '1184 1186 25' _null_ _null_ _null_ _null_ _null_ timestamptz_pl_interval_at_zone _null_ _null_ _null_ _null_ ) insert ( 1190 timestamptz_mi_interval 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '1184 1186' _null_ _null_ _null_ _null_ _null_ timestamptz_mi_interval _null_ _null_ _null_ _null_ ) insert ( 6223 date_subtract 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '1184 1186' _null_ _null_ _null_ _null_ _null_ timestamptz_mi_interval _null_ _null_ _null_ _null_ ) insert ( 6273 date_subtract 11 10 12 1 0 0 0 f f f t f i s 3 0 1184 '1184 1186 25' _null_ _null_ _null_ _null_ _null_ timestamptz_mi_interval_at_zone _null_ _null_ _null_ _null_ ) insert ( 1195 timestamptz_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_smaller _null_ _null_ _null_ _null_ ) insert ( 1196 timestamptz_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_larger _null_ _null_ _null_ _null_ ) insert ( 1197 interval_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_smaller _null_ _null_ _null_ _null_ ) insert ( 1198 interval_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_larger _null_ _null_ _null_ _null_ ) insert ( 1199 age 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_age _null_ _null_ _null_ _null_ ) insert ( 3918 interval_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ interval_support _null_ _null_ _null_ _null_ ) insert ( 1200 interval 11 10 12 1 0 0 3918 f f f t f i s 2 0 1186 '1186 23' _null_ _null_ _null_ _null_ _null_ interval_scale _null_ _null_ _null_ _null_ ) insert ( 1215 obj_description 11 10 14 100 0 0 0 f f f t f s s 2 0 25 '26 19' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1216 col_description 11 10 14 100 0 0 0 f f f t f s s 2 0 25 '26 23' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1993 shobj_description 11 10 14 100 0 0 0 f f f t f s s 2 0 25 '26 19' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1217 date_trunc 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '25 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_trunc _null_ _null_ _null_ _null_ ) insert ( 1284 date_trunc 11 10 12 1 0 0 0 f f f t f i s 3 0 1184 '25 1184 25' _null_ _null_ _null_ _null_ _null_ timestamptz_trunc_zone _null_ _null_ _null_ _null_ ) insert ( 1218 date_trunc 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '25 1186' _null_ _null_ _null_ _null_ _null_ interval_trunc _null_ _null_ _null_ _null_ ) insert ( 1219 int8inc 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8inc _null_ _null_ _null_ _null_ ) insert ( 3546 int8dec 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8dec _null_ _null_ _null_ _null_ ) insert ( 2804 int8inc_any 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 2276' _null_ _null_ _null_ _null_ _null_ int8inc_any _null_ _null_ _null_ _null_ ) insert ( 3547 int8dec_any 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 2276' _null_ _null_ _null_ _null_ _null_ int8dec_any _null_ _null_ _null_ _null_ ) insert ( 1230 int8abs 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8abs _null_ _null_ _null_ _null_ ) insert ( 1236 int8larger 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8larger _null_ _null_ _null_ _null_ ) insert ( 1237 int8smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8smaller _null_ _null_ _null_ _null_ ) insert ( 1238 texticregexeq 11 10 12 1 0 0 1024 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ texticregexeq _null_ _null_ _null_ _null_ ) insert ( 1024 texticregexeq_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ texticregexeq_support _null_ _null_ _null_ _null_ ) insert ( 1239 texticregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ texticregexne _null_ _null_ _null_ _null_ ) insert ( 1240 nameicregexeq 11 10 12 1 0 0 1024 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameicregexeq _null_ _null_ _null_ _null_ ) insert ( 1241 nameicregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameicregexne _null_ _null_ _null_ _null_ ) insert ( 1251 int4abs 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4abs _null_ _null_ _null_ _null_ ) insert ( 1253 int2abs 11 10 12 1 0 0 0 f f f t f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ int2abs _null_ _null_ _null_ _null_ ) insert ( 1271 overlaps 11 10 12 1 0 0 0 f f f f f i s 4 0 16 '1266 1266 1266 1266' _null_ _null_ _null_ _null_ _null_ overlaps_timetz _null_ _null_ _null_ _null_ ) insert ( 1272 datetime_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1082 1083' _null_ _null_ _null_ _null_ _null_ datetime_timestamp _null_ _null_ _null_ _null_ ) insert ( 1273 date_part 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '25 1266' _null_ _null_ _null_ _null_ _null_ timetz_part _null_ _null_ _null_ _null_ ) insert ( 6201 extract 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '25 1266' _null_ _null_ _null_ _null_ _null_ extract_timetz _null_ _null_ _null_ _null_ ) insert ( 1274 int84pl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int84pl _null_ _null_ _null_ _null_ ) insert ( 1275 int84mi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int84mi _null_ _null_ _null_ _null_ ) insert ( 1276 int84mul 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int84mul _null_ _null_ _null_ _null_ ) insert ( 1277 int84div 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int84div _null_ _null_ _null_ _null_ ) insert ( 1278 int48pl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '23 20' _null_ _null_ _null_ _null_ _null_ int48pl _null_ _null_ _null_ _null_ ) insert ( 1279 int48mi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '23 20' _null_ _null_ _null_ _null_ _null_ int48mi _null_ _null_ _null_ _null_ ) insert ( 1280 int48mul 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '23 20' _null_ _null_ _null_ _null_ _null_ int48mul _null_ _null_ _null_ _null_ ) insert ( 1281 int48div 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '23 20' _null_ _null_ _null_ _null_ _null_ int48div _null_ _null_ _null_ _null_ ) insert ( 837 int82pl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 21' _null_ _null_ _null_ _null_ _null_ int82pl _null_ _null_ _null_ _null_ ) insert ( 838 int82mi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 21' _null_ _null_ _null_ _null_ _null_ int82mi _null_ _null_ _null_ _null_ ) insert ( 839 int82mul 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 21' _null_ _null_ _null_ _null_ _null_ int82mul _null_ _null_ _null_ _null_ ) insert ( 840 int82div 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 21' _null_ _null_ _null_ _null_ _null_ int82div _null_ _null_ _null_ _null_ ) insert ( 841 int28pl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '21 20' _null_ _null_ _null_ _null_ _null_ int28pl _null_ _null_ _null_ _null_ ) insert ( 942 int28mi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '21 20' _null_ _null_ _null_ _null_ _null_ int28mi _null_ _null_ _null_ _null_ ) insert ( 943 int28mul 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '21 20' _null_ _null_ _null_ _null_ _null_ int28mul _null_ _null_ _null_ _null_ ) insert ( 948 int28div 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '21 20' _null_ _null_ _null_ _null_ _null_ int28div _null_ _null_ _null_ _null_ ) insert ( 1287 oid 11 10 12 1 0 0 0 f f f t f i s 1 0 26 20 _null_ _null_ _null_ _null_ _null_ i8tooid _null_ _null_ _null_ _null_ ) insert ( 1288 int8 11 10 12 1 0 0 0 f f t t f i s 1 0 20 26 _null_ _null_ _null_ _null_ _null_ oidtoi8 _null_ _null_ _null_ _null_ ) insert ( 1291 suppress_redundant_updates_trigger 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ suppress_redundant_updates_trigger _null_ _null_ _null_ _null_ ) insert ( 1292 tideq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tideq _null_ _null_ _null_ _null_ ) insert ( 1294 currtid2 11 10 12 1 0 0 0 f f f t f v u 2 0 27 '25 27' _null_ _null_ _null_ _null_ _null_ currtid_byrelname _null_ _null_ _null_ _null_ ) insert ( 1265 tidne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tidne _null_ _null_ _null_ _null_ ) insert ( 2790 tidgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tidgt _null_ _null_ _null_ _null_ ) insert ( 2791 tidlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tidlt _null_ _null_ _null_ _null_ ) insert ( 2792 tidge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tidge _null_ _null_ _null_ _null_ ) insert ( 2793 tidle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '27 27' _null_ _null_ _null_ _null_ _null_ tidle _null_ _null_ _null_ _null_ ) insert ( 2794 bttidcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '27 27' _null_ _null_ _null_ _null_ _null_ bttidcmp _null_ _null_ _null_ _null_ ) insert ( 2795 tidlarger 11 10 12 1 0 0 0 f f f t f i s 2 0 27 '27 27' _null_ _null_ _null_ _null_ _null_ tidlarger _null_ _null_ _null_ _null_ ) insert ( 2796 tidsmaller 11 10 12 1 0 0 0 f f f t f i s 2 0 27 '27 27' _null_ _null_ _null_ _null_ _null_ tidsmaller _null_ _null_ _null_ _null_ ) insert ( 2233 hashtid 11 10 12 1 0 0 0 f f f t f i s 1 0 23 27 _null_ _null_ _null_ _null_ _null_ hashtid _null_ _null_ _null_ _null_ ) insert ( 2234 hashtidextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '27 20' _null_ _null_ _null_ _null_ _null_ hashtidextended _null_ _null_ _null_ _null_ ) insert ( 1296 timedate_pl 11 10 14 1 0 0 0 f f f t f i s 2 0 1114 '1083 1082' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1297 datetimetz_pl 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '1082 1266' _null_ _null_ _null_ _null_ _null_ datetimetz_timestamptz _null_ _null_ _null_ _null_ ) insert ( 1298 timetzdate_pl 11 10 14 1 0 0 0 f f f t f i s 2 0 1184 '1266 1082' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1299 now 11 10 12 1 0 0 0 f f f t f s s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ now _null_ _null_ _null_ _null_ ) insert ( 2647 transaction_timestamp 11 10 12 1 0 0 0 f f f t f s s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ now _null_ _null_ _null_ _null_ ) insert ( 2648 statement_timestamp 11 10 12 1 0 0 0 f f f t f s s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ statement_timestamp _null_ _null_ _null_ _null_ ) insert ( 2649 clock_timestamp 11 10 12 1 0 0 0 f f f t f v s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ clock_timestamp _null_ _null_ _null_ _null_ ) insert ( 1300 positionsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ positionsel _null_ _null_ _null_ _null_ ) insert ( 1301 positionjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ positionjoinsel _null_ _null_ _null_ _null_ ) insert ( 1302 contsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ contsel _null_ _null_ _null_ _null_ ) insert ( 1303 contjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ contjoinsel _null_ _null_ _null_ _null_ ) insert ( 1304 overlaps 11 10 12 1 0 0 0 f f f f f i s 4 0 16 '1184 1184 1184 1184' _null_ _null_ _null_ _null_ _null_ overlaps_timestamp _null_ _null_ _null_ _null_ ) insert ( 1305 overlaps 11 10 14 1 0 0 0 f f f f f s s 4 0 16 '1184 1186 1184 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1306 overlaps 11 10 14 1 0 0 0 f f f f f s s 4 0 16 '1184 1184 1184 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1307 overlaps 11 10 14 1 0 0 0 f f f f f s s 4 0 16 '1184 1186 1184 1184' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1308 overlaps 11 10 12 1 0 0 0 f f f f f i s 4 0 16 '1083 1083 1083 1083' _null_ _null_ _null_ _null_ _null_ overlaps_time _null_ _null_ _null_ _null_ ) insert ( 1309 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1083 1186 1083 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1310 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1083 1083 1083 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1311 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1083 1186 1083 1083' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1312 timestamp_in 11 10 12 1 0 0 0 f f f t f s s 3 0 1114 '2275 26 23' _null_ _null_ _null_ _null_ _null_ timestamp_in _null_ _null_ _null_ _null_ ) insert ( 1313 timestamp_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 1114 _null_ _null_ _null_ _null_ _null_ timestamp_out _null_ _null_ _null_ _null_ ) insert ( 2905 timestamptypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ timestamptypmodin _null_ _null_ _null_ _null_ ) insert ( 2906 timestamptypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ timestamptypmodout _null_ _null_ _null_ _null_ ) insert ( 1314 timestamptz_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1184 1184' _null_ _null_ _null_ _null_ _null_ timestamp_cmp _null_ _null_ _null_ _null_ ) insert ( 1315 interval_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1186 1186' _null_ _null_ _null_ _null_ _null_ interval_cmp _null_ _null_ _null_ _null_ ) insert ( 1316 time 11 10 12 1 0 0 0 f f f t f i s 1 0 1083 1114 _null_ _null_ _null_ _null_ _null_ timestamp_time _null_ _null_ _null_ _null_ ) insert ( 1317 length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ textlen _null_ _null_ _null_ _null_ ) insert ( 1318 length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1042 _null_ _null_ _null_ _null_ _null_ bpcharlen _null_ _null_ _null_ _null_ ) insert ( 1319 xideqint4 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '28 23' _null_ _null_ _null_ _null_ _null_ xideq _null_ _null_ _null_ _null_ ) insert ( 3309 xidneqint4 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '28 23' _null_ _null_ _null_ _null_ _null_ xidneq _null_ _null_ _null_ _null_ ) insert ( 1326 interval_div 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 701' _null_ _null_ _null_ _null_ _null_ interval_div _null_ _null_ _null_ _null_ ) insert ( 1339 dlog10 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dlog10 _null_ _null_ _null_ _null_ ) insert ( 1340 log 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dlog10 _null_ _null_ _null_ _null_ ) insert ( 1194 log10 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dlog10 _null_ _null_ _null_ _null_ ) insert ( 1341 ln 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dlog1 _null_ _null_ _null_ _null_ ) insert ( 1342 round 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dround _null_ _null_ _null_ _null_ ) insert ( 1343 trunc 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dtrunc _null_ _null_ _null_ _null_ ) insert ( 1344 sqrt 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsqrt _null_ _null_ _null_ _null_ ) insert ( 1345 cbrt 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcbrt _null_ _null_ _null_ _null_ ) insert ( 1346 pow 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ dpow _null_ _null_ _null_ _null_ ) insert ( 1368 power 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ dpow _null_ _null_ _null_ _null_ ) insert ( 1347 exp 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dexp _null_ _null_ _null_ _null_ ) insert ( 1348 obj_description 11 10 14 100 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1349 oidvectortypes 11 10 12 1 0 0 0 f f f t f s s 1 0 25 30 _null_ _null_ _null_ _null_ _null_ oidvectortypes _null_ _null_ _null_ _null_ ) insert ( 1350 timetz_in 11 10 12 1 0 0 0 f f f t f s s 3 0 1266 '2275 26 23' _null_ _null_ _null_ _null_ _null_ timetz_in _null_ _null_ _null_ _null_ ) insert ( 1351 timetz_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1266 _null_ _null_ _null_ _null_ _null_ timetz_out _null_ _null_ _null_ _null_ ) insert ( 2911 timetztypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ timetztypmodin _null_ _null_ _null_ _null_ ) insert ( 2912 timetztypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ timetztypmodout _null_ _null_ _null_ _null_ ) insert ( 1352 timetz_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_eq _null_ _null_ _null_ _null_ ) insert ( 1353 timetz_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_ne _null_ _null_ _null_ _null_ ) insert ( 1354 timetz_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_lt _null_ _null_ _null_ _null_ ) insert ( 1355 timetz_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_le _null_ _null_ _null_ _null_ ) insert ( 1356 timetz_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_ge _null_ _null_ _null_ _null_ ) insert ( 1357 timetz_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_gt _null_ _null_ _null_ _null_ ) insert ( 1358 timetz_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_cmp _null_ _null_ _null_ _null_ ) insert ( 1359 timestamptz 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '1082 1266' _null_ _null_ _null_ _null_ _null_ datetimetz_timestamptz _null_ _null_ _null_ _null_ ) insert ( 1367 character_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1042 _null_ _null_ _null_ _null_ _null_ bpcharlen _null_ _null_ _null_ _null_ ) insert ( 1369 character_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ textlen _null_ _null_ _null_ _null_ ) insert ( 1370 interval 11 10 12 1 0 0 0 f f t t f i s 1 0 1186 1083 _null_ _null_ _null_ _null_ _null_ time_interval _null_ _null_ _null_ _null_ ) insert ( 1372 char_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1042 _null_ _null_ _null_ _null_ _null_ bpcharlen _null_ _null_ _null_ _null_ ) insert ( 1374 octet_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ textoctetlen _null_ _null_ _null_ _null_ ) insert ( 1375 octet_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1042 _null_ _null_ _null_ _null_ _null_ bpcharoctetlen _null_ _null_ _null_ _null_ ) insert ( 1377 time_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1083 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_larger _null_ _null_ _null_ _null_ ) insert ( 1378 time_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1083 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_smaller _null_ _null_ _null_ _null_ ) insert ( 1379 timetz_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1266 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_larger _null_ _null_ _null_ _null_ ) insert ( 1380 timetz_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1266 '1266 1266' _null_ _null_ _null_ _null_ _null_ timetz_smaller _null_ _null_ _null_ _null_ ) insert ( 1381 char_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ textlen _null_ _null_ _null_ _null_ ) insert ( 1384 date_part 11 10 14 1 0 0 0 f f f t f i s 2 0 701 '25 1082' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 6199 extract 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '25 1082' _null_ _null_ _null_ _null_ _null_ extract_date _null_ _null_ _null_ _null_ ) insert ( 1385 date_part 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '25 1083' _null_ _null_ _null_ _null_ _null_ time_part _null_ _null_ _null_ _null_ ) insert ( 6200 extract 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '25 1083' _null_ _null_ _null_ _null_ _null_ extract_time _null_ _null_ _null_ _null_ ) insert ( 1386 age 11 10 14 1 0 0 0 f f f t f s s 1 0 1186 1184 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1388 timetz 11 10 12 1 0 0 0 f f f t f s s 1 0 1266 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_timetz _null_ _null_ _null_ _null_ ) insert ( 1373 isfinite 11 10 12 1 0 0 0 f f f t f i s 1 0 16 1082 _null_ _null_ _null_ _null_ _null_ date_finite _null_ _null_ _null_ _null_ ) insert ( 1389 isfinite 11 10 12 1 0 0 0 f f f t f i s 1 0 16 1184 _null_ _null_ _null_ _null_ _null_ timestamp_finite _null_ _null_ _null_ _null_ ) insert ( 1390 isfinite 11 10 12 1 0 0 0 f f f t f i s 1 0 16 1186 _null_ _null_ _null_ _null_ _null_ interval_finite _null_ _null_ _null_ _null_ ) insert ( 1376 factorial 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ numeric_fac _null_ _null_ _null_ _null_ ) insert ( 1394 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ float4abs _null_ _null_ _null_ _null_ ) insert ( 1395 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ float8abs _null_ _null_ _null_ _null_ ) insert ( 1396 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8abs _null_ _null_ _null_ _null_ ) insert ( 1397 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4abs _null_ _null_ _null_ _null_ ) insert ( 1398 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ int2abs _null_ _null_ _null_ _null_ ) insert ( 1400 name 11 10 12 1 0 0 0 f f t t f i s 1 0 19 1043 _null_ _null_ _null_ _null_ _null_ text_name _null_ _null_ _null_ _null_ ) insert ( 1401 varchar 11 10 12 1 0 0 0 f f t t f i s 1 0 1043 19 _null_ _null_ _null_ _null_ _null_ name_text _null_ _null_ _null_ _null_ ) insert ( 1402 current_schema 11 10 12 1 0 0 0 f f f t f s u 0 0 19 '' _null_ _null_ _null_ _null_ _null_ current_schema _null_ _null_ _null_ _null_ ) insert ( 1403 current_schemas 11 10 12 1 0 0 0 f f f t f s u 1 0 1003 16 _null_ _null_ _null_ _null_ _null_ current_schemas _null_ _null_ _null_ _null_ ) insert ( 1404 overlay 11 10 12 1 0 0 0 f f f t f i s 4 0 25 '25 25 23 23' _null_ _null_ _null_ _null_ _null_ textoverlay _null_ _null_ _null_ _null_ ) insert ( 1405 overlay 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 23' _null_ _null_ _null_ _null_ _null_ textoverlay_no_len _null_ _null_ _null_ _null_ ) insert ( 1406 isvertical 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_vert _null_ _null_ _null_ _null_ ) insert ( 1407 ishorizontal 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 600' _null_ _null_ _null_ _null_ _null_ point_horiz _null_ _null_ _null_ _null_ ) insert ( 1408 isparallel 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_parallel _null_ _null_ _null_ _null_ ) insert ( 1409 isperp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_perp _null_ _null_ _null_ _null_ ) insert ( 1410 isvertical 11 10 12 1 0 0 0 f f f t f i s 1 0 16 601 _null_ _null_ _null_ _null_ _null_ lseg_vertical _null_ _null_ _null_ _null_ ) insert ( 1411 ishorizontal 11 10 12 1 0 0 0 f f f t f i s 1 0 16 601 _null_ _null_ _null_ _null_ _null_ lseg_horizontal _null_ _null_ _null_ _null_ ) insert ( 1412 isparallel 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_parallel _null_ _null_ _null_ _null_ ) insert ( 1413 isperp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_perp _null_ _null_ _null_ _null_ ) insert ( 1414 isvertical 11 10 12 1 0 0 0 f f f t f i s 1 0 16 628 _null_ _null_ _null_ _null_ _null_ line_vertical _null_ _null_ _null_ _null_ ) insert ( 1415 ishorizontal 11 10 12 1 0 0 0 f f f t f i s 1 0 16 628 _null_ _null_ _null_ _null_ _null_ line_horizontal _null_ _null_ _null_ _null_ ) insert ( 1416 point 11 10 12 1 0 0 0 f f f t f i s 1 0 600 718 _null_ _null_ _null_ _null_ _null_ circle_center _null_ _null_ _null_ _null_ ) insert ( 1419 time 11 10 12 1 0 0 0 f f f t f i s 1 0 1083 1186 _null_ _null_ _null_ _null_ _null_ interval_time _null_ _null_ _null_ _null_ ) insert ( 1421 box 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '600 600' _null_ _null_ _null_ _null_ _null_ points_box _null_ _null_ _null_ _null_ ) insert ( 1422 box_add 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 600' _null_ _null_ _null_ _null_ _null_ box_add _null_ _null_ _null_ _null_ ) insert ( 1423 box_sub 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 600' _null_ _null_ _null_ _null_ _null_ box_sub _null_ _null_ _null_ _null_ ) insert ( 1424 box_mul 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 600' _null_ _null_ _null_ _null_ _null_ box_mul _null_ _null_ _null_ _null_ ) insert ( 1425 box_div 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '603 600' _null_ _null_ _null_ _null_ _null_ box_div _null_ _null_ _null_ _null_ ) insert ( 1426 path_contain_pt 11 10 14 1 0 0 0 f f f t f i s 2 0 16 '602 600' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1428 poly_contain_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 600' _null_ _null_ _null_ _null_ _null_ poly_contain_pt _null_ _null_ _null_ _null_ ) insert ( 1429 pt_contained_poly 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 604' _null_ _null_ _null_ _null_ _null_ pt_contained_poly _null_ _null_ _null_ _null_ ) insert ( 1430 isclosed 11 10 12 1 0 0 0 f f f t f i s 1 0 16 602 _null_ _null_ _null_ _null_ _null_ path_isclosed _null_ _null_ _null_ _null_ ) insert ( 1431 isopen 11 10 12 1 0 0 0 f f f t f i s 1 0 16 602 _null_ _null_ _null_ _null_ _null_ path_isopen _null_ _null_ _null_ _null_ ) insert ( 1432 path_npoints 11 10 12 1 0 0 0 f f f t f i s 1 0 23 602 _null_ _null_ _null_ _null_ _null_ path_npoints _null_ _null_ _null_ _null_ ) insert ( 1433 pclose 11 10 12 1 0 0 0 f f f t f i s 1 0 602 602 _null_ _null_ _null_ _null_ _null_ path_close _null_ _null_ _null_ _null_ ) insert ( 1434 popen 11 10 12 1 0 0 0 f f f t f i s 1 0 602 602 _null_ _null_ _null_ _null_ _null_ path_open _null_ _null_ _null_ _null_ ) insert ( 1435 path_add 11 10 12 1 0 0 0 f f f t f i s 2 0 602 '602 602' _null_ _null_ _null_ _null_ _null_ path_add _null_ _null_ _null_ _null_ ) insert ( 1436 path_add_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 602 '602 600' _null_ _null_ _null_ _null_ _null_ path_add_pt _null_ _null_ _null_ _null_ ) insert ( 1437 path_sub_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 602 '602 600' _null_ _null_ _null_ _null_ _null_ path_sub_pt _null_ _null_ _null_ _null_ ) insert ( 1438 path_mul_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 602 '602 600' _null_ _null_ _null_ _null_ _null_ path_mul_pt _null_ _null_ _null_ _null_ ) insert ( 1439 path_div_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 602 '602 600' _null_ _null_ _null_ _null_ _null_ path_div_pt _null_ _null_ _null_ _null_ ) insert ( 1440 point 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '701 701' _null_ _null_ _null_ _null_ _null_ construct_point _null_ _null_ _null_ _null_ ) insert ( 1441 point_add 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 600' _null_ _null_ _null_ _null_ _null_ point_add _null_ _null_ _null_ _null_ ) insert ( 1442 point_sub 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 600' _null_ _null_ _null_ _null_ _null_ point_sub _null_ _null_ _null_ _null_ ) insert ( 1443 point_mul 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 600' _null_ _null_ _null_ _null_ _null_ point_mul _null_ _null_ _null_ _null_ ) insert ( 1444 point_div 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '600 600' _null_ _null_ _null_ _null_ _null_ point_div _null_ _null_ _null_ _null_ ) insert ( 1445 poly_npoints 11 10 12 1 0 0 0 f f f t f i s 1 0 23 604 _null_ _null_ _null_ _null_ _null_ poly_npoints _null_ _null_ _null_ _null_ ) insert ( 1446 box 11 10 12 1 0 0 0 f f f t f i s 1 0 603 604 _null_ _null_ _null_ _null_ _null_ poly_box _null_ _null_ _null_ _null_ ) insert ( 1447 path 11 10 12 1 0 0 0 f f f t f i s 1 0 602 604 _null_ _null_ _null_ _null_ _null_ poly_path _null_ _null_ _null_ _null_ ) insert ( 1448 polygon 11 10 12 1 0 0 0 f f f t f i s 1 0 604 603 _null_ _null_ _null_ _null_ _null_ box_poly _null_ _null_ _null_ _null_ ) insert ( 1449 polygon 11 10 12 1 0 0 0 f f f t f i s 1 0 604 602 _null_ _null_ _null_ _null_ _null_ path_poly _null_ _null_ _null_ _null_ ) insert ( 1450 circle_in 11 10 12 1 0 0 0 f f f t f i s 1 0 718 2275 _null_ _null_ _null_ _null_ _null_ circle_in _null_ _null_ _null_ _null_ ) insert ( 1451 circle_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 718 _null_ _null_ _null_ _null_ _null_ circle_out _null_ _null_ _null_ _null_ ) insert ( 1452 circle_same 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_same _null_ _null_ _null_ _null_ ) insert ( 1453 circle_contain 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_contain _null_ _null_ _null_ _null_ ) insert ( 1454 circle_left 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_left _null_ _null_ _null_ _null_ ) insert ( 1455 circle_overleft 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_overleft _null_ _null_ _null_ _null_ ) insert ( 1456 circle_overright 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_overright _null_ _null_ _null_ _null_ ) insert ( 1457 circle_right 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_right _null_ _null_ _null_ _null_ ) insert ( 1458 circle_contained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_contained _null_ _null_ _null_ _null_ ) insert ( 1459 circle_overlap 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_overlap _null_ _null_ _null_ _null_ ) insert ( 1460 circle_below 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_below _null_ _null_ _null_ _null_ ) insert ( 1461 circle_above 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_above _null_ _null_ _null_ _null_ ) insert ( 1462 circle_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_eq _null_ _null_ _null_ _null_ ) insert ( 1463 circle_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_ne _null_ _null_ _null_ _null_ ) insert ( 1464 circle_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_lt _null_ _null_ _null_ _null_ ) insert ( 1465 circle_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_gt _null_ _null_ _null_ _null_ ) insert ( 1466 circle_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_le _null_ _null_ _null_ _null_ ) insert ( 1467 circle_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_ge _null_ _null_ _null_ _null_ ) insert ( 1468 area 11 10 12 1 0 0 0 f f f t f i s 1 0 701 718 _null_ _null_ _null_ _null_ _null_ circle_area _null_ _null_ _null_ _null_ ) insert ( 1469 diameter 11 10 12 1 0 0 0 f f f t f i s 1 0 701 718 _null_ _null_ _null_ _null_ _null_ circle_diameter _null_ _null_ _null_ _null_ ) insert ( 1470 radius 11 10 12 1 0 0 0 f f f t f i s 1 0 701 718 _null_ _null_ _null_ _null_ _null_ circle_radius _null_ _null_ _null_ _null_ ) insert ( 1471 circle_distance 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '718 718' _null_ _null_ _null_ _null_ _null_ circle_distance _null_ _null_ _null_ _null_ ) insert ( 1472 circle_center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 718 _null_ _null_ _null_ _null_ _null_ circle_center _null_ _null_ _null_ _null_ ) insert ( 1473 circle 11 10 12 1 0 0 0 f f f t f i s 2 0 718 '600 701' _null_ _null_ _null_ _null_ _null_ cr_circle _null_ _null_ _null_ _null_ ) insert ( 1474 circle 11 10 12 1 0 0 0 f f f t f i s 1 0 718 604 _null_ _null_ _null_ _null_ _null_ poly_circle _null_ _null_ _null_ _null_ ) insert ( 1475 polygon 11 10 12 1 0 0 0 f f f t f i s 2 0 604 '23 718' _null_ _null_ _null_ _null_ _null_ circle_poly _null_ _null_ _null_ _null_ ) insert ( 1476 dist_pc 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '600 718' _null_ _null_ _null_ _null_ _null_ dist_pc _null_ _null_ _null_ _null_ ) insert ( 1477 circle_contain_pt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 600' _null_ _null_ _null_ _null_ _null_ circle_contain_pt _null_ _null_ _null_ _null_ ) insert ( 1478 pt_contained_circle 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '600 718' _null_ _null_ _null_ _null_ _null_ pt_contained_circle _null_ _null_ _null_ _null_ ) insert ( 4091 box 11 10 12 1 0 0 0 f f f t f i s 1 0 603 600 _null_ _null_ _null_ _null_ _null_ point_box _null_ _null_ _null_ _null_ ) insert ( 1479 circle 11 10 12 1 0 0 0 f f f t f i s 1 0 718 603 _null_ _null_ _null_ _null_ _null_ box_circle _null_ _null_ _null_ _null_ ) insert ( 1480 box 11 10 12 1 0 0 0 f f f t f i s 1 0 603 718 _null_ _null_ _null_ _null_ _null_ circle_box _null_ _null_ _null_ _null_ ) insert ( 1482 lseg_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_ne _null_ _null_ _null_ _null_ ) insert ( 1483 lseg_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_lt _null_ _null_ _null_ _null_ ) insert ( 1484 lseg_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_le _null_ _null_ _null_ _null_ ) insert ( 1485 lseg_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_gt _null_ _null_ _null_ _null_ ) insert ( 1486 lseg_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '601 601' _null_ _null_ _null_ _null_ _null_ lseg_ge _null_ _null_ _null_ _null_ ) insert ( 1487 lseg_length 11 10 12 1 0 0 0 f f f t f i s 1 0 701 601 _null_ _null_ _null_ _null_ _null_ lseg_length _null_ _null_ _null_ _null_ ) insert ( 1488 close_ls 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '628 601' _null_ _null_ _null_ _null_ _null_ close_ls _null_ _null_ _null_ _null_ ) insert ( 1489 close_lseg 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '601 601' _null_ _null_ _null_ _null_ _null_ close_lseg _null_ _null_ _null_ _null_ ) insert ( 1490 line_in 11 10 12 1 0 0 0 f f f t f i s 1 0 628 2275 _null_ _null_ _null_ _null_ _null_ line_in _null_ _null_ _null_ _null_ ) insert ( 1491 line_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 628 _null_ _null_ _null_ _null_ _null_ line_out _null_ _null_ _null_ _null_ ) insert ( 1492 line_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_eq _null_ _null_ _null_ _null_ ) insert ( 1493 line 11 10 12 1 0 0 0 f f f t f i s 2 0 628 '600 600' _null_ _null_ _null_ _null_ _null_ line_construct_pp _null_ _null_ _null_ _null_ ) insert ( 1494 line_interpt 11 10 12 1 0 0 0 f f f t f i s 2 0 600 '628 628' _null_ _null_ _null_ _null_ _null_ line_interpt _null_ _null_ _null_ _null_ ) insert ( 1495 line_intersect 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_intersect _null_ _null_ _null_ _null_ ) insert ( 1496 line_parallel 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_parallel _null_ _null_ _null_ _null_ ) insert ( 1497 line_perp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '628 628' _null_ _null_ _null_ _null_ _null_ line_perp _null_ _null_ _null_ _null_ ) insert ( 1498 line_vertical 11 10 12 1 0 0 0 f f f t f i s 1 0 16 628 _null_ _null_ _null_ _null_ _null_ line_vertical _null_ _null_ _null_ _null_ ) insert ( 1499 line_horizontal 11 10 12 1 0 0 0 f f f t f i s 1 0 16 628 _null_ _null_ _null_ _null_ _null_ line_horizontal _null_ _null_ _null_ _null_ ) insert ( 1530 length 11 10 12 1 0 0 0 f f f t f i s 1 0 701 601 _null_ _null_ _null_ _null_ _null_ lseg_length _null_ _null_ _null_ _null_ ) insert ( 1531 length 11 10 12 1 0 0 0 f f f t f i s 1 0 701 602 _null_ _null_ _null_ _null_ _null_ path_length _null_ _null_ _null_ _null_ ) insert ( 1532 point 11 10 12 1 0 0 0 f f f t f i s 1 0 600 601 _null_ _null_ _null_ _null_ _null_ lseg_center _null_ _null_ _null_ _null_ ) insert ( 1534 point 11 10 12 1 0 0 0 f f f t f i s 1 0 600 603 _null_ _null_ _null_ _null_ _null_ box_center _null_ _null_ _null_ _null_ ) insert ( 1540 point 11 10 12 1 0 0 0 f f f t f i s 1 0 600 604 _null_ _null_ _null_ _null_ _null_ poly_center _null_ _null_ _null_ _null_ ) insert ( 1541 lseg 11 10 12 1 0 0 0 f f f t f i s 1 0 601 603 _null_ _null_ _null_ _null_ _null_ box_diagonal _null_ _null_ _null_ _null_ ) insert ( 1542 center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 603 _null_ _null_ _null_ _null_ _null_ box_center _null_ _null_ _null_ _null_ ) insert ( 1543 center 11 10 12 1 0 0 0 f f f t f i s 1 0 600 718 _null_ _null_ _null_ _null_ _null_ circle_center _null_ _null_ _null_ _null_ ) insert ( 1544 polygon 11 10 14 1 0 0 0 f f f t f i s 1 0 604 718 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1545 npoints 11 10 12 1 0 0 0 f f f t f i s 1 0 23 602 _null_ _null_ _null_ _null_ _null_ path_npoints _null_ _null_ _null_ _null_ ) insert ( 1556 npoints 11 10 12 1 0 0 0 f f f t f i s 1 0 23 604 _null_ _null_ _null_ _null_ _null_ poly_npoints _null_ _null_ _null_ _null_ ) insert ( 1564 bit_in 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '2275 26 23' _null_ _null_ _null_ _null_ _null_ bit_in _null_ _null_ _null_ _null_ ) insert ( 1565 bit_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1560 _null_ _null_ _null_ _null_ _null_ bit_out _null_ _null_ _null_ _null_ ) insert ( 2919 bittypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ bittypmodin _null_ _null_ _null_ _null_ ) insert ( 2920 bittypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ bittypmodout _null_ _null_ _null_ _null_ ) insert ( 1569 like 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textlike _null_ _null_ _null_ _null_ ) insert ( 1570 notlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ textnlike _null_ _null_ _null_ _null_ ) insert ( 1571 like 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namelike _null_ _null_ _null_ _null_ ) insert ( 1572 notlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ namenlike _null_ _null_ _null_ _null_ ) insert ( 1574 nextval 11 10 12 1 0 0 0 f f f t f v u 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ nextval_oid _null_ _null_ _null_ _null_ ) insert ( 1575 currval 11 10 12 1 0 0 0 f f f t f v u 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ currval_oid _null_ _null_ _null_ _null_ ) insert ( 1576 setval 11 10 12 1 0 0 0 f f f t f v u 2 0 20 '2205 20' _null_ _null_ _null_ _null_ _null_ setval_oid _null_ _null_ _null_ _null_ ) insert ( 1765 setval 11 10 12 1 0 0 0 f f f t f v u 3 0 20 '2205 20 16' _null_ _null_ _null_ _null_ _null_ setval3_oid _null_ _null_ _null_ _null_ ) insert ( 3078 pg_sequence_parameters 11 10 12 1 0 0 0 f f f t f s s 1 0 2249 26 '{26,20,20,20,20,16,20,26}' '{i,o,o,o,o,o,o,o}' '{sequence_oid,start_value,minimum_value,maximum_value,increment,cycle_option,cache_size,data_type}' _null_ _null_ pg_sequence_parameters _null_ _null_ _null_ _null_ ) insert ( 4032 pg_sequence_last_value 11 10 12 1 0 0 0 f f f t f v u 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ pg_sequence_last_value _null_ _null_ _null_ _null_ ) insert ( 275 pg_nextoid 11 10 12 1 0 0 0 f f f t f v u 3 0 26 '2205 19 2205' _null_ _null_ _null_ _null_ _null_ pg_nextoid _null_ _null_ _null_ _null_ ) insert ( 6241 pg_stop_making_pinned_objects 11 10 12 1 0 0 0 f f f t f v u 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_stop_making_pinned_objects _null_ _null_ _null_ _null_ ) insert ( 1579 varbit_in 11 10 12 1 0 0 0 f f f t f i s 3 0 1562 '2275 26 23' _null_ _null_ _null_ _null_ _null_ varbit_in _null_ _null_ _null_ _null_ ) insert ( 1580 varbit_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1562 _null_ _null_ _null_ _null_ _null_ varbit_out _null_ _null_ _null_ _null_ ) insert ( 2902 varbittypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ varbittypmodin _null_ _null_ _null_ _null_ ) insert ( 2921 varbittypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ varbittypmodout _null_ _null_ _null_ _null_ ) insert ( 1581 biteq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ biteq _null_ _null_ _null_ _null_ ) insert ( 1582 bitne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitne _null_ _null_ _null_ _null_ ) insert ( 1592 bitge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitge _null_ _null_ _null_ _null_ ) insert ( 1593 bitgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitgt _null_ _null_ _null_ _null_ ) insert ( 1594 bitle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitle _null_ _null_ _null_ _null_ ) insert ( 1595 bitlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitlt _null_ _null_ _null_ _null_ ) insert ( 1596 bitcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitcmp _null_ _null_ _null_ _null_ ) insert ( 1598 random 11 10 12 1 0 0 0 f f f t f v r 0 0 701 '' _null_ _null_ _null_ _null_ _null_ drandom _null_ _null_ _null_ _null_ ) insert ( 6212 random_normal 11 10 12 1 0 0 0 f f f t f v r 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ drandom_normal _null_ _null_ _null_ _null_ ) insert ( 6339 random 11 10 12 1 0 0 0 f f f t f v r 2 0 23 '23 23' _null_ _null_ '{min,max}' _null_ _null_ int4random _null_ _null_ _null_ _null_ ) insert ( 6340 random 11 10 12 1 0 0 0 f f f t f v r 2 0 20 '20 20' _null_ _null_ '{min,max}' _null_ _null_ int8random _null_ _null_ _null_ _null_ ) insert ( 6341 random 11 10 12 1 0 0 0 f f f t f v r 2 0 1700 '1700 1700' _null_ _null_ '{min,max}' _null_ _null_ numeric_random _null_ _null_ _null_ _null_ ) insert ( 1599 setseed 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 701 _null_ _null_ _null_ _null_ _null_ setseed _null_ _null_ _null_ _null_ ) insert ( 1600 asin 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dasin _null_ _null_ _null_ _null_ ) insert ( 1601 acos 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dacos _null_ _null_ _null_ _null_ ) insert ( 1602 atan 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ datan _null_ _null_ _null_ _null_ ) insert ( 1603 atan2 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ datan2 _null_ _null_ _null_ _null_ ) insert ( 1604 sin 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsin _null_ _null_ _null_ _null_ ) insert ( 1605 cos 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcos _null_ _null_ _null_ _null_ ) insert ( 1606 tan 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dtan _null_ _null_ _null_ _null_ ) insert ( 1607 cot 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcot _null_ _null_ _null_ _null_ ) insert ( 2731 asind 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dasind _null_ _null_ _null_ _null_ ) insert ( 2732 acosd 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dacosd _null_ _null_ _null_ _null_ ) insert ( 2733 atand 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ datand _null_ _null_ _null_ _null_ ) insert ( 2734 atan2d 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ datan2d _null_ _null_ _null_ _null_ ) insert ( 2735 sind 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsind _null_ _null_ _null_ _null_ ) insert ( 2736 cosd 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcosd _null_ _null_ _null_ _null_ ) insert ( 2737 tand 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dtand _null_ _null_ _null_ _null_ ) insert ( 2738 cotd 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcotd _null_ _null_ _null_ _null_ ) insert ( 1608 degrees 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ degrees _null_ _null_ _null_ _null_ ) insert ( 1609 radians 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ radians _null_ _null_ _null_ _null_ ) insert ( 1610 pi 11 10 12 1 0 0 0 f f f t f i s 0 0 701 '' _null_ _null_ _null_ _null_ _null_ dpi _null_ _null_ _null_ _null_ ) insert ( 2462 sinh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dsinh _null_ _null_ _null_ _null_ ) insert ( 2463 cosh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dcosh _null_ _null_ _null_ _null_ ) insert ( 2464 tanh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dtanh _null_ _null_ _null_ _null_ ) insert ( 2465 asinh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dasinh _null_ _null_ _null_ _null_ ) insert ( 2466 acosh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ dacosh _null_ _null_ _null_ _null_ ) insert ( 2467 atanh 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ datanh _null_ _null_ _null_ _null_ ) insert ( 6219 erf 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ derf _null_ _null_ _null_ _null_ ) insert ( 6220 erfc 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ derfc _null_ _null_ _null_ _null_ ) insert ( 1618 interval_mul 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1186 701' _null_ _null_ _null_ _null_ _null_ interval_mul _null_ _null_ _null_ _null_ ) insert ( 1620 ascii 11 10 12 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ ascii _null_ _null_ _null_ _null_ ) insert ( 1621 chr 11 10 12 1 0 0 0 f f f t f i s 1 0 25 23 _null_ _null_ _null_ _null_ _null_ chr _null_ _null_ _null_ _null_ ) insert ( 1622 repeat 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ repeat _null_ _null_ _null_ _null_ ) insert ( 1623 similar_escape 11 10 12 1 0 0 0 f f f f f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ similar_escape _null_ _null_ _null_ _null_ ) insert ( 1986 similar_to_escape 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ similar_to_escape_2 _null_ _null_ _null_ _null_ ) insert ( 1987 similar_to_escape 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ similar_to_escape_1 _null_ _null_ _null_ _null_ ) insert ( 1624 mul_d_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '701 1186' _null_ _null_ _null_ _null_ _null_ mul_d_interval _null_ _null_ _null_ _null_ ) insert ( 1631 bpcharlike 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ textlike _null_ _null_ _null_ _null_ ) insert ( 1632 bpcharnlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ textnlike _null_ _null_ _null_ _null_ ) insert ( 1633 texticlike 11 10 12 1 0 0 1025 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ texticlike _null_ _null_ _null_ _null_ ) insert ( 1025 texticlike_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ texticlike_support _null_ _null_ _null_ _null_ ) insert ( 1634 texticnlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ texticnlike _null_ _null_ _null_ _null_ ) insert ( 1635 nameiclike 11 10 12 1 0 0 1025 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameiclike _null_ _null_ _null_ _null_ ) insert ( 1636 nameicnlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ nameicnlike _null_ _null_ _null_ _null_ ) insert ( 1637 like_escape 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ like_escape _null_ _null_ _null_ _null_ ) insert ( 1656 bpcharicregexeq 11 10 12 1 0 0 1024 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ texticregexeq _null_ _null_ _null_ _null_ ) insert ( 1657 bpcharicregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ texticregexne _null_ _null_ _null_ _null_ ) insert ( 1658 bpcharregexeq 11 10 12 1 0 0 1364 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ textregexeq _null_ _null_ _null_ _null_ ) insert ( 1659 bpcharregexne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ textregexne _null_ _null_ _null_ _null_ ) insert ( 1660 bpchariclike 11 10 12 1 0 0 1025 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ texticlike _null_ _null_ _null_ _null_ ) insert ( 1661 bpcharicnlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1042 25' _null_ _null_ _null_ _null_ _null_ texticnlike _null_ _null_ _null_ _null_ ) insert ( 868 strpos 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ textpos _null_ _null_ _null_ _null_ ) insert ( 870 lower 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ lower _null_ _null_ _null_ _null_ ) insert ( 871 upper 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ upper _null_ _null_ _null_ _null_ ) insert ( 872 initcap 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ initcap _null_ _null_ _null_ _null_ ) insert ( 873 lpad 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 23 25' _null_ _null_ _null_ _null_ _null_ lpad _null_ _null_ _null_ _null_ ) insert ( 874 rpad 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 23 25' _null_ _null_ _null_ _null_ _null_ rpad _null_ _null_ _null_ _null_ ) insert ( 875 ltrim 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ ltrim _null_ _null_ _null_ _null_ ) insert ( 876 rtrim 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ rtrim _null_ _null_ _null_ _null_ ) insert ( 877 substr 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 23 23' _null_ _null_ _null_ _null_ _null_ text_substr _null_ _null_ _null_ _null_ ) insert ( 878 translate 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ translate _null_ _null_ _null_ _null_ ) insert ( 879 lpad 11 10 14 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 880 rpad 11 10 14 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 881 ltrim 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ ltrim1 _null_ _null_ _null_ _null_ ) insert ( 882 rtrim 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ rtrim1 _null_ _null_ _null_ _null_ ) insert ( 883 substr 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ text_substr_no_len _null_ _null_ _null_ _null_ ) insert ( 884 btrim 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ btrim _null_ _null_ _null_ _null_ ) insert ( 885 btrim 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ btrim1 _null_ _null_ _null_ _null_ ) insert ( 936 substring 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 23 23' _null_ _null_ _null_ _null_ _null_ text_substr _null_ _null_ _null_ _null_ ) insert ( 937 substring 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ text_substr_no_len _null_ _null_ _null_ _null_ ) insert ( 2087 replace 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ replace_text _null_ _null_ _null_ _null_ ) insert ( 2284 regexp_replace 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ textregexreplace_noopt _null_ _null_ _null_ _null_ ) insert ( 2285 regexp_replace 11 10 12 1 0 0 0 f f f t f i s 4 0 25 '25 25 25 25' _null_ _null_ _null_ _null_ _null_ textregexreplace _null_ _null_ _null_ _null_ ) insert ( 6251 regexp_replace 11 10 12 1 0 0 0 f f f t f i s 6 0 25 '25 25 25 23 23 25' _null_ _null_ _null_ _null_ _null_ textregexreplace_extended _null_ _null_ _null_ _null_ ) insert ( 6252 regexp_replace 11 10 12 1 0 0 0 f f f t f i s 5 0 25 '25 25 25 23 23' _null_ _null_ _null_ _null_ _null_ textregexreplace_extended_no_flags _null_ _null_ _null_ _null_ ) insert ( 6253 regexp_replace 11 10 12 1 0 0 0 f f f t f i s 4 0 25 '25 25 25 23' _null_ _null_ _null_ _null_ _null_ textregexreplace_extended_no_n _null_ _null_ _null_ _null_ ) insert ( 3396 regexp_match 11 10 12 1 0 0 0 f f f t f i s 2 0 1009 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_match_no_flags _null_ _null_ _null_ _null_ ) insert ( 3397 regexp_match 11 10 12 1 0 0 0 f f f t f i s 3 0 1009 '25 25 25' _null_ _null_ _null_ _null_ _null_ regexp_match _null_ _null_ _null_ _null_ ) insert ( 2763 regexp_matches 11 10 12 1 1 0 0 f f f t t i s 2 0 1009 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_matches_no_flags _null_ _null_ _null_ _null_ ) insert ( 2764 regexp_matches 11 10 12 1 10 0 0 f f f t t i s 3 0 1009 '25 25 25' _null_ _null_ _null_ _null_ _null_ regexp_matches _null_ _null_ _null_ _null_ ) insert ( 6254 regexp_count 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_count_no_start _null_ _null_ _null_ _null_ ) insert ( 6255 regexp_count 11 10 12 1 0 0 0 f f f t f i s 3 0 23 '25 25 23' _null_ _null_ _null_ _null_ _null_ regexp_count_no_flags _null_ _null_ _null_ _null_ ) insert ( 6256 regexp_count 11 10 12 1 0 0 0 f f f t f i s 4 0 23 '25 25 23 25' _null_ _null_ _null_ _null_ _null_ regexp_count _null_ _null_ _null_ _null_ ) insert ( 6257 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_instr_no_start _null_ _null_ _null_ _null_ ) insert ( 6258 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 3 0 23 '25 25 23' _null_ _null_ _null_ _null_ _null_ regexp_instr_no_n _null_ _null_ _null_ _null_ ) insert ( 6259 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 4 0 23 '25 25 23 23' _null_ _null_ _null_ _null_ _null_ regexp_instr_no_endoption _null_ _null_ _null_ _null_ ) insert ( 6260 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 5 0 23 '25 25 23 23 23' _null_ _null_ _null_ _null_ _null_ regexp_instr_no_flags _null_ _null_ _null_ _null_ ) insert ( 6261 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 6 0 23 '25 25 23 23 23 25' _null_ _null_ _null_ _null_ _null_ regexp_instr_no_subexpr _null_ _null_ _null_ _null_ ) insert ( 6262 regexp_instr 11 10 12 1 0 0 0 f f f t f i s 7 0 23 '25 25 23 23 23 25 23' _null_ _null_ _null_ _null_ _null_ regexp_instr _null_ _null_ _null_ _null_ ) insert ( 6263 regexp_like 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_like_no_flags _null_ _null_ _null_ _null_ ) insert ( 6264 regexp_like 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '25 25 25' _null_ _null_ _null_ _null_ _null_ regexp_like _null_ _null_ _null_ _null_ ) insert ( 6265 regexp_substr 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_substr_no_start _null_ _null_ _null_ _null_ ) insert ( 6266 regexp_substr 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 23' _null_ _null_ _null_ _null_ _null_ regexp_substr_no_n _null_ _null_ _null_ _null_ ) insert ( 6267 regexp_substr 11 10 12 1 0 0 0 f f f t f i s 4 0 25 '25 25 23 23' _null_ _null_ _null_ _null_ _null_ regexp_substr_no_flags _null_ _null_ _null_ _null_ ) insert ( 6268 regexp_substr 11 10 12 1 0 0 0 f f f t f i s 5 0 25 '25 25 23 23 25' _null_ _null_ _null_ _null_ _null_ regexp_substr_no_subexpr _null_ _null_ _null_ _null_ ) insert ( 6269 regexp_substr 11 10 12 1 0 0 0 f f f t f i s 6 0 25 '25 25 23 23 25 23' _null_ _null_ _null_ _null_ _null_ regexp_substr _null_ _null_ _null_ _null_ ) insert ( 2088 split_part 11 10 12 1 0 0 0 f f f t f i s 3 0 25 '25 25 23' _null_ _null_ _null_ _null_ _null_ split_part _null_ _null_ _null_ _null_ ) insert ( 2765 regexp_split_to_table 11 10 12 1 1000 0 0 f f f t t i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_split_to_table_no_flags _null_ _null_ _null_ _null_ ) insert ( 2766 regexp_split_to_table 11 10 12 1 1000 0 0 f f f t t i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ regexp_split_to_table _null_ _null_ _null_ _null_ ) insert ( 2767 regexp_split_to_array 11 10 12 1 0 0 0 f f f t f i s 2 0 1009 '25 25' _null_ _null_ _null_ _null_ _null_ regexp_split_to_array_no_flags _null_ _null_ _null_ _null_ ) insert ( 2768 regexp_split_to_array 11 10 12 1 0 0 0 f f f t f i s 3 0 1009 '25 25 25' _null_ _null_ _null_ _null_ _null_ regexp_split_to_array _null_ _null_ _null_ _null_ ) insert ( 6330 to_bin 11 10 12 1 0 0 0 f f f t f i s 1 0 25 23 _null_ _null_ _null_ _null_ _null_ to_bin32 _null_ _null_ _null_ _null_ ) insert ( 6331 to_bin 11 10 12 1 0 0 0 f f f t f i s 1 0 25 20 _null_ _null_ _null_ _null_ _null_ to_bin64 _null_ _null_ _null_ _null_ ) insert ( 6332 to_oct 11 10 12 1 0 0 0 f f f t f i s 1 0 25 23 _null_ _null_ _null_ _null_ _null_ to_oct32 _null_ _null_ _null_ _null_ ) insert ( 6333 to_oct 11 10 12 1 0 0 0 f f f t f i s 1 0 25 20 _null_ _null_ _null_ _null_ _null_ to_oct64 _null_ _null_ _null_ _null_ ) insert ( 2089 to_hex 11 10 12 1 0 0 0 f f f t f i s 1 0 25 23 _null_ _null_ _null_ _null_ _null_ to_hex32 _null_ _null_ _null_ _null_ ) insert ( 2090 to_hex 11 10 12 1 0 0 0 f f f t f i s 1 0 25 20 _null_ _null_ _null_ _null_ _null_ to_hex64 _null_ _null_ _null_ _null_ ) insert ( 1039 getdatabaseencoding 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ getdatabaseencoding _null_ _null_ _null_ _null_ ) insert ( 810 pg_client_encoding 11 10 12 1 0 0 0 f f f t f s s 0 0 19 '' _null_ _null_ _null_ _null_ _null_ pg_client_encoding _null_ _null_ _null_ _null_ ) insert ( 1713 length 11 10 12 1 0 0 0 f f f t f s s 2 0 23 '17 19' _null_ _null_ _null_ _null_ _null_ length_in_encoding _null_ _null_ _null_ _null_ ) insert ( 1714 convert_from 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '17 19' _null_ _null_ _null_ _null_ _null_ pg_convert_from _null_ _null_ _null_ _null_ ) insert ( 1717 convert_to 11 10 12 1 0 0 0 f f f t f s s 2 0 17 '25 19' _null_ _null_ _null_ _null_ _null_ pg_convert_to _null_ _null_ _null_ _null_ ) insert ( 1813 convert 11 10 12 1 0 0 0 f f f t f s s 3 0 17 '17 19 19' _null_ _null_ _null_ _null_ _null_ pg_convert _null_ _null_ _null_ _null_ ) insert ( 1264 pg_char_to_encoding 11 10 12 1 0 0 0 f f f t f s s 1 0 23 19 _null_ _null_ _null_ _null_ _null_ PG_char_to_encoding _null_ _null_ _null_ _null_ ) insert ( 1597 pg_encoding_to_char 11 10 12 1 0 0 0 f f f t f s s 1 0 19 23 _null_ _null_ _null_ _null_ _null_ PG_encoding_to_char _null_ _null_ _null_ _null_ ) insert ( 2319 pg_encoding_max_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ pg_encoding_max_length_sql _null_ _null_ _null_ _null_ ) insert ( 1638 oidgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oidgt _null_ _null_ _null_ _null_ ) insert ( 1639 oidge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '26 26' _null_ _null_ _null_ _null_ _null_ oidge _null_ _null_ _null_ _null_ ) insert ( 1573 pg_get_ruledef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_ruledef _null_ _null_ _null_ _null_ ) insert ( 1640 pg_get_viewdef 11 10 12 1 0 0 0 f f f t f s r 1 0 25 25 _null_ _null_ _null_ _null_ _null_ pg_get_viewdef_name _null_ _null_ _null_ _null_ ) insert ( 1641 pg_get_viewdef 11 10 12 1 0 0 0 f f f t f s r 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_viewdef _null_ _null_ _null_ _null_ ) insert ( 1642 pg_get_userbyid 11 10 12 1 0 0 0 f f f t f s s 1 0 19 26 _null_ _null_ _null_ _null_ _null_ pg_get_userbyid _null_ _null_ _null_ _null_ ) insert ( 1643 pg_get_indexdef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_indexdef _null_ _null_ _null_ _null_ ) insert ( 3415 pg_get_statisticsobjdef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_statisticsobjdef _null_ _null_ _null_ _null_ ) insert ( 6174 pg_get_statisticsobjdef_columns 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_statisticsobjdef_columns _null_ _null_ _null_ _null_ ) insert ( 6173 pg_get_statisticsobjdef_expressions 11 10 12 1 0 0 0 f f f t f s s 1 0 1009 26 _null_ _null_ _null_ _null_ _null_ pg_get_statisticsobjdef_expressions _null_ _null_ _null_ _null_ ) insert ( 3352 pg_get_partkeydef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_partkeydef _null_ _null_ _null_ _null_ ) insert ( 3408 pg_get_partition_constraintdef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_partition_constraintdef _null_ _null_ _null_ _null_ ) insert ( 1662 pg_get_triggerdef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_triggerdef _null_ _null_ _null_ _null_ ) insert ( 1387 pg_get_constraintdef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_constraintdef _null_ _null_ _null_ _null_ ) insert ( 1716 pg_get_expr 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '194 26' _null_ _null_ _null_ _null_ _null_ pg_get_expr _null_ _null_ _null_ _null_ ) insert ( 1665 pg_get_serial_sequence 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ pg_get_serial_sequence _null_ _null_ _null_ _null_ ) insert ( 2098 pg_get_functiondef 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_functiondef _null_ _null_ _null_ _null_ ) insert ( 2162 pg_get_function_arguments 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_function_arguments _null_ _null_ _null_ _null_ ) insert ( 2232 pg_get_function_identity_arguments 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_function_identity_arguments _null_ _null_ _null_ _null_ ) insert ( 2165 pg_get_function_result 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_function_result _null_ _null_ _null_ _null_ ) insert ( 3808 pg_get_function_arg_default 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '26 23' _null_ _null_ _null_ _null_ _null_ pg_get_function_arg_default _null_ _null_ _null_ _null_ ) insert ( 6197 pg_get_function_sqlbody 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_get_function_sqlbody _null_ _null_ _null_ _null_ ) insert ( 1686 pg_get_keywords 11 10 12 10 500 0 0 f f f t t s s 0 0 2249 '' '{25,18,16,25,25}' '{o,o,o,o,o}' '{word,catcode,barelabel,catdesc,baredesc}' _null_ _null_ pg_get_keywords _null_ _null_ _null_ _null_ ) insert ( 6159 pg_get_catalog_foreign_keys 11 10 12 10 250 0 0 f f f t t s s 0 0 2249 '' '{2205,1009,2205,1009,16,16}' '{o,o,o,o,o,o}' '{fktable,fkcols,pktable,pkcols,is_array,is_opt}' _null_ _null_ pg_get_catalog_foreign_keys _null_ _null_ _null_ _null_ ) insert ( 2289 pg_options_to_table 11 10 12 1 3 0 0 f f f t t s s 1 0 2249 1009 '{1009,25,25}' '{i,o,o}' '{options_array,option_name,option_value}' _null_ _null_ pg_options_to_table _null_ _null_ _null_ _null_ ) insert ( 1619 pg_typeof 11 10 12 1 0 0 0 f f f f f s s 1 0 2206 2276 _null_ _null_ _null_ _null_ _null_ pg_typeof _null_ _null_ _null_ _null_ ) insert ( 6315 pg_basetype 11 10 12 1 0 0 0 f f f t f s s 1 0 2206 2206 _null_ _null_ _null_ _null_ _null_ pg_basetype _null_ _null_ _null_ _null_ ) insert ( 3162 pg_collation_for 11 10 12 1 0 0 0 f f f f f s s 1 0 25 2276 _null_ _null_ _null_ _null_ _null_ pg_collation_for _null_ _null_ _null_ _null_ ) insert ( 3842 pg_relation_is_updatable 11 10 12 10 0 0 0 f f f t f s s 2 0 23 '2205 16' _null_ _null_ _null_ _null_ _null_ pg_relation_is_updatable _null_ _null_ _null_ _null_ ) insert ( 3843 pg_column_is_updatable 11 10 12 10 0 0 0 f f f t f s s 3 0 16 '2205 21 16' _null_ _null_ _null_ _null_ _null_ pg_column_is_updatable _null_ _null_ _null_ _null_ ) insert ( 6120 pg_get_replica_identity_index 11 10 12 10 0 0 0 f f f t f s s 1 0 2205 2205 _null_ _null_ _null_ _null_ _null_ pg_get_replica_identity_index _null_ _null_ _null_ _null_ ) insert ( 1250 unique_key_recheck 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ unique_key_recheck _null_ _null_ _null_ _null_ ) insert ( 1644 RI_FKey_check_ins 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_check_ins _null_ _null_ _null_ _null_ ) insert ( 1645 RI_FKey_check_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_check_upd _null_ _null_ _null_ _null_ ) insert ( 1646 RI_FKey_cascade_del 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_cascade_del _null_ _null_ _null_ _null_ ) insert ( 1647 RI_FKey_cascade_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_cascade_upd _null_ _null_ _null_ _null_ ) insert ( 1648 RI_FKey_restrict_del 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_restrict_del _null_ _null_ _null_ _null_ ) insert ( 1649 RI_FKey_restrict_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_restrict_upd _null_ _null_ _null_ _null_ ) insert ( 1650 RI_FKey_setnull_del 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_setnull_del _null_ _null_ _null_ _null_ ) insert ( 1651 RI_FKey_setnull_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_setnull_upd _null_ _null_ _null_ _null_ ) insert ( 1652 RI_FKey_setdefault_del 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_setdefault_del _null_ _null_ _null_ _null_ ) insert ( 1653 RI_FKey_setdefault_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_setdefault_upd _null_ _null_ _null_ _null_ ) insert ( 1654 RI_FKey_noaction_del 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_noaction_del _null_ _null_ _null_ _null_ ) insert ( 1655 RI_FKey_noaction_upd 11 10 12 1 0 0 0 f f f t f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ RI_FKey_noaction_upd _null_ _null_ _null_ _null_ ) insert ( 1666 varbiteq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ biteq _null_ _null_ _null_ _null_ ) insert ( 1667 varbitne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitne _null_ _null_ _null_ _null_ ) insert ( 1668 varbitge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitge _null_ _null_ _null_ _null_ ) insert ( 1669 varbitgt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitgt _null_ _null_ _null_ _null_ ) insert ( 1670 varbitle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitle _null_ _null_ _null_ _null_ ) insert ( 1671 varbitlt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitlt _null_ _null_ _null_ _null_ ) insert ( 1672 varbitcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitcmp _null_ _null_ _null_ _null_ ) insert ( 1673 bitand 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 1560' _null_ _null_ _null_ _null_ _null_ bit_and _null_ _null_ _null_ _null_ ) insert ( 1674 bitor 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 1560' _null_ _null_ _null_ _null_ _null_ bit_or _null_ _null_ _null_ _null_ ) insert ( 1675 bitxor 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitxor _null_ _null_ _null_ _null_ ) insert ( 1676 bitnot 11 10 12 1 0 0 0 f f f t f i s 1 0 1560 1560 _null_ _null_ _null_ _null_ _null_ bitnot _null_ _null_ _null_ _null_ ) insert ( 1677 bitshiftleft 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 23' _null_ _null_ _null_ _null_ _null_ bitshiftleft _null_ _null_ _null_ _null_ ) insert ( 1678 bitshiftright 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 23' _null_ _null_ _null_ _null_ _null_ bitshiftright _null_ _null_ _null_ _null_ ) insert ( 1679 bitcat 11 10 12 1 0 0 0 f f f t f i s 2 0 1562 '1562 1562' _null_ _null_ _null_ _null_ _null_ bitcat _null_ _null_ _null_ _null_ ) insert ( 1680 substring 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '1560 23 23' _null_ _null_ _null_ _null_ _null_ bitsubstr _null_ _null_ _null_ _null_ ) insert ( 1681 length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1560 _null_ _null_ _null_ _null_ _null_ bitlength _null_ _null_ _null_ _null_ ) insert ( 1682 octet_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1560 _null_ _null_ _null_ _null_ _null_ bitoctetlength _null_ _null_ _null_ _null_ ) insert ( 1683 bit 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '23 23' _null_ _null_ _null_ _null_ _null_ bitfromint4 _null_ _null_ _null_ _null_ ) insert ( 1684 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1560 _null_ _null_ _null_ _null_ _null_ bittoint4 _null_ _null_ _null_ _null_ ) insert ( 1685 bit 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '1560 23 16' _null_ _null_ _null_ _null_ _null_ bit _null_ _null_ _null_ _null_ ) insert ( 3158 varbit_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ varbit_support _null_ _null_ _null_ _null_ ) insert ( 1687 varbit 11 10 12 1 0 0 3158 f f f t f i s 3 0 1562 '1562 23 16' _null_ _null_ _null_ _null_ _null_ varbit _null_ _null_ _null_ _null_ ) insert ( 1698 position 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1560 1560' _null_ _null_ _null_ _null_ _null_ bitposition _null_ _null_ _null_ _null_ ) insert ( 1699 substring 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '1560 23' _null_ _null_ _null_ _null_ _null_ bitsubstr_no_len _null_ _null_ _null_ _null_ ) insert ( 3030 overlay 11 10 12 1 0 0 0 f f f t f i s 4 0 1560 '1560 1560 23 23' _null_ _null_ _null_ _null_ _null_ bitoverlay _null_ _null_ _null_ _null_ ) insert ( 3031 overlay 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '1560 1560 23' _null_ _null_ _null_ _null_ _null_ bitoverlay_no_len _null_ _null_ _null_ _null_ ) insert ( 3032 get_bit 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1560 23' _null_ _null_ _null_ _null_ _null_ bitgetbit _null_ _null_ _null_ _null_ ) insert ( 3033 set_bit 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '1560 23 23' _null_ _null_ _null_ _null_ _null_ bitsetbit _null_ _null_ _null_ _null_ ) insert ( 6162 bit_count 11 10 12 1 0 0 0 f f f t f i s 1 0 20 1560 _null_ _null_ _null_ _null_ _null_ bit_bit_count _null_ _null_ _null_ _null_ ) insert ( 436 macaddr_in 11 10 12 1 0 0 0 f f f t f i s 1 0 829 2275 _null_ _null_ _null_ _null_ _null_ macaddr_in _null_ _null_ _null_ _null_ ) insert ( 437 macaddr_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 829 _null_ _null_ _null_ _null_ _null_ macaddr_out _null_ _null_ _null_ _null_ ) insert ( 753 trunc 11 10 12 1 0 0 0 f f f t f i s 1 0 829 829 _null_ _null_ _null_ _null_ _null_ macaddr_trunc _null_ _null_ _null_ _null_ ) insert ( 830 macaddr_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_eq _null_ _null_ _null_ _null_ ) insert ( 831 macaddr_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_lt _null_ _null_ _null_ _null_ ) insert ( 832 macaddr_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_le _null_ _null_ _null_ _null_ ) insert ( 833 macaddr_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_gt _null_ _null_ _null_ _null_ ) insert ( 834 macaddr_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_ge _null_ _null_ _null_ _null_ ) insert ( 835 macaddr_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_ne _null_ _null_ _null_ _null_ ) insert ( 836 macaddr_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_cmp _null_ _null_ _null_ _null_ ) insert ( 3144 macaddr_not 11 10 12 1 0 0 0 f f f t f i s 1 0 829 829 _null_ _null_ _null_ _null_ _null_ macaddr_not _null_ _null_ _null_ _null_ ) insert ( 3145 macaddr_and 11 10 12 1 0 0 0 f f f t f i s 2 0 829 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_and _null_ _null_ _null_ _null_ ) insert ( 3146 macaddr_or 11 10 12 1 0 0 0 f f f t f i s 2 0 829 '829 829' _null_ _null_ _null_ _null_ _null_ macaddr_or _null_ _null_ _null_ _null_ ) insert ( 3359 macaddr_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ macaddr_sortsupport _null_ _null_ _null_ _null_ ) insert ( 4110 macaddr8_in 11 10 12 1 0 0 0 f f f t f i s 1 0 774 2275 _null_ _null_ _null_ _null_ _null_ macaddr8_in _null_ _null_ _null_ _null_ ) insert ( 4111 macaddr8_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 774 _null_ _null_ _null_ _null_ _null_ macaddr8_out _null_ _null_ _null_ _null_ ) insert ( 4112 trunc 11 10 12 1 0 0 0 f f f t f i s 1 0 774 774 _null_ _null_ _null_ _null_ _null_ macaddr8_trunc _null_ _null_ _null_ _null_ ) insert ( 4113 macaddr8_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_eq _null_ _null_ _null_ _null_ ) insert ( 4114 macaddr8_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_lt _null_ _null_ _null_ _null_ ) insert ( 4115 macaddr8_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_le _null_ _null_ _null_ _null_ ) insert ( 4116 macaddr8_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_gt _null_ _null_ _null_ _null_ ) insert ( 4117 macaddr8_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_ge _null_ _null_ _null_ _null_ ) insert ( 4118 macaddr8_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_ne _null_ _null_ _null_ _null_ ) insert ( 4119 macaddr8_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_cmp _null_ _null_ _null_ _null_ ) insert ( 4120 macaddr8_not 11 10 12 1 0 0 0 f f f t f i s 1 0 774 774 _null_ _null_ _null_ _null_ _null_ macaddr8_not _null_ _null_ _null_ _null_ ) insert ( 4121 macaddr8_and 11 10 12 1 0 0 0 f f f t f i s 2 0 774 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_and _null_ _null_ _null_ _null_ ) insert ( 4122 macaddr8_or 11 10 12 1 0 0 0 f f f t f i s 2 0 774 '774 774' _null_ _null_ _null_ _null_ _null_ macaddr8_or _null_ _null_ _null_ _null_ ) insert ( 4123 macaddr8 11 10 12 1 0 0 0 f f t t f i s 1 0 774 829 _null_ _null_ _null_ _null_ _null_ macaddrtomacaddr8 _null_ _null_ _null_ _null_ ) insert ( 4124 macaddr 11 10 12 1 0 0 0 f f f t f i s 1 0 829 774 _null_ _null_ _null_ _null_ _null_ macaddr8tomacaddr _null_ _null_ _null_ _null_ ) insert ( 4125 macaddr8_set7bit 11 10 12 1 0 0 0 f f f t f i s 1 0 774 774 _null_ _null_ _null_ _null_ _null_ macaddr8_set7bit _null_ _null_ _null_ _null_ ) insert ( 910 inet_in 11 10 12 1 0 0 0 f f f t f i s 1 0 869 2275 _null_ _null_ _null_ _null_ _null_ inet_in _null_ _null_ _null_ _null_ ) insert ( 911 inet_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 869 _null_ _null_ _null_ _null_ _null_ inet_out _null_ _null_ _null_ _null_ ) insert ( 1267 cidr_in 11 10 12 1 0 0 0 f f f t f i s 1 0 650 2275 _null_ _null_ _null_ _null_ _null_ cidr_in _null_ _null_ _null_ _null_ ) insert ( 1427 cidr_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 650 _null_ _null_ _null_ _null_ _null_ cidr_out _null_ _null_ _null_ _null_ ) insert ( 920 network_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_eq _null_ _null_ _null_ _null_ ) insert ( 921 network_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_lt _null_ _null_ _null_ _null_ ) insert ( 922 network_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_le _null_ _null_ _null_ _null_ ) insert ( 923 network_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_gt _null_ _null_ _null_ _null_ ) insert ( 924 network_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_ge _null_ _null_ _null_ _null_ ) insert ( 925 network_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_ne _null_ _null_ _null_ _null_ ) insert ( 3562 network_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 869' _null_ _null_ _null_ _null_ _null_ network_larger _null_ _null_ _null_ _null_ ) insert ( 3563 network_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 869' _null_ _null_ _null_ _null_ _null_ network_smaller _null_ _null_ _null_ _null_ ) insert ( 926 network_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '869 869' _null_ _null_ _null_ _null_ _null_ network_cmp _null_ _null_ _null_ _null_ ) insert ( 927 network_sub 11 10 12 1 0 0 1173 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_sub _null_ _null_ _null_ _null_ ) insert ( 928 network_subeq 11 10 12 1 0 0 1173 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_subeq _null_ _null_ _null_ _null_ ) insert ( 929 network_sup 11 10 12 1 0 0 1173 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_sup _null_ _null_ _null_ _null_ ) insert ( 930 network_supeq 11 10 12 1 0 0 1173 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_supeq _null_ _null_ _null_ _null_ ) insert ( 1173 network_subset_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ network_subset_support _null_ _null_ _null_ _null_ ) insert ( 3551 network_overlap 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ network_overlap _null_ _null_ _null_ _null_ ) insert ( 5033 network_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ network_sortsupport _null_ _null_ _null_ _null_ ) insert ( 598 abbrev 11 10 12 1 0 0 0 f f f t f i s 1 0 25 869 _null_ _null_ _null_ _null_ _null_ inet_abbrev _null_ _null_ _null_ _null_ ) insert ( 599 abbrev 11 10 12 1 0 0 0 f f f t f i s 1 0 25 650 _null_ _null_ _null_ _null_ _null_ cidr_abbrev _null_ _null_ _null_ _null_ ) insert ( 605 set_masklen 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 23' _null_ _null_ _null_ _null_ _null_ inet_set_masklen _null_ _null_ _null_ _null_ ) insert ( 635 set_masklen 11 10 12 1 0 0 0 f f f t f i s 2 0 650 '650 23' _null_ _null_ _null_ _null_ _null_ cidr_set_masklen _null_ _null_ _null_ _null_ ) insert ( 711 family 11 10 12 1 0 0 0 f f f t f i s 1 0 23 869 _null_ _null_ _null_ _null_ _null_ network_family _null_ _null_ _null_ _null_ ) insert ( 683 network 11 10 12 1 0 0 0 f f f t f i s 1 0 650 869 _null_ _null_ _null_ _null_ _null_ network_network _null_ _null_ _null_ _null_ ) insert ( 696 netmask 11 10 12 1 0 0 0 f f f t f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ network_netmask _null_ _null_ _null_ _null_ ) insert ( 697 masklen 11 10 12 1 0 0 0 f f f t f i s 1 0 23 869 _null_ _null_ _null_ _null_ _null_ network_masklen _null_ _null_ _null_ _null_ ) insert ( 698 broadcast 11 10 12 1 0 0 0 f f f t f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ network_broadcast _null_ _null_ _null_ _null_ ) insert ( 699 host 11 10 12 1 0 0 0 f f f t f i s 1 0 25 869 _null_ _null_ _null_ _null_ _null_ network_host _null_ _null_ _null_ _null_ ) insert ( 730 text 11 10 12 1 0 0 0 f f f t f i s 1 0 25 869 _null_ _null_ _null_ _null_ _null_ network_show _null_ _null_ _null_ _null_ ) insert ( 1362 hostmask 11 10 12 1 0 0 0 f f f t f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ network_hostmask _null_ _null_ _null_ _null_ ) insert ( 1715 cidr 11 10 12 1 0 0 0 f f f t f i s 1 0 650 869 _null_ _null_ _null_ _null_ _null_ inet_to_cidr _null_ _null_ _null_ _null_ ) insert ( 2196 inet_client_addr 11 10 12 1 0 0 0 f f f f f s r 0 0 869 '' _null_ _null_ _null_ _null_ _null_ inet_client_addr _null_ _null_ _null_ _null_ ) insert ( 2197 inet_client_port 11 10 12 1 0 0 0 f f f f f s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ inet_client_port _null_ _null_ _null_ _null_ ) insert ( 2198 inet_server_addr 11 10 12 1 0 0 0 f f f f f s r 0 0 869 '' _null_ _null_ _null_ _null_ _null_ inet_server_addr _null_ _null_ _null_ _null_ ) insert ( 2199 inet_server_port 11 10 12 1 0 0 0 f f f f f s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ inet_server_port _null_ _null_ _null_ _null_ ) insert ( 2627 inetnot 11 10 12 1 0 0 0 f f f t f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ inetnot _null_ _null_ _null_ _null_ ) insert ( 2628 inetand 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 869' _null_ _null_ _null_ _null_ _null_ inetand _null_ _null_ _null_ _null_ ) insert ( 2629 inetor 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 869' _null_ _null_ _null_ _null_ _null_ inetor _null_ _null_ _null_ _null_ ) insert ( 2630 inetpl 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 20' _null_ _null_ _null_ _null_ _null_ inetpl _null_ _null_ _null_ _null_ ) insert ( 2631 int8pl_inet 11 10 14 1 0 0 0 f f f t f i s 2 0 869 '20 869' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2632 inetmi_int8 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '869 20' _null_ _null_ _null_ _null_ _null_ inetmi_int8 _null_ _null_ _null_ _null_ ) insert ( 2633 inetmi 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '869 869' _null_ _null_ _null_ _null_ _null_ inetmi _null_ _null_ _null_ _null_ ) insert ( 4071 inet_same_family 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '869 869' _null_ _null_ _null_ _null_ _null_ inet_same_family _null_ _null_ _null_ _null_ ) insert ( 4063 inet_merge 11 10 12 1 0 0 0 f f f t f i s 2 0 650 '869 869' _null_ _null_ _null_ _null_ _null_ inet_merge _null_ _null_ _null_ _null_ ) insert ( 3553 inet_gist_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 869 21 26 2281' _null_ _null_ _null_ _null_ _null_ inet_gist_consistent _null_ _null_ _null_ _null_ ) insert ( 3554 inet_gist_union 11 10 12 1 0 0 0 f f f t f i s 2 0 869 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_gist_union _null_ _null_ _null_ _null_ ) insert ( 3555 inet_gist_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ inet_gist_compress _null_ _null_ _null_ _null_ ) insert ( 3573 inet_gist_fetch 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ inet_gist_fetch _null_ _null_ _null_ _null_ ) insert ( 3557 inet_gist_penalty 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ inet_gist_penalty _null_ _null_ _null_ _null_ ) insert ( 3558 inet_gist_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_gist_picksplit _null_ _null_ _null_ _null_ ) insert ( 3559 inet_gist_same 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '869 869 2281' _null_ _null_ _null_ _null_ _null_ inet_gist_same _null_ _null_ _null_ _null_ ) insert ( 3795 inet_spg_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_spg_config _null_ _null_ _null_ _null_ ) insert ( 3796 inet_spg_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_spg_choose _null_ _null_ _null_ _null_ ) insert ( 3797 inet_spg_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_spg_picksplit _null_ _null_ _null_ _null_ ) insert ( 3798 inet_spg_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_spg_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 3799 inet_spg_leaf_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2281 2281' _null_ _null_ _null_ _null_ _null_ inet_spg_leaf_consistent _null_ _null_ _null_ _null_ ) insert ( 3560 networksel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ networksel _null_ _null_ _null_ _null_ ) insert ( 3561 networkjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ networkjoinsel _null_ _null_ _null_ _null_ ) insert ( 1690 time_mi_time 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1083 1083' _null_ _null_ _null_ _null_ _null_ time_mi_time _null_ _null_ _null_ _null_ ) insert ( 1691 boolle 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boolle _null_ _null_ _null_ _null_ ) insert ( 1692 boolge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boolge _null_ _null_ _null_ _null_ ) insert ( 1693 btboolcmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '16 16' _null_ _null_ _null_ _null_ _null_ btboolcmp _null_ _null_ _null_ _null_ ) insert ( 1688 time_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1083 _null_ _null_ _null_ _null_ _null_ time_hash _null_ _null_ _null_ _null_ ) insert ( 3409 time_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1083 20' _null_ _null_ _null_ _null_ _null_ time_hash_extended _null_ _null_ _null_ _null_ ) insert ( 1696 timetz_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1266 _null_ _null_ _null_ _null_ _null_ timetz_hash _null_ _null_ _null_ _null_ ) insert ( 3410 timetz_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1266 20' _null_ _null_ _null_ _null_ _null_ timetz_hash_extended _null_ _null_ _null_ _null_ ) insert ( 1697 interval_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1186 _null_ _null_ _null_ _null_ _null_ interval_hash _null_ _null_ _null_ _null_ ) insert ( 3418 interval_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1186 20' _null_ _null_ _null_ _null_ _null_ interval_hash_extended _null_ _null_ _null_ _null_ ) insert ( 1701 numeric_in 11 10 12 1 0 0 0 f f f t f i s 3 0 1700 '2275 26 23' _null_ _null_ _null_ _null_ _null_ numeric_in _null_ _null_ _null_ _null_ ) insert ( 1702 numeric_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 1700 _null_ _null_ _null_ _null_ _null_ numeric_out _null_ _null_ _null_ _null_ ) insert ( 2917 numerictypmodin 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1263 _null_ _null_ _null_ _null_ _null_ numerictypmodin _null_ _null_ _null_ _null_ ) insert ( 2918 numerictypmodout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 23 _null_ _null_ _null_ _null_ _null_ numerictypmodout _null_ _null_ _null_ _null_ ) insert ( 3157 numeric_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ numeric_support _null_ _null_ _null_ _null_ ) insert ( 1703 numeric 11 10 12 1 0 0 3157 f f f t f i s 2 0 1700 '1700 23' _null_ _null_ _null_ _null_ _null_ numeric _null_ _null_ _null_ _null_ ) insert ( 1704 numeric_abs 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_abs _null_ _null_ _null_ _null_ ) insert ( 1705 abs 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_abs _null_ _null_ _null_ _null_ ) insert ( 1706 sign 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_sign _null_ _null_ _null_ _null_ ) insert ( 1707 round 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 23' _null_ _null_ _null_ _null_ _null_ numeric_round _null_ _null_ _null_ _null_ ) insert ( 1708 round 11 10 14 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1709 trunc 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 23' _null_ _null_ _null_ _null_ _null_ numeric_trunc _null_ _null_ _null_ _null_ ) insert ( 1710 trunc 11 10 14 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1711 ceil 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_ceil _null_ _null_ _null_ _null_ ) insert ( 2167 ceiling 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_ceil _null_ _null_ _null_ _null_ ) insert ( 1712 floor 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_floor _null_ _null_ _null_ _null_ ) insert ( 1718 numeric_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_eq _null_ _null_ _null_ _null_ ) insert ( 1719 numeric_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_ne _null_ _null_ _null_ _null_ ) insert ( 1720 numeric_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_gt _null_ _null_ _null_ _null_ ) insert ( 1721 numeric_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_ge _null_ _null_ _null_ _null_ ) insert ( 1722 numeric_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_lt _null_ _null_ _null_ _null_ ) insert ( 1723 numeric_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_le _null_ _null_ _null_ _null_ ) insert ( 1724 numeric_add 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_add _null_ _null_ _null_ _null_ ) insert ( 1725 numeric_sub 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_sub _null_ _null_ _null_ _null_ ) insert ( 1726 numeric_mul 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_mul _null_ _null_ _null_ _null_ ) insert ( 1727 numeric_div 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_div _null_ _null_ _null_ _null_ ) insert ( 1728 mod 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_mod _null_ _null_ _null_ _null_ ) insert ( 1729 numeric_mod 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_mod _null_ _null_ _null_ _null_ ) insert ( 5048 gcd 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_gcd _null_ _null_ _null_ _null_ ) insert ( 5049 lcm 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_lcm _null_ _null_ _null_ _null_ ) insert ( 1730 sqrt 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_sqrt _null_ _null_ _null_ _null_ ) insert ( 1731 numeric_sqrt 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_sqrt _null_ _null_ _null_ _null_ ) insert ( 1732 exp 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_exp _null_ _null_ _null_ _null_ ) insert ( 1733 numeric_exp 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_exp _null_ _null_ _null_ _null_ ) insert ( 1734 ln 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_ln _null_ _null_ _null_ _null_ ) insert ( 1735 numeric_ln 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_ln _null_ _null_ _null_ _null_ ) insert ( 1736 log 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_log _null_ _null_ _null_ _null_ ) insert ( 1737 numeric_log 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_log _null_ _null_ _null_ _null_ ) insert ( 1738 pow 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_power _null_ _null_ _null_ _null_ ) insert ( 2169 power 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_power _null_ _null_ _null_ _null_ ) insert ( 1739 numeric_power 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_power _null_ _null_ _null_ _null_ ) insert ( 3281 scale 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1700 _null_ _null_ _null_ _null_ _null_ numeric_scale _null_ _null_ _null_ _null_ ) insert ( 5042 min_scale 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1700 _null_ _null_ _null_ _null_ _null_ numeric_min_scale _null_ _null_ _null_ _null_ ) insert ( 5043 trim_scale 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_trim_scale _null_ _null_ _null_ _null_ ) insert ( 1740 numeric 11 10 12 1 0 0 0 f f t t f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ int4_numeric _null_ _null_ _null_ _null_ ) insert ( 1741 log 11 10 14 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1481 log10 11 10 14 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1742 numeric 11 10 12 1 0 0 0 f f t t f i s 1 0 1700 700 _null_ _null_ _null_ _null_ _null_ float4_numeric _null_ _null_ _null_ _null_ ) insert ( 1743 numeric 11 10 12 1 0 0 0 f f t t f i s 1 0 1700 701 _null_ _null_ _null_ _null_ _null_ float8_numeric _null_ _null_ _null_ _null_ ) insert ( 1744 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1700 _null_ _null_ _null_ _null_ _null_ numeric_int4 _null_ _null_ _null_ _null_ ) insert ( 1745 float4 11 10 12 1 0 0 0 f f f t f i s 1 0 700 1700 _null_ _null_ _null_ _null_ _null_ numeric_float4 _null_ _null_ _null_ _null_ ) insert ( 1746 float8 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1700 _null_ _null_ _null_ _null_ _null_ numeric_float8 _null_ _null_ _null_ _null_ ) insert ( 1973 div 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_div_trunc _null_ _null_ _null_ _null_ ) insert ( 1980 numeric_div_trunc 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_div_trunc _null_ _null_ _null_ _null_ ) insert ( 2170 width_bucket 11 10 12 1 0 0 0 f f f t f i s 4 0 23 '1700 1700 1700 23' _null_ _null_ _null_ _null_ _null_ width_bucket_numeric _null_ _null_ _null_ _null_ ) insert ( 1747 time_pl_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1083 '1083 1186' _null_ _null_ _null_ _null_ _null_ time_pl_interval _null_ _null_ _null_ _null_ ) insert ( 1748 time_mi_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1083 '1083 1186' _null_ _null_ _null_ _null_ _null_ time_mi_interval _null_ _null_ _null_ _null_ ) insert ( 1749 timetz_pl_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1266 '1266 1186' _null_ _null_ _null_ _null_ _null_ timetz_pl_interval _null_ _null_ _null_ _null_ ) insert ( 1750 timetz_mi_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1266 '1266 1186' _null_ _null_ _null_ _null_ _null_ timetz_mi_interval _null_ _null_ _null_ _null_ ) insert ( 1764 numeric_inc 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_inc _null_ _null_ _null_ _null_ ) insert ( 1766 numeric_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_smaller _null_ _null_ _null_ _null_ ) insert ( 1767 numeric_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_larger _null_ _null_ _null_ _null_ ) insert ( 1769 numeric_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1700 1700' _null_ _null_ _null_ _null_ _null_ numeric_cmp _null_ _null_ _null_ _null_ ) insert ( 3283 numeric_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ numeric_sortsupport _null_ _null_ _null_ _null_ ) insert ( 1771 numeric_uminus 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_uminus _null_ _null_ _null_ _null_ ) insert ( 1779 int8 11 10 12 1 0 0 0 f f f t f i s 1 0 20 1700 _null_ _null_ _null_ _null_ _null_ numeric_int8 _null_ _null_ _null_ _null_ ) insert ( 1781 numeric 11 10 12 1 0 0 0 f f t t f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ int8_numeric _null_ _null_ _null_ _null_ ) insert ( 1782 numeric 11 10 12 1 0 0 0 f f t t f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ int2_numeric _null_ _null_ _null_ _null_ ) insert ( 1783 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 1700 _null_ _null_ _null_ _null_ _null_ numeric_int2 _null_ _null_ _null_ _null_ ) insert ( 6103 pg_lsn 11 10 12 1 0 0 0 f f f t f i s 1 0 3220 1700 _null_ _null_ _null_ _null_ _null_ numeric_pg_lsn _null_ _null_ _null_ _null_ ) insert ( 3556 bool 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3802 _null_ _null_ _null_ _null_ _null_ jsonb_bool _null_ _null_ _null_ _null_ ) insert ( 3449 numeric 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 3802 _null_ _null_ _null_ _null_ _null_ jsonb_numeric _null_ _null_ _null_ _null_ ) insert ( 3450 int2 11 10 12 1 0 0 0 f f f t f i s 1 0 21 3802 _null_ _null_ _null_ _null_ _null_ jsonb_int2 _null_ _null_ _null_ _null_ ) insert ( 3451 int4 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3802 _null_ _null_ _null_ _null_ _null_ jsonb_int4 _null_ _null_ _null_ _null_ ) insert ( 3452 int8 11 10 12 1 0 0 0 f f f t f i s 1 0 20 3802 _null_ _null_ _null_ _null_ _null_ jsonb_int8 _null_ _null_ _null_ _null_ ) insert ( 3453 float4 11 10 12 1 0 0 0 f f f t f i s 1 0 700 3802 _null_ _null_ _null_ _null_ _null_ jsonb_float4 _null_ _null_ _null_ _null_ ) insert ( 2580 float8 11 10 12 1 0 0 0 f f f t f i s 1 0 701 3802 _null_ _null_ _null_ _null_ _null_ jsonb_float8 _null_ _null_ _null_ _null_ ) insert ( 1770 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '1184 25' _null_ _null_ _null_ _null_ _null_ timestamptz_to_char _null_ _null_ _null_ _null_ ) insert ( 1772 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '1700 25' _null_ _null_ _null_ _null_ _null_ numeric_to_char _null_ _null_ _null_ _null_ ) insert ( 1773 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '23 25' _null_ _null_ _null_ _null_ _null_ int4_to_char _null_ _null_ _null_ _null_ ) insert ( 1774 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '20 25' _null_ _null_ _null_ _null_ _null_ int8_to_char _null_ _null_ _null_ _null_ ) insert ( 1775 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '700 25' _null_ _null_ _null_ _null_ _null_ float4_to_char _null_ _null_ _null_ _null_ ) insert ( 1776 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '701 25' _null_ _null_ _null_ _null_ _null_ float8_to_char _null_ _null_ _null_ _null_ ) insert ( 1777 to_number 11 10 12 1 0 0 0 f f f t f s s 2 0 1700 '25 25' _null_ _null_ _null_ _null_ _null_ numeric_to_number _null_ _null_ _null_ _null_ ) insert ( 1778 to_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 1184 '25 25' _null_ _null_ _null_ _null_ _null_ to_timestamp _null_ _null_ _null_ _null_ ) insert ( 1780 to_date 11 10 12 1 0 0 0 f f f t f s s 2 0 1082 '25 25' _null_ _null_ _null_ _null_ _null_ to_date _null_ _null_ _null_ _null_ ) insert ( 1768 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '1186 25' _null_ _null_ _null_ _null_ _null_ interval_to_char _null_ _null_ _null_ _null_ ) insert ( 1282 quote_ident 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ quote_ident _null_ _null_ _null_ _null_ ) insert ( 1283 quote_literal 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ quote_literal _null_ _null_ _null_ _null_ ) insert ( 1285 quote_literal 11 10 14 1 0 0 0 f f f t f s s 1 0 25 2283 _null_ _null_ _null_ _null_ _null_ 'select pg_catalog.quote_literal($1::pg_catalog.text)' _null_ _null_ _null_ _null_ ) insert ( 1289 quote_nullable 11 10 12 1 0 0 0 f f f f f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ quote_nullable _null_ _null_ _null_ _null_ ) insert ( 1290 quote_nullable 11 10 14 1 0 0 0 f f f f f s s 1 0 25 2283 _null_ _null_ _null_ _null_ _null_ 'select pg_catalog.quote_nullable($1::pg_catalog.text)' _null_ _null_ _null_ _null_ ) insert ( 1798 oidin 11 10 12 1 0 0 0 f f f t f i s 1 0 26 2275 _null_ _null_ _null_ _null_ _null_ oidin _null_ _null_ _null_ _null_ ) insert ( 1799 oidout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 26 _null_ _null_ _null_ _null_ _null_ oidout _null_ _null_ _null_ _null_ ) insert ( 3058 concat 11 10 12 1 0 2276 0 f f f f f s s 1 0 25 2276 '{2276}' '{v}' _null_ _null_ _null_ text_concat _null_ _null_ _null_ _null_ ) insert ( 3059 concat_ws 11 10 12 1 0 2276 0 f f f f f s s 2 0 25 '25 2276' '{25,2276}' '{i,v}' _null_ _null_ _null_ text_concat_ws _null_ _null_ _null_ _null_ ) insert ( 3060 left 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ text_left _null_ _null_ _null_ _null_ ) insert ( 3061 right 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ text_right _null_ _null_ _null_ _null_ ) insert ( 3062 reverse 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ text_reverse _null_ _null_ _null_ _null_ ) insert ( 3539 format 11 10 12 1 0 2276 0 f f f f f s s 2 0 25 '25 2276' '{25,2276}' '{i,v}' _null_ _null_ _null_ text_format _null_ _null_ _null_ _null_ ) insert ( 3540 format 11 10 12 1 0 0 0 f f f f f s s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ text_format_nv _null_ _null_ _null_ _null_ ) insert ( 1810 bit_length 11 10 14 1 0 0 0 f f f t f i s 1 0 23 17 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1811 bit_length 11 10 14 1 0 0 0 f f f t f i s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1812 bit_length 11 10 14 1 0 0 0 f f f t f i s 1 0 23 1560 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1814 iclikesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ iclikesel _null_ _null_ _null_ _null_ ) insert ( 1815 icnlikesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ icnlikesel _null_ _null_ _null_ _null_ ) insert ( 1816 iclikejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ iclikejoinsel _null_ _null_ _null_ _null_ ) insert ( 1817 icnlikejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ icnlikejoinsel _null_ _null_ _null_ _null_ ) insert ( 1818 regexeqsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ regexeqsel _null_ _null_ _null_ _null_ ) insert ( 1819 likesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ likesel _null_ _null_ _null_ _null_ ) insert ( 1820 icregexeqsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ icregexeqsel _null_ _null_ _null_ _null_ ) insert ( 1821 regexnesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ regexnesel _null_ _null_ _null_ _null_ ) insert ( 1822 nlikesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ nlikesel _null_ _null_ _null_ _null_ ) insert ( 1823 icregexnesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ icregexnesel _null_ _null_ _null_ _null_ ) insert ( 1824 regexeqjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ regexeqjoinsel _null_ _null_ _null_ _null_ ) insert ( 1825 likejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ likejoinsel _null_ _null_ _null_ _null_ ) insert ( 1826 icregexeqjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ icregexeqjoinsel _null_ _null_ _null_ _null_ ) insert ( 1827 regexnejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ regexnejoinsel _null_ _null_ _null_ _null_ ) insert ( 1828 nlikejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ nlikejoinsel _null_ _null_ _null_ _null_ ) insert ( 1829 icregexnejoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ icregexnejoinsel _null_ _null_ _null_ _null_ ) insert ( 3437 prefixsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ prefixsel _null_ _null_ _null_ _null_ ) insert ( 3438 prefixjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ prefixjoinsel _null_ _null_ _null_ _null_ ) insert ( 1830 float8_avg 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_avg _null_ _null_ _null_ _null_ ) insert ( 2512 float8_var_pop 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_var_pop _null_ _null_ _null_ _null_ ) insert ( 1831 float8_var_samp 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_var_samp _null_ _null_ _null_ _null_ ) insert ( 2513 float8_stddev_pop 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_stddev_pop _null_ _null_ _null_ _null_ ) insert ( 1832 float8_stddev_samp 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_stddev_samp _null_ _null_ _null_ _null_ ) insert ( 1833 numeric_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 1700' _null_ _null_ _null_ _null_ _null_ numeric_accum _null_ _null_ _null_ _null_ ) insert ( 3341 numeric_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ numeric_combine _null_ _null_ _null_ _null_ ) insert ( 2858 numeric_avg_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 1700' _null_ _null_ _null_ _null_ _null_ numeric_avg_accum _null_ _null_ _null_ _null_ ) insert ( 3337 numeric_avg_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ numeric_avg_combine _null_ _null_ _null_ _null_ ) insert ( 2740 numeric_avg_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ numeric_avg_serialize _null_ _null_ _null_ _null_ ) insert ( 2741 numeric_avg_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ numeric_avg_deserialize _null_ _null_ _null_ _null_ ) insert ( 3335 numeric_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ numeric_serialize _null_ _null_ _null_ _null_ ) insert ( 3336 numeric_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ numeric_deserialize _null_ _null_ _null_ _null_ ) insert ( 3548 numeric_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 1700' _null_ _null_ _null_ _null_ _null_ numeric_accum_inv _null_ _null_ _null_ _null_ ) insert ( 1834 int2_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 21' _null_ _null_ _null_ _null_ _null_ int2_accum _null_ _null_ _null_ _null_ ) insert ( 1835 int4_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 23' _null_ _null_ _null_ _null_ _null_ int4_accum _null_ _null_ _null_ _null_ ) insert ( 1836 int8_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 20' _null_ _null_ _null_ _null_ _null_ int8_accum _null_ _null_ _null_ _null_ ) insert ( 3338 numeric_poly_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ numeric_poly_combine _null_ _null_ _null_ _null_ ) insert ( 3339 numeric_poly_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_serialize _null_ _null_ _null_ _null_ ) insert ( 3340 numeric_poly_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ numeric_poly_deserialize _null_ _null_ _null_ _null_ ) insert ( 2746 int8_avg_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 20' _null_ _null_ _null_ _null_ _null_ int8_avg_accum _null_ _null_ _null_ _null_ ) insert ( 3567 int2_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 21' _null_ _null_ _null_ _null_ _null_ int2_accum_inv _null_ _null_ _null_ _null_ ) insert ( 3568 int4_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 23' _null_ _null_ _null_ _null_ _null_ int4_accum_inv _null_ _null_ _null_ _null_ ) insert ( 3569 int8_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 20' _null_ _null_ _null_ _null_ _null_ int8_accum_inv _null_ _null_ _null_ _null_ ) insert ( 3387 int8_avg_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 20' _null_ _null_ _null_ _null_ _null_ int8_avg_accum_inv _null_ _null_ _null_ _null_ ) insert ( 2785 int8_avg_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ int8_avg_combine _null_ _null_ _null_ _null_ ) insert ( 2786 int8_avg_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ int8_avg_serialize _null_ _null_ _null_ _null_ ) insert ( 2787 int8_avg_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ int8_avg_deserialize _null_ _null_ _null_ _null_ ) insert ( 3324 int4_avg_combine 11 10 12 1 0 0 0 f f f t f i s 2 0 1016 '1016 1016' _null_ _null_ _null_ _null_ _null_ int4_avg_combine _null_ _null_ _null_ _null_ ) insert ( 3178 numeric_sum 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_sum _null_ _null_ _null_ _null_ ) insert ( 1837 numeric_avg 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_avg _null_ _null_ _null_ _null_ ) insert ( 2514 numeric_var_pop 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_var_pop _null_ _null_ _null_ _null_ ) insert ( 1838 numeric_var_samp 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_var_samp _null_ _null_ _null_ _null_ ) insert ( 2596 numeric_stddev_pop 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_stddev_pop _null_ _null_ _null_ _null_ ) insert ( 1839 numeric_stddev_samp 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_stddev_samp _null_ _null_ _null_ _null_ ) insert ( 1840 int2_sum 11 10 12 1 0 0 0 f f f f f i s 2 0 20 '20 21' _null_ _null_ _null_ _null_ _null_ int2_sum _null_ _null_ _null_ _null_ ) insert ( 1841 int4_sum 11 10 12 1 0 0 0 f f f f f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int4_sum _null_ _null_ _null_ _null_ ) insert ( 1842 int8_sum 11 10 12 1 0 0 0 f f f f f i s 2 0 1700 '1700 20' _null_ _null_ _null_ _null_ _null_ int8_sum _null_ _null_ _null_ _null_ ) insert ( 3388 numeric_poly_sum 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_sum _null_ _null_ _null_ _null_ ) insert ( 3389 numeric_poly_avg 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_avg _null_ _null_ _null_ _null_ ) insert ( 3390 numeric_poly_var_pop 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_var_pop _null_ _null_ _null_ _null_ ) insert ( 3391 numeric_poly_var_samp 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_var_samp _null_ _null_ _null_ _null_ ) insert ( 3392 numeric_poly_stddev_pop 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_stddev_pop _null_ _null_ _null_ _null_ ) insert ( 3393 numeric_poly_stddev_samp 11 10 12 1 0 0 0 f f f f f i s 1 0 1700 2281 _null_ _null_ _null_ _null_ _null_ numeric_poly_stddev_samp _null_ _null_ _null_ _null_ ) insert ( 1843 interval_avg_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 1186' _null_ _null_ _null_ _null_ _null_ interval_avg_accum _null_ _null_ _null_ _null_ ) insert ( 3325 interval_avg_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ interval_avg_combine _null_ _null_ _null_ _null_ ) insert ( 3549 interval_avg_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 1186' _null_ _null_ _null_ _null_ _null_ interval_avg_accum_inv _null_ _null_ _null_ _null_ ) insert ( 6324 interval_avg_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ interval_avg_serialize _null_ _null_ _null_ _null_ ) insert ( 6325 interval_avg_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ interval_avg_deserialize _null_ _null_ _null_ _null_ ) insert ( 1844 interval_avg 11 10 12 1 0 0 0 f f f f f i s 1 0 1186 2281 _null_ _null_ _null_ _null_ _null_ interval_avg _null_ _null_ _null_ _null_ ) insert ( 6326 interval_sum 11 10 12 1 0 0 0 f f f f f i s 1 0 1186 2281 _null_ _null_ _null_ _null_ _null_ interval_sum _null_ _null_ _null_ _null_ ) insert ( 1962 int2_avg_accum 11 10 12 1 0 0 0 f f f t f i s 2 0 1016 '1016 21' _null_ _null_ _null_ _null_ _null_ int2_avg_accum _null_ _null_ _null_ _null_ ) insert ( 1963 int4_avg_accum 11 10 12 1 0 0 0 f f f t f i s 2 0 1016 '1016 23' _null_ _null_ _null_ _null_ _null_ int4_avg_accum _null_ _null_ _null_ _null_ ) insert ( 3570 int2_avg_accum_inv 11 10 12 1 0 0 0 f f f t f i s 2 0 1016 '1016 21' _null_ _null_ _null_ _null_ _null_ int2_avg_accum_inv _null_ _null_ _null_ _null_ ) insert ( 3571 int4_avg_accum_inv 11 10 12 1 0 0 0 f f f t f i s 2 0 1016 '1016 23' _null_ _null_ _null_ _null_ _null_ int4_avg_accum_inv _null_ _null_ _null_ _null_ ) insert ( 1964 int8_avg 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1016 _null_ _null_ _null_ _null_ _null_ int8_avg _null_ _null_ _null_ _null_ ) insert ( 3572 int2int4_sum 11 10 12 1 0 0 0 f f f t f i s 1 0 20 1016 _null_ _null_ _null_ _null_ _null_ int2int4_sum _null_ _null_ _null_ _null_ ) insert ( 2805 int8inc_float8_float8 11 10 12 1 0 0 0 f f f t f i s 3 0 20 '20 701 701' _null_ _null_ _null_ _null_ _null_ int8inc_float8_float8 _null_ _null_ _null_ _null_ ) insert ( 2806 float8_regr_accum 11 10 12 1 0 0 0 f f f t f i s 3 0 1022 '1022 701 701' _null_ _null_ _null_ _null_ _null_ float8_regr_accum _null_ _null_ _null_ _null_ ) insert ( 3342 float8_regr_combine 11 10 12 1 0 0 0 f f f t f i s 2 0 1022 '1022 1022' _null_ _null_ _null_ _null_ _null_ float8_regr_combine _null_ _null_ _null_ _null_ ) insert ( 2807 float8_regr_sxx 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_sxx _null_ _null_ _null_ _null_ ) insert ( 2808 float8_regr_syy 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_syy _null_ _null_ _null_ _null_ ) insert ( 2809 float8_regr_sxy 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_sxy _null_ _null_ _null_ _null_ ) insert ( 2810 float8_regr_avgx 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_avgx _null_ _null_ _null_ _null_ ) insert ( 2811 float8_regr_avgy 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_avgy _null_ _null_ _null_ _null_ ) insert ( 2812 float8_regr_r2 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_r2 _null_ _null_ _null_ _null_ ) insert ( 2813 float8_regr_slope 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_slope _null_ _null_ _null_ _null_ ) insert ( 2814 float8_regr_intercept 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_regr_intercept _null_ _null_ _null_ _null_ ) insert ( 2815 float8_covar_pop 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_covar_pop _null_ _null_ _null_ _null_ ) insert ( 2816 float8_covar_samp 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_covar_samp _null_ _null_ _null_ _null_ ) insert ( 2817 float8_corr 11 10 12 1 0 0 0 f f f t f i s 1 0 701 1022 _null_ _null_ _null_ _null_ _null_ float8_corr _null_ _null_ _null_ _null_ ) insert ( 3535 string_agg_transfn 11 10 12 1 0 0 0 f f f f f i s 3 0 2281 '2281 25 25' _null_ _null_ _null_ _null_ _null_ string_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6299 string_agg_combine 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ string_agg_combine _null_ _null_ _null_ _null_ ) insert ( 6300 string_agg_serialize 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ string_agg_serialize _null_ _null_ _null_ _null_ ) insert ( 6301 string_agg_deserialize 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '17 2281' _null_ _null_ _null_ _null_ _null_ string_agg_deserialize _null_ _null_ _null_ _null_ ) insert ( 3536 string_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 1 0 25 2281 _null_ _null_ _null_ _null_ _null_ string_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3538 string_agg 11 10 12 1 0 0 0 a f f f f i s 2 0 25 '25 25' _null_ _null_ '{value,delimiter}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3543 bytea_string_agg_transfn 11 10 12 1 0 0 0 f f f f f i s 3 0 2281 '2281 17 17' _null_ _null_ _null_ _null_ _null_ bytea_string_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 3544 bytea_string_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ bytea_string_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3545 string_agg 11 10 12 1 0 0 0 a f f f f i s 2 0 17 '17 17' _null_ _null_ '{value,delimiter}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 1845 to_ascii 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ to_ascii_default _null_ _null_ _null_ _null_ ) insert ( 1846 to_ascii 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 23' _null_ _null_ _null_ _null_ _null_ to_ascii_enc _null_ _null_ _null_ _null_ ) insert ( 1847 to_ascii 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 19' _null_ _null_ _null_ _null_ _null_ to_ascii_encname _null_ _null_ _null_ _null_ ) insert ( 1848 interval_pl_time 11 10 14 1 0 0 0 f f f t f i s 2 0 1083 '1186 1083' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 1850 int28eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28eq _null_ _null_ _null_ _null_ ) insert ( 1851 int28ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28ne _null_ _null_ _null_ _null_ ) insert ( 1852 int28lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28lt _null_ _null_ _null_ _null_ ) insert ( 1853 int28gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28gt _null_ _null_ _null_ _null_ ) insert ( 1854 int28le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28le _null_ _null_ _null_ _null_ ) insert ( 1855 int28ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '21 20' _null_ _null_ _null_ _null_ _null_ int28ge _null_ _null_ _null_ _null_ ) insert ( 1856 int82eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82eq _null_ _null_ _null_ _null_ ) insert ( 1857 int82ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82ne _null_ _null_ _null_ _null_ ) insert ( 1858 int82lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82lt _null_ _null_ _null_ _null_ ) insert ( 1859 int82gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82gt _null_ _null_ _null_ _null_ ) insert ( 1860 int82le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82le _null_ _null_ _null_ _null_ ) insert ( 1861 int82ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '20 21' _null_ _null_ _null_ _null_ _null_ int82ge _null_ _null_ _null_ _null_ ) insert ( 1892 int2and 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2and _null_ _null_ _null_ _null_ ) insert ( 1893 int2or 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2or _null_ _null_ _null_ _null_ ) insert ( 1894 int2xor 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 21' _null_ _null_ _null_ _null_ _null_ int2xor _null_ _null_ _null_ _null_ ) insert ( 1895 int2not 11 10 12 1 0 0 0 f f f t f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ int2not _null_ _null_ _null_ _null_ ) insert ( 1896 int2shl 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 23' _null_ _null_ _null_ _null_ _null_ int2shl _null_ _null_ _null_ _null_ ) insert ( 1897 int2shr 11 10 12 1 0 0 0 f f f t f i s 2 0 21 '21 23' _null_ _null_ _null_ _null_ _null_ int2shr _null_ _null_ _null_ _null_ ) insert ( 1898 int4and 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4and _null_ _null_ _null_ _null_ ) insert ( 1899 int4or 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4or _null_ _null_ _null_ _null_ ) insert ( 1900 int4xor 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4xor _null_ _null_ _null_ _null_ ) insert ( 1901 int4not 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4not _null_ _null_ _null_ _null_ ) insert ( 1902 int4shl 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4shl _null_ _null_ _null_ _null_ ) insert ( 1903 int4shr 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ int4shr _null_ _null_ _null_ _null_ ) insert ( 1904 int8and 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8and _null_ _null_ _null_ _null_ ) insert ( 1905 int8or 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8or _null_ _null_ _null_ _null_ ) insert ( 1906 int8xor 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ int8xor _null_ _null_ _null_ _null_ ) insert ( 1907 int8not 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8not _null_ _null_ _null_ _null_ ) insert ( 1908 int8shl 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int8shl _null_ _null_ _null_ _null_ ) insert ( 1909 int8shr 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '20 23' _null_ _null_ _null_ _null_ _null_ int8shr _null_ _null_ _null_ _null_ ) insert ( 1910 int8up 11 10 12 1 0 0 0 f f f t f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ int8up _null_ _null_ _null_ _null_ ) insert ( 1911 int2up 11 10 12 1 0 0 0 f f f t f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ int2up _null_ _null_ _null_ _null_ ) insert ( 1912 int4up 11 10 12 1 0 0 0 f f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ int4up _null_ _null_ _null_ _null_ ) insert ( 1913 float4up 11 10 12 1 0 0 0 f f f t f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ float4up _null_ _null_ _null_ _null_ ) insert ( 1914 float8up 11 10 12 1 0 0 0 f f f t f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ float8up _null_ _null_ _null_ _null_ ) insert ( 1915 numeric_uplus 11 10 12 1 0 0 0 f f f t f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ numeric_uplus _null_ _null_ _null_ _null_ ) insert ( 1922 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 1923 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 1924 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 1925 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 1926 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_name _null_ _null_ _null_ _null_ ) insert ( 1927 has_table_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_table_privilege_id _null_ _null_ _null_ _null_ ) insert ( 2181 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2182 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2183 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2184 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2185 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2186 has_sequence_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_sequence_privilege_id _null_ _null_ _null_ _null_ ) insert ( 3012 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '19 25 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_name_name _null_ _null_ _null_ _null_ ) insert ( 3013 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '19 25 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_name_attnum _null_ _null_ _null_ _null_ ) insert ( 3014 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '19 26 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_id_name _null_ _null_ _null_ _null_ ) insert ( 3015 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '19 26 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_id_attnum _null_ _null_ _null_ _null_ ) insert ( 3016 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '26 25 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_name_name _null_ _null_ _null_ _null_ ) insert ( 3017 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '26 25 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_name_attnum _null_ _null_ _null_ _null_ ) insert ( 3018 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '26 26 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_id_name _null_ _null_ _null_ _null_ ) insert ( 3019 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '26 26 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_id_attnum _null_ _null_ _null_ _null_ ) insert ( 3020 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '25 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 3021 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '25 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_name_attnum _null_ _null_ _null_ _null_ ) insert ( 3022 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 3023 has_column_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 21 25' _null_ _null_ _null_ _null_ _null_ has_column_privilege_id_attnum _null_ _null_ _null_ _null_ ) insert ( 3024 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 3025 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 3026 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 3027 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 3028 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_name _null_ _null_ _null_ _null_ ) insert ( 3029 has_any_column_privilege 11 10 12 10 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_any_column_privilege_id _null_ _null_ _null_ _null_ ) insert ( 3355 pg_ndistinct_in 11 10 12 1 0 0 0 f f f t f i s 1 0 3361 2275 _null_ _null_ _null_ _null_ _null_ pg_ndistinct_in _null_ _null_ _null_ _null_ ) insert ( 3356 pg_ndistinct_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3361 _null_ _null_ _null_ _null_ _null_ pg_ndistinct_out _null_ _null_ _null_ _null_ ) insert ( 3357 pg_ndistinct_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 3361 2281 _null_ _null_ _null_ _null_ _null_ pg_ndistinct_recv _null_ _null_ _null_ _null_ ) insert ( 3358 pg_ndistinct_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 3361 _null_ _null_ _null_ _null_ _null_ pg_ndistinct_send _null_ _null_ _null_ _null_ ) insert ( 3404 pg_dependencies_in 11 10 12 1 0 0 0 f f f t f i s 1 0 3402 2275 _null_ _null_ _null_ _null_ _null_ pg_dependencies_in _null_ _null_ _null_ _null_ ) insert ( 3405 pg_dependencies_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3402 _null_ _null_ _null_ _null_ _null_ pg_dependencies_out _null_ _null_ _null_ _null_ ) insert ( 3406 pg_dependencies_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 3402 2281 _null_ _null_ _null_ _null_ _null_ pg_dependencies_recv _null_ _null_ _null_ _null_ ) insert ( 3407 pg_dependencies_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 3402 _null_ _null_ _null_ _null_ _null_ pg_dependencies_send _null_ _null_ _null_ _null_ ) insert ( 5018 pg_mcv_list_in 11 10 12 1 0 0 0 f f f t f i s 1 0 5017 2275 _null_ _null_ _null_ _null_ _null_ pg_mcv_list_in _null_ _null_ _null_ _null_ ) insert ( 5019 pg_mcv_list_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 5017 _null_ _null_ _null_ _null_ _null_ pg_mcv_list_out _null_ _null_ _null_ _null_ ) insert ( 5020 pg_mcv_list_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 5017 2281 _null_ _null_ _null_ _null_ _null_ pg_mcv_list_recv _null_ _null_ _null_ _null_ ) insert ( 5021 pg_mcv_list_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 5017 _null_ _null_ _null_ _null_ _null_ pg_mcv_list_send _null_ _null_ _null_ _null_ ) insert ( 3427 pg_mcv_list_items 11 10 12 1 1000 0 0 f f f t t s s 1 0 2249 5017 '{5017,23,1009,1000,701,701}' '{i,o,o,o,o,o}' '{mcv_list,index,values,nulls,frequency,base_frequency}' _null_ _null_ pg_stats_ext_mcvlist_items _null_ _null_ _null_ _null_ ) insert ( 1928 pg_stat_get_numscans 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_numscans _null_ _null_ _null_ _null_ ) insert ( 6310 pg_stat_get_lastscan 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_lastscan _null_ _null_ _null_ _null_ ) insert ( 1929 pg_stat_get_tuples_returned 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_returned _null_ _null_ _null_ _null_ ) insert ( 1930 pg_stat_get_tuples_fetched 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_fetched _null_ _null_ _null_ _null_ ) insert ( 1931 pg_stat_get_tuples_inserted 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_inserted _null_ _null_ _null_ _null_ ) insert ( 1932 pg_stat_get_tuples_updated 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_updated _null_ _null_ _null_ _null_ ) insert ( 1933 pg_stat_get_tuples_deleted 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_deleted _null_ _null_ _null_ _null_ ) insert ( 1972 pg_stat_get_tuples_hot_updated 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_hot_updated _null_ _null_ _null_ _null_ ) insert ( 6217 pg_stat_get_tuples_newpage_updated 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_tuples_newpage_updated _null_ _null_ _null_ _null_ ) insert ( 2878 pg_stat_get_live_tuples 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_live_tuples _null_ _null_ _null_ _null_ ) insert ( 2879 pg_stat_get_dead_tuples 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_dead_tuples _null_ _null_ _null_ _null_ ) insert ( 3177 pg_stat_get_mod_since_analyze 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_mod_since_analyze _null_ _null_ _null_ _null_ ) insert ( 5053 pg_stat_get_ins_since_vacuum 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_ins_since_vacuum _null_ _null_ _null_ _null_ ) insert ( 1934 pg_stat_get_blocks_fetched 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_blocks_fetched _null_ _null_ _null_ _null_ ) insert ( 1935 pg_stat_get_blocks_hit 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_blocks_hit _null_ _null_ _null_ _null_ ) insert ( 2781 pg_stat_get_last_vacuum_time 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_last_vacuum_time _null_ _null_ _null_ _null_ ) insert ( 2782 pg_stat_get_last_autovacuum_time 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_last_autovacuum_time _null_ _null_ _null_ _null_ ) insert ( 2783 pg_stat_get_last_analyze_time 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_last_analyze_time _null_ _null_ _null_ _null_ ) insert ( 2784 pg_stat_get_last_autoanalyze_time 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_last_autoanalyze_time _null_ _null_ _null_ _null_ ) insert ( 3054 pg_stat_get_vacuum_count 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_vacuum_count _null_ _null_ _null_ _null_ ) insert ( 3055 pg_stat_get_autovacuum_count 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_autovacuum_count _null_ _null_ _null_ _null_ ) insert ( 3056 pg_stat_get_analyze_count 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_analyze_count _null_ _null_ _null_ _null_ ) insert ( 3057 pg_stat_get_autoanalyze_count 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_autoanalyze_count _null_ _null_ _null_ _null_ ) insert ( 1936 pg_stat_get_backend_idset 11 10 12 1 100 0 0 f f f t t s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_idset _null_ _null_ _null_ _null_ ) insert ( 2022 pg_stat_get_activity 11 10 12 1 100 0 0 f f f f t s r 1 0 2249 23 '{23,26,23,26,25,25,25,25,25,1184,1184,1184,1184,869,25,23,28,28,25,16,25,25,23,25,1700,25,16,25,16,16,23,20}' '{i,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{pid,datid,pid,usesysid,application_name,state,query,wait_event_type,wait_event,xact_start,query_start,backend_start,state_change,client_addr,client_hostname,client_port,backend_xid,backend_xmin,backend_type,ssl,sslversion,sslcipher,sslbits,ssl_client_dn,ssl_client_serial,ssl_issuer_dn,gss_auth,gss_princ,gss_enc,gss_delegation,leader_pid,query_id}' _null_ _null_ pg_stat_get_activity _null_ _null_ _null_ _null_ ) insert ( 6318 pg_get_wait_events 11 10 12 10 250 0 0 f f f t t v s 0 0 2249 '' '{25,25,25}' '{o,o,o}' '{type,name,description}' _null_ _null_ pg_get_wait_events _null_ _null_ _null_ _null_ ) insert ( 3318 pg_stat_get_progress_info 11 10 12 1 100 0 0 f f f t t s r 1 0 2249 25 '{25,23,26,26,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20,20}' '{i,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{cmdtype,pid,datid,relid,param1,param2,param3,param4,param5,param6,param7,param8,param9,param10,param11,param12,param13,param14,param15,param16,param17,param18,param19,param20}' _null_ _null_ pg_stat_get_progress_info _null_ _null_ _null_ _null_ ) insert ( 3099 pg_stat_get_wal_senders 11 10 12 1 10 0 0 f f f f t s r 0 0 2249 '' '{23,25,3220,3220,3220,3220,1186,1186,1186,23,25,1184}' '{o,o,o,o,o,o,o,o,o,o,o,o}' '{pid,state,sent_lsn,write_lsn,flush_lsn,replay_lsn,write_lag,flush_lag,replay_lag,sync_priority,sync_state,reply_time}' _null_ _null_ pg_stat_get_wal_senders _null_ _null_ _null_ _null_ ) insert ( 3317 pg_stat_get_wal_receiver 11 10 12 1 0 0 0 f f f f f s r 0 0 2249 '' '{23,25,3220,23,3220,3220,23,1184,1184,3220,1184,25,25,23,25}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{pid,status,receive_start_lsn,receive_start_tli,written_lsn,flushed_lsn,received_tli,last_msg_send_time,last_msg_receipt_time,latest_end_lsn,latest_end_time,slot_name,sender_host,sender_port,conninfo}' _null_ _null_ pg_stat_get_wal_receiver _null_ _null_ _null_ _null_ ) insert ( 6169 pg_stat_get_replication_slot 11 10 12 1 0 0 0 f f f t f s r 1 0 2249 25 '{25,25,20,20,20,20,20,20,20,20,1184}' '{i,o,o,o,o,o,o,o,o,o,o}' '{slot_name,slot_name,spill_txns,spill_count,spill_bytes,stream_txns,stream_count,stream_bytes,total_txns,total_bytes,stats_reset}' _null_ _null_ pg_stat_get_replication_slot _null_ _null_ _null_ _null_ ) insert ( 6230 pg_stat_have_stats 11 10 12 1 0 0 0 f f f t f v r 3 0 16 '25 26 26' _null_ _null_ _null_ _null_ _null_ pg_stat_have_stats _null_ _null_ _null_ _null_ ) insert ( 6231 pg_stat_get_subscription_stats 11 10 12 1 0 0 0 f f f t f s r 1 0 2249 26 '{26,26,20,20,1184}' '{i,o,o,o,o}' '{subid,subid,apply_error_count,sync_error_count,stats_reset}' _null_ _null_ pg_stat_get_subscription_stats _null_ _null_ _null_ _null_ ) insert ( 6118 pg_stat_get_subscription 11 10 12 1 10 0 0 f f f f t s r 1 0 2249 26 '{26,26,26,23,23,3220,1184,1184,3220,1184,25}' '{i,o,o,o,o,o,o,o,o,o,o}' '{subid,subid,relid,pid,leader_pid,received_lsn,last_msg_send_time,last_msg_receipt_time,latest_end_lsn,latest_end_time,worker_type}' _null_ _null_ pg_stat_get_subscription _null_ _null_ _null_ _null_ ) insert ( 2026 pg_backend_pid 11 10 12 1 0 0 0 f f f t f s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ pg_backend_pid _null_ _null_ _null_ _null_ ) insert ( 1937 pg_stat_get_backend_pid 11 10 12 1 0 0 0 f f f t f s r 1 0 23 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_pid _null_ _null_ _null_ _null_ ) insert ( 1938 pg_stat_get_backend_dbid 11 10 12 1 0 0 0 f f f t f s r 1 0 26 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_dbid _null_ _null_ _null_ _null_ ) insert ( 6107 pg_stat_get_backend_subxact 11 10 12 1 0 0 0 f f f t f s r 1 0 2249 23 '{23,23,16}' '{i,o,o}' '{bid,subxact_count,subxact_overflowed}' _null_ _null_ pg_stat_get_backend_subxact _null_ _null_ _null_ _null_ ) insert ( 1939 pg_stat_get_backend_userid 11 10 12 1 0 0 0 f f f t f s r 1 0 26 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_userid _null_ _null_ _null_ _null_ ) insert ( 1940 pg_stat_get_backend_activity 11 10 12 1 0 0 0 f f f t f s r 1 0 25 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_activity _null_ _null_ _null_ _null_ ) insert ( 2788 pg_stat_get_backend_wait_event_type 11 10 12 1 0 0 0 f f f t f s r 1 0 25 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_wait_event_type _null_ _null_ _null_ _null_ ) insert ( 2853 pg_stat_get_backend_wait_event 11 10 12 1 0 0 0 f f f t f s r 1 0 25 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_wait_event _null_ _null_ _null_ _null_ ) insert ( 2094 pg_stat_get_backend_activity_start 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_activity_start _null_ _null_ _null_ _null_ ) insert ( 2857 pg_stat_get_backend_xact_start 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_xact_start _null_ _null_ _null_ _null_ ) insert ( 1391 pg_stat_get_backend_start 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_start _null_ _null_ _null_ _null_ ) insert ( 1392 pg_stat_get_backend_client_addr 11 10 12 1 0 0 0 f f f t f s r 1 0 869 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_client_addr _null_ _null_ _null_ _null_ ) insert ( 1393 pg_stat_get_backend_client_port 11 10 12 1 0 0 0 f f f t f s r 1 0 23 23 _null_ _null_ _null_ _null_ _null_ pg_stat_get_backend_client_port _null_ _null_ _null_ _null_ ) insert ( 1941 pg_stat_get_db_numbackends 11 10 12 1 0 0 0 f f f t f s r 1 0 23 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_numbackends _null_ _null_ _null_ _null_ ) insert ( 1942 pg_stat_get_db_xact_commit 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_xact_commit _null_ _null_ _null_ _null_ ) insert ( 1943 pg_stat_get_db_xact_rollback 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_xact_rollback _null_ _null_ _null_ _null_ ) insert ( 1944 pg_stat_get_db_blocks_fetched 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_blocks_fetched _null_ _null_ _null_ _null_ ) insert ( 1945 pg_stat_get_db_blocks_hit 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_blocks_hit _null_ _null_ _null_ _null_ ) insert ( 2758 pg_stat_get_db_tuples_returned 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_tuples_returned _null_ _null_ _null_ _null_ ) insert ( 2759 pg_stat_get_db_tuples_fetched 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_tuples_fetched _null_ _null_ _null_ _null_ ) insert ( 2760 pg_stat_get_db_tuples_inserted 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_tuples_inserted _null_ _null_ _null_ _null_ ) insert ( 2761 pg_stat_get_db_tuples_updated 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_tuples_updated _null_ _null_ _null_ _null_ ) insert ( 2762 pg_stat_get_db_tuples_deleted 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_tuples_deleted _null_ _null_ _null_ _null_ ) insert ( 3065 pg_stat_get_db_conflict_tablespace 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_tablespace _null_ _null_ _null_ _null_ ) insert ( 3066 pg_stat_get_db_conflict_lock 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_lock _null_ _null_ _null_ _null_ ) insert ( 3067 pg_stat_get_db_conflict_snapshot 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_snapshot _null_ _null_ _null_ _null_ ) insert ( 6309 pg_stat_get_db_conflict_logicalslot 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_logicalslot _null_ _null_ _null_ _null_ ) insert ( 3068 pg_stat_get_db_conflict_bufferpin 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_bufferpin _null_ _null_ _null_ _null_ ) insert ( 3069 pg_stat_get_db_conflict_startup_deadlock 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_startup_deadlock _null_ _null_ _null_ _null_ ) insert ( 3070 pg_stat_get_db_conflict_all 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_conflict_all _null_ _null_ _null_ _null_ ) insert ( 3152 pg_stat_get_db_deadlocks 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_deadlocks _null_ _null_ _null_ _null_ ) insert ( 3426 pg_stat_get_db_checksum_failures 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_checksum_failures _null_ _null_ _null_ _null_ ) insert ( 3428 pg_stat_get_db_checksum_last_failure 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_checksum_last_failure _null_ _null_ _null_ _null_ ) insert ( 3074 pg_stat_get_db_stat_reset_time 11 10 12 1 0 0 0 f f f t f s r 1 0 1184 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_stat_reset_time _null_ _null_ _null_ _null_ ) insert ( 3150 pg_stat_get_db_temp_files 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_temp_files _null_ _null_ _null_ _null_ ) insert ( 3151 pg_stat_get_db_temp_bytes 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_temp_bytes _null_ _null_ _null_ _null_ ) insert ( 2844 pg_stat_get_db_blk_read_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_blk_read_time _null_ _null_ _null_ _null_ ) insert ( 2845 pg_stat_get_db_blk_write_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_blk_write_time _null_ _null_ _null_ _null_ ) insert ( 6185 pg_stat_get_db_session_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_session_time _null_ _null_ _null_ _null_ ) insert ( 6186 pg_stat_get_db_active_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_active_time _null_ _null_ _null_ _null_ ) insert ( 6187 pg_stat_get_db_idle_in_transaction_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_idle_in_transaction_time _null_ _null_ _null_ _null_ ) insert ( 6188 pg_stat_get_db_sessions 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_sessions _null_ _null_ _null_ _null_ ) insert ( 6189 pg_stat_get_db_sessions_abandoned 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_sessions_abandoned _null_ _null_ _null_ _null_ ) insert ( 6190 pg_stat_get_db_sessions_fatal 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_sessions_fatal _null_ _null_ _null_ _null_ ) insert ( 6191 pg_stat_get_db_sessions_killed 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_db_sessions_killed _null_ _null_ _null_ _null_ ) insert ( 3195 pg_stat_get_archiver 11 10 12 1 0 0 0 f f f f f s r 0 0 2249 '' '{20,25,1184,20,25,1184,1184}' '{o,o,o,o,o,o,o}' '{archived_count,last_archived_wal,last_archived_time,failed_count,last_failed_wal,last_failed_time,stats_reset}' _null_ _null_ pg_stat_get_archiver _null_ _null_ _null_ _null_ ) insert ( 2769 pg_stat_get_checkpointer_num_timed 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_num_timed _null_ _null_ _null_ _null_ ) insert ( 2770 pg_stat_get_checkpointer_num_requested 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_num_requested _null_ _null_ _null_ _null_ ) insert ( 6327 pg_stat_get_checkpointer_restartpoints_timed 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_restartpoints_timed _null_ _null_ _null_ _null_ ) insert ( 6328 pg_stat_get_checkpointer_restartpoints_requested 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_restartpoints_requested _null_ _null_ _null_ _null_ ) insert ( 6329 pg_stat_get_checkpointer_restartpoints_performed 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_restartpoints_performed _null_ _null_ _null_ _null_ ) insert ( 2771 pg_stat_get_checkpointer_buffers_written 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_buffers_written _null_ _null_ _null_ _null_ ) insert ( 6314 pg_stat_get_checkpointer_stat_reset_time 11 10 12 1 0 0 0 f f f t f s r 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_stat_reset_time _null_ _null_ _null_ _null_ ) insert ( 2772 pg_stat_get_bgwriter_buf_written_clean 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_bgwriter_buf_written_clean _null_ _null_ _null_ _null_ ) insert ( 2773 pg_stat_get_bgwriter_maxwritten_clean 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_bgwriter_maxwritten_clean _null_ _null_ _null_ _null_ ) insert ( 3075 pg_stat_get_bgwriter_stat_reset_time 11 10 12 1 0 0 0 f f f t f s r 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_bgwriter_stat_reset_time _null_ _null_ _null_ _null_ ) insert ( 3160 pg_stat_get_checkpointer_write_time 11 10 12 1 0 0 0 f f f t f s r 0 0 701 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_write_time _null_ _null_ _null_ _null_ ) insert ( 3161 pg_stat_get_checkpointer_sync_time 11 10 12 1 0 0 0 f f f t f s r 0 0 701 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_checkpointer_sync_time _null_ _null_ _null_ _null_ ) insert ( 2859 pg_stat_get_buf_alloc 11 10 12 1 0 0 0 f f f t f s r 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_buf_alloc _null_ _null_ _null_ _null_ ) insert ( 6214 pg_stat_get_io 11 10 12 1 30 0 0 f f f t t v r 0 0 2249 '' '{25,25,25,20,701,20,701,20,701,20,701,20,20,20,20,20,701,1184}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{backend_type,object,context,reads,read_time,writes,write_time,writebacks,writeback_time,extends,extend_time,op_bytes,hits,evictions,reuses,fsyncs,fsync_time,stats_reset}' _null_ _null_ pg_stat_get_io _null_ _null_ _null_ _null_ ) insert ( 1136 pg_stat_get_wal 11 10 12 1 0 0 0 f f f f f s r 0 0 2249 '' '{20,20,1700,20,20,20,701,701,1184}' '{o,o,o,o,o,o,o,o,o}' '{wal_records,wal_fpi,wal_bytes,wal_buffers_full,wal_write,wal_sync,wal_write_time,wal_sync_time,stats_reset}' _null_ _null_ pg_stat_get_wal _null_ _null_ _null_ _null_ ) insert ( 6248 pg_stat_get_recovery_prefetch 11 10 12 1 1 0 0 f f f t t v s 0 0 2249 '' '{1184,20,20,20,20,20,20,23,23,23}' '{o,o,o,o,o,o,o,o,o,o}' '{stats_reset,prefetch,hit,skip_init,skip_new,skip_fpw,skip_rep,wal_distance,block_distance,io_depth}' _null_ _null_ pg_stat_get_recovery_prefetch _null_ _null_ _null_ _null_ ) insert ( 2306 pg_stat_get_slru 11 10 12 1 100 0 0 f f f f t s r 0 0 2249 '' '{25,20,20,20,20,20,20,20,1184}' '{o,o,o,o,o,o,o,o,o}' '{name,blks_zeroed,blks_hit,blks_read,blks_written,blks_exists,flushes,truncates,stats_reset}' _null_ _null_ pg_stat_get_slru _null_ _null_ _null_ _null_ ) insert ( 2978 pg_stat_get_function_calls 11 10 12 1 0 0 0 f f f t f s r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_function_calls _null_ _null_ _null_ _null_ ) insert ( 2979 pg_stat_get_function_total_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_function_total_time _null_ _null_ _null_ _null_ ) insert ( 2980 pg_stat_get_function_self_time 11 10 12 1 0 0 0 f f f t f s r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_function_self_time _null_ _null_ _null_ _null_ ) insert ( 3037 pg_stat_get_xact_numscans 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_numscans _null_ _null_ _null_ _null_ ) insert ( 3038 pg_stat_get_xact_tuples_returned 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_returned _null_ _null_ _null_ _null_ ) insert ( 3039 pg_stat_get_xact_tuples_fetched 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_fetched _null_ _null_ _null_ _null_ ) insert ( 3040 pg_stat_get_xact_tuples_inserted 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_inserted _null_ _null_ _null_ _null_ ) insert ( 3041 pg_stat_get_xact_tuples_updated 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_updated _null_ _null_ _null_ _null_ ) insert ( 3042 pg_stat_get_xact_tuples_deleted 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_deleted _null_ _null_ _null_ _null_ ) insert ( 3043 pg_stat_get_xact_tuples_hot_updated 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_hot_updated _null_ _null_ _null_ _null_ ) insert ( 6218 pg_stat_get_xact_tuples_newpage_updated 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_tuples_newpage_updated _null_ _null_ _null_ _null_ ) insert ( 3044 pg_stat_get_xact_blocks_fetched 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_blocks_fetched _null_ _null_ _null_ _null_ ) insert ( 3045 pg_stat_get_xact_blocks_hit 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_blocks_hit _null_ _null_ _null_ _null_ ) insert ( 3046 pg_stat_get_xact_function_calls 11 10 12 1 0 0 0 f f f t f v r 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_function_calls _null_ _null_ _null_ _null_ ) insert ( 3047 pg_stat_get_xact_function_total_time 11 10 12 1 0 0 0 f f f t f v r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_function_total_time _null_ _null_ _null_ _null_ ) insert ( 3048 pg_stat_get_xact_function_self_time 11 10 12 1 0 0 0 f f f t f v r 1 0 701 26 _null_ _null_ _null_ _null_ _null_ pg_stat_get_xact_function_self_time _null_ _null_ _null_ _null_ ) insert ( 3788 pg_stat_get_snapshot_timestamp 11 10 12 1 0 0 0 f f f t f s r 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_stat_get_snapshot_timestamp _null_ _null_ _null_ _null_ ) insert ( 2230 pg_stat_clear_snapshot 11 10 12 1 0 0 0 f f f f f v r 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_stat_clear_snapshot _null_ _null_ _null_ _null_ ) insert ( 2137 pg_stat_force_next_flush 11 10 12 1 0 0 0 f f f f f v r 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_stat_force_next_flush _null_ _null_ _null_ _null_ ) insert ( 2274 pg_stat_reset 11 10 12 1 0 0 0 f f f f f v s 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_stat_reset _null_ _null_ _null_ _null_ ) insert ( 3775 pg_stat_reset_shared 11 10 12 1 0 0 0 f f f f f v s 1 0 2278 25 _null_ _null_ _null_ _null_ _null_ pg_stat_reset_shared _null_ _null_ _null_ _null_ ) insert ( 3776 pg_stat_reset_single_table_counters 11 10 12 1 0 0 0 f f f t f v s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ pg_stat_reset_single_table_counters _null_ _null_ _null_ _null_ ) insert ( 3777 pg_stat_reset_single_function_counters 11 10 12 1 0 0 0 f f f t f v s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ pg_stat_reset_single_function_counters _null_ _null_ _null_ _null_ ) insert ( 2307 pg_stat_reset_slru 11 10 12 1 0 0 0 f f f f f v s 1 0 2278 25 _null_ _null_ '{target}' _null_ _null_ pg_stat_reset_slru _null_ _null_ _null_ _null_ ) insert ( 6170 pg_stat_reset_replication_slot 11 10 12 1 0 0 0 f f f f f v s 1 0 2278 25 _null_ _null_ _null_ _null_ _null_ pg_stat_reset_replication_slot _null_ _null_ _null_ _null_ ) insert ( 6232 pg_stat_reset_subscription_stats 11 10 12 1 0 0 0 f f f f f v s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ pg_stat_reset_subscription_stats _null_ _null_ _null_ _null_ ) insert ( 3163 pg_trigger_depth 11 10 12 1 0 0 0 f f f t f s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ pg_trigger_depth _null_ _null_ _null_ _null_ ) insert ( 3778 pg_tablespace_location 11 10 12 1 0 0 0 f f f t f s s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_tablespace_location _null_ _null_ _null_ _null_ ) insert ( 1946 encode 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '17 25' _null_ _null_ _null_ _null_ _null_ binary_encode _null_ _null_ _null_ _null_ ) insert ( 1947 decode 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '25 25' _null_ _null_ _null_ _null_ _null_ binary_decode _null_ _null_ _null_ _null_ ) insert ( 1948 byteaeq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteaeq _null_ _null_ _null_ _null_ ) insert ( 1949 bytealt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ bytealt _null_ _null_ _null_ _null_ ) insert ( 1950 byteale 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteale _null_ _null_ _null_ _null_ ) insert ( 1951 byteagt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteagt _null_ _null_ _null_ _null_ ) insert ( 1952 byteage 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteage _null_ _null_ _null_ _null_ ) insert ( 1953 byteane 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteane _null_ _null_ _null_ _null_ ) insert ( 1954 byteacmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '17 17' _null_ _null_ _null_ _null_ _null_ byteacmp _null_ _null_ _null_ _null_ ) insert ( 3331 bytea_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ bytea_sortsupport _null_ _null_ _null_ _null_ ) insert ( 3917 timestamp_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ timestamp_support _null_ _null_ _null_ _null_ ) insert ( 3944 time_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ time_support _null_ _null_ _null_ _null_ ) insert ( 1961 timestamp 11 10 12 1 0 0 3917 f f f t f i s 2 0 1114 '1114 23' _null_ _null_ _null_ _null_ _null_ timestamp_scale _null_ _null_ _null_ _null_ ) insert ( 1965 oidlarger 11 10 12 1 0 0 0 f f f t f i s 2 0 26 '26 26' _null_ _null_ _null_ _null_ _null_ oidlarger _null_ _null_ _null_ _null_ ) insert ( 1966 oidsmaller 11 10 12 1 0 0 0 f f f t f i s 2 0 26 '26 26' _null_ _null_ _null_ _null_ _null_ oidsmaller _null_ _null_ _null_ _null_ ) insert ( 1967 timestamptz 11 10 12 1 0 0 3917 f f f t f i s 2 0 1184 '1184 23' _null_ _null_ _null_ _null_ _null_ timestamptz_scale _null_ _null_ _null_ _null_ ) insert ( 1968 time 11 10 12 1 0 0 3944 f f f t f i s 2 0 1083 '1083 23' _null_ _null_ _null_ _null_ _null_ time_scale _null_ _null_ _null_ _null_ ) insert ( 1969 timetz 11 10 12 1 0 0 3944 f f f t f i s 2 0 1266 '1266 23' _null_ _null_ _null_ _null_ _null_ timetz_scale _null_ _null_ _null_ _null_ ) insert ( 2003 textanycat 11 10 14 1 0 0 0 f f f t f s s 2 0 25 '25 2776' _null_ _null_ _null_ _null_ _null_ 'select $1 operator(pg_catalog.||) $2::pg_catalog.text' _null_ _null_ _null_ _null_ ) insert ( 2004 anytextcat 11 10 14 1 0 0 0 f f f t f s s 2 0 25 '2776 25' _null_ _null_ _null_ _null_ _null_ 'select $1::pg_catalog.text operator(pg_catalog.||) $2' _null_ _null_ _null_ _null_ ) insert ( 2005 bytealike 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ bytealike _null_ _null_ _null_ _null_ ) insert ( 2006 byteanlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteanlike _null_ _null_ _null_ _null_ ) insert ( 2007 like 11 10 12 1 0 0 1023 f f f t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ bytealike _null_ _null_ _null_ _null_ ) insert ( 2008 notlike 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '17 17' _null_ _null_ _null_ _null_ _null_ byteanlike _null_ _null_ _null_ _null_ ) insert ( 2009 like_escape 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 17' _null_ _null_ _null_ _null_ _null_ like_escape_bytea _null_ _null_ _null_ _null_ ) insert ( 2010 length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 17 _null_ _null_ _null_ _null_ _null_ byteaoctetlen _null_ _null_ _null_ _null_ ) insert ( 2011 byteacat 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 17' _null_ _null_ _null_ _null_ _null_ byteacat _null_ _null_ _null_ _null_ ) insert ( 2012 substring 11 10 12 1 0 0 0 f f f t f i s 3 0 17 '17 23 23' _null_ _null_ _null_ _null_ _null_ bytea_substr _null_ _null_ _null_ _null_ ) insert ( 2013 substring 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 23' _null_ _null_ _null_ _null_ _null_ bytea_substr_no_len _null_ _null_ _null_ _null_ ) insert ( 2085 substr 11 10 12 1 0 0 0 f f f t f i s 3 0 17 '17 23 23' _null_ _null_ _null_ _null_ _null_ bytea_substr _null_ _null_ _null_ _null_ ) insert ( 2086 substr 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 23' _null_ _null_ _null_ _null_ _null_ bytea_substr_no_len _null_ _null_ _null_ _null_ ) insert ( 2014 position 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '17 17' _null_ _null_ _null_ _null_ _null_ byteapos _null_ _null_ _null_ _null_ ) insert ( 2015 btrim 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 17' _null_ _null_ _null_ _null_ _null_ byteatrim _null_ _null_ _null_ _null_ ) insert ( 6195 ltrim 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 17' _null_ _null_ _null_ _null_ _null_ bytealtrim _null_ _null_ _null_ _null_ ) insert ( 6196 rtrim 11 10 12 1 0 0 0 f f f t f i s 2 0 17 '17 17' _null_ _null_ _null_ _null_ _null_ byteartrim _null_ _null_ _null_ _null_ ) insert ( 2019 time 11 10 12 1 0 0 0 f f f t f s s 1 0 1083 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_time _null_ _null_ _null_ _null_ ) insert ( 2020 date_trunc 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '25 1114' _null_ _null_ _null_ _null_ _null_ timestamp_trunc _null_ _null_ _null_ _null_ ) insert ( 6177 date_bin 11 10 12 1 0 0 0 f f f t f i s 3 0 1114 '1186 1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_bin _null_ _null_ _null_ _null_ ) insert ( 6178 date_bin 11 10 12 1 0 0 0 f f f t f i s 3 0 1184 '1186 1184 1184' _null_ _null_ _null_ _null_ _null_ timestamptz_bin _null_ _null_ _null_ _null_ ) insert ( 2021 date_part 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '25 1114' _null_ _null_ _null_ _null_ _null_ timestamp_part _null_ _null_ _null_ _null_ ) insert ( 6202 extract 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '25 1114' _null_ _null_ _null_ _null_ _null_ extract_timestamp _null_ _null_ _null_ _null_ ) insert ( 2024 timestamp 11 10 12 1 0 0 0 f f f t f i s 1 0 1114 1082 _null_ _null_ _null_ _null_ _null_ date_timestamp _null_ _null_ _null_ _null_ ) insert ( 2025 timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1082 1083' _null_ _null_ _null_ _null_ _null_ datetime_timestamp _null_ _null_ _null_ _null_ ) insert ( 2027 timestamp 11 10 12 1 0 0 0 f f f t f s s 1 0 1114 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_timestamp _null_ _null_ _null_ _null_ ) insert ( 2028 timestamptz 11 10 12 1 0 0 0 f f f t f s s 1 0 1184 1114 _null_ _null_ _null_ _null_ _null_ timestamp_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2029 date 11 10 12 1 0 0 0 f f f t f i s 1 0 1082 1114 _null_ _null_ _null_ _null_ _null_ timestamp_date _null_ _null_ _null_ _null_ ) insert ( 2031 timestamp_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_mi _null_ _null_ _null_ _null_ ) insert ( 2032 timestamp_pl_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1114 1186' _null_ _null_ _null_ _null_ _null_ timestamp_pl_interval _null_ _null_ _null_ _null_ ) insert ( 2033 timestamp_mi_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1114 1186' _null_ _null_ _null_ _null_ _null_ timestamp_mi_interval _null_ _null_ _null_ _null_ ) insert ( 2035 timestamp_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_smaller _null_ _null_ _null_ _null_ ) insert ( 2036 timestamp_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_larger _null_ _null_ _null_ _null_ ) insert ( 2037 timezone 11 10 12 1 0 0 0 f f f t f s s 2 0 1266 '25 1266' _null_ _null_ _null_ _null_ _null_ timetz_zone _null_ _null_ _null_ _null_ ) insert ( 2038 timezone 11 10 12 1 0 0 0 f f f t f i s 2 0 1266 '1186 1266' _null_ _null_ _null_ _null_ _null_ timetz_izone _null_ _null_ _null_ _null_ ) insert ( 6336 timezone 11 10 12 1 0 0 0 f f f t f s s 1 0 1266 1266 _null_ _null_ _null_ _null_ _null_ timetz_at_local _null_ _null_ _null_ _null_ ) insert ( 2039 timestamp_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 1114 _null_ _null_ _null_ _null_ _null_ timestamp_hash _null_ _null_ _null_ _null_ ) insert ( 3411 timestamp_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '1114 20' _null_ _null_ _null_ _null_ _null_ timestamp_hash_extended _null_ _null_ _null_ _null_ ) insert ( 2041 overlaps 11 10 12 1 0 0 0 f f f f f i s 4 0 16 '1114 1114 1114 1114' _null_ _null_ _null_ _null_ _null_ overlaps_timestamp _null_ _null_ _null_ _null_ ) insert ( 2042 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1114 1186 1114 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2043 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1114 1114 1114 1186' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2044 overlaps 11 10 14 1 0 0 0 f f f f f i s 4 0 16 '1114 1186 1114 1114' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2045 timestamp_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_cmp _null_ _null_ _null_ _null_ ) insert ( 3137 timestamp_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ timestamp_sortsupport _null_ _null_ _null_ _null_ ) insert ( 4134 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1114 1114 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_timestamp_interval _null_ _null_ _null_ _null_ ) insert ( 4135 in_range 11 10 12 1 0 0 0 f f f t f s s 5 0 16 '1184 1184 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_timestamptz_interval _null_ _null_ _null_ _null_ ) insert ( 4136 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1186 1186 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_interval_interval _null_ _null_ _null_ _null_ ) insert ( 4137 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1083 1083 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_time_interval _null_ _null_ _null_ _null_ ) insert ( 4138 in_range 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '1266 1266 1186 16 16' _null_ _null_ _null_ _null_ _null_ in_range_timetz_interval _null_ _null_ _null_ _null_ ) insert ( 2046 time 11 10 12 1 0 0 0 f f f t f i s 1 0 1083 1266 _null_ _null_ _null_ _null_ _null_ timetz_time _null_ _null_ _null_ _null_ ) insert ( 2047 timetz 11 10 12 1 0 0 0 f f f t f s s 1 0 1266 1083 _null_ _null_ _null_ _null_ _null_ time_timetz _null_ _null_ _null_ _null_ ) insert ( 2048 isfinite 11 10 12 1 0 0 0 f f f t f i s 1 0 16 1114 _null_ _null_ _null_ _null_ _null_ timestamp_finite _null_ _null_ _null_ _null_ ) insert ( 2049 to_char 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '1114 25' _null_ _null_ _null_ _null_ _null_ timestamp_to_char _null_ _null_ _null_ _null_ ) insert ( 2052 timestamp_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_eq _null_ _null_ _null_ _null_ ) insert ( 2053 timestamp_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_ne _null_ _null_ _null_ _null_ ) insert ( 2054 timestamp_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_lt _null_ _null_ _null_ _null_ ) insert ( 2055 timestamp_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_le _null_ _null_ _null_ _null_ ) insert ( 2056 timestamp_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_ge _null_ _null_ _null_ _null_ ) insert ( 2057 timestamp_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_gt _null_ _null_ _null_ _null_ ) insert ( 2058 age 11 10 12 1 0 0 0 f f f t f i s 2 0 1186 '1114 1114' _null_ _null_ _null_ _null_ _null_ timestamp_age _null_ _null_ _null_ _null_ ) insert ( 2059 age 11 10 14 1 0 0 0 f f f t f s s 1 0 1186 1114 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2069 timezone 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '25 1114' _null_ _null_ _null_ _null_ _null_ timestamp_zone _null_ _null_ _null_ _null_ ) insert ( 2070 timezone 11 10 12 1 0 0 0 f f f t f i s 2 0 1184 '1186 1114' _null_ _null_ _null_ _null_ _null_ timestamp_izone _null_ _null_ _null_ _null_ ) insert ( 6335 timezone 11 10 12 1 0 0 0 f f f t f s s 1 0 1184 1114 _null_ _null_ _null_ _null_ _null_ timestamp_at_local _null_ _null_ _null_ _null_ ) insert ( 2071 date_pl_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1082 1186' _null_ _null_ _null_ _null_ _null_ date_pl_interval _null_ _null_ _null_ _null_ ) insert ( 2072 date_mi_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 1114 '1082 1186' _null_ _null_ _null_ _null_ _null_ date_mi_interval _null_ _null_ _null_ _null_ ) insert ( 2073 substring 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ textregexsubstr _null_ _null_ _null_ _null_ ) insert ( 2074 substring 11 10 14 1 0 0 0 f f f t f i s 3 0 25 '25 25 25' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2075 bit 11 10 12 1 0 0 0 f f f t f i s 2 0 1560 '20 23' _null_ _null_ _null_ _null_ _null_ bitfromint8 _null_ _null_ _null_ _null_ ) insert ( 2076 int8 11 10 12 1 0 0 0 f f f t f i s 1 0 20 1560 _null_ _null_ _null_ _null_ _null_ bittoint8 _null_ _null_ _null_ _null_ ) insert ( 2077 current_setting 11 10 12 1 0 0 0 f f f t f s s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ show_config_by_name _null_ _null_ _null_ _null_ ) insert ( 3294 current_setting 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '25 16' _null_ _null_ _null_ _null_ _null_ show_config_by_name_missing_ok _null_ _null_ _null_ _null_ ) insert ( 2078 set_config 11 10 12 1 0 0 0 f f f f f v u 3 0 25 '25 25 16' _null_ _null_ _null_ _null_ _null_ set_config_by_name _null_ _null_ _null_ _null_ ) insert ( 2084 pg_show_all_settings 11 10 12 1 1000 0 0 f f f t t s s 0 0 2249 '' '{25,25,25,25,25,25,25,25,25,25,25,1009,25,25,25,23,16}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{name,setting,unit,category,short_desc,extra_desc,context,vartype,source,min_val,max_val,enumvals,boot_val,reset_val,sourcefile,sourceline,pending_restart}' _null_ _null_ show_all_settings _null_ _null_ _null_ _null_ ) insert ( 6240 pg_settings_get_flags 11 10 12 1 0 0 0 f f f t f s s 1 0 1009 25 _null_ _null_ _null_ _null_ _null_ pg_settings_get_flags _null_ _null_ _null_ _null_ ) insert ( 3329 pg_show_all_file_settings 11 10 12 1 1000 0 0 f f f t t v s 0 0 2249 '' '{25,23,23,25,25,16,25}' '{o,o,o,o,o,o,o}' '{sourcefile,sourceline,seqno,name,setting,applied,error}' _null_ _null_ show_all_file_settings _null_ _null_ _null_ _null_ ) insert ( 3401 pg_hba_file_rules 11 10 12 1 1000 0 0 f f f t t v s 0 0 2249 '' '{23,25,23,25,1009,1009,25,25,25,1009,25}' '{o,o,o,o,o,o,o,o,o,o,o}' '{rule_number,file_name,line_number,type,database,user_name,address,netmask,auth_method,options,error}' _null_ _null_ pg_hba_file_rules _null_ _null_ _null_ _null_ ) insert ( 6250 pg_ident_file_mappings 11 10 12 1 1000 0 0 f f f t t v s 0 0 2249 '' '{23,25,23,25,25,25,25}' '{o,o,o,o,o,o,o}' '{map_number,file_name,line_number,map_name,sys_name,pg_username,error}' _null_ _null_ pg_ident_file_mappings _null_ _null_ _null_ _null_ ) insert ( 1371 pg_lock_status 11 10 12 1 1000 0 0 f f f t t v s 0 0 2249 '' '{25,26,26,23,21,25,28,26,26,21,25,23,25,16,16,1184}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{locktype,database,relation,page,tuple,virtualxid,transactionid,classid,objid,objsubid,virtualtransaction,pid,mode,granted,fastpath,waitstart}' _null_ _null_ pg_lock_status _null_ _null_ _null_ _null_ ) insert ( 2561 pg_blocking_pids 11 10 12 1 0 0 0 f f f t f v s 1 0 1007 23 _null_ _null_ _null_ _null_ _null_ pg_blocking_pids _null_ _null_ _null_ _null_ ) insert ( 3376 pg_safe_snapshot_blocking_pids 11 10 12 1 0 0 0 f f f t f v s 1 0 1007 23 _null_ _null_ _null_ _null_ _null_ pg_safe_snapshot_blocking_pids _null_ _null_ _null_ _null_ ) insert ( 3378 pg_isolation_test_session_is_blocked 11 10 12 1 0 0 0 f f f t f v s 2 0 16 '23 1007' _null_ _null_ _null_ _null_ _null_ pg_isolation_test_session_is_blocked _null_ _null_ _null_ _null_ ) insert ( 1065 pg_prepared_xact 11 10 12 1 1000 0 0 f f f t t v s 0 0 2249 '' '{28,25,1184,26,26}' '{o,o,o,o,o}' '{transaction,gid,prepared,ownerid,dbid}' _null_ _null_ pg_prepared_xact _null_ _null_ _null_ _null_ ) insert ( 3819 pg_get_multixact_members 11 10 12 1 1000 0 0 f f f t t v s 1 0 2249 28 '{28,28,25}' '{i,o,o}' '{multixid,xid,mode}' _null_ _null_ pg_get_multixact_members _null_ _null_ _null_ _null_ ) insert ( 3581 pg_xact_commit_timestamp 11 10 12 1 0 0 0 f f f t f v s 1 0 1184 28 _null_ _null_ _null_ _null_ _null_ pg_xact_commit_timestamp _null_ _null_ _null_ _null_ ) insert ( 6168 pg_xact_commit_timestamp_origin 11 10 12 1 0 0 0 f f f t f v s 1 0 2249 28 '{28,1184,26}' '{i,o,o}' '{xid,timestamp,roident}' _null_ _null_ pg_xact_commit_timestamp_origin _null_ _null_ _null_ _null_ ) insert ( 3583 pg_last_committed_xact 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{28,1184,26}' '{o,o,o}' '{xid,timestamp,roident}' _null_ _null_ pg_last_committed_xact _null_ _null_ _null_ _null_ ) insert ( 3537 pg_describe_object 11 10 12 1 0 0 0 f f f t f s s 3 0 25 '26 26 23' _null_ _null_ _null_ _null_ _null_ pg_describe_object _null_ _null_ _null_ _null_ ) insert ( 3839 pg_identify_object 11 10 12 1 0 0 0 f f f t f s s 3 0 2249 '26 26 23' '{26,26,23,25,25,25,25}' '{i,i,i,o,o,o,o}' '{classid,objid,objsubid,type,schema,name,identity}' _null_ _null_ pg_identify_object _null_ _null_ _null_ _null_ ) insert ( 3382 pg_identify_object_as_address 11 10 12 1 0 0 0 f f f t f s s 3 0 2249 '26 26 23' '{26,26,23,25,1009,1009}' '{i,i,i,o,o,o}' '{classid,objid,objsubid,type,object_names,object_args}' _null_ _null_ pg_identify_object_as_address _null_ _null_ _null_ _null_ ) insert ( 3954 pg_get_object_address 11 10 12 1 0 0 0 f f f t f s s 3 0 2249 '25 1009 1009' '{25,1009,1009,26,26,23}' '{i,i,i,o,o,o}' '{type,object_names,object_args,classid,objid,objsubid}' _null_ _null_ pg_get_object_address _null_ _null_ _null_ _null_ ) insert ( 2079 pg_table_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_table_is_visible _null_ _null_ _null_ _null_ ) insert ( 2080 pg_type_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_type_is_visible _null_ _null_ _null_ _null_ ) insert ( 2081 pg_function_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_function_is_visible _null_ _null_ _null_ _null_ ) insert ( 2082 pg_operator_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_operator_is_visible _null_ _null_ _null_ _null_ ) insert ( 2083 pg_opclass_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_opclass_is_visible _null_ _null_ _null_ _null_ ) insert ( 3829 pg_opfamily_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_opfamily_is_visible _null_ _null_ _null_ _null_ ) insert ( 2093 pg_conversion_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_conversion_is_visible _null_ _null_ _null_ _null_ ) insert ( 3403 pg_statistics_obj_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_statistics_obj_is_visible _null_ _null_ _null_ _null_ ) insert ( 3756 pg_ts_parser_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_ts_parser_is_visible _null_ _null_ _null_ _null_ ) insert ( 3757 pg_ts_dict_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_ts_dict_is_visible _null_ _null_ _null_ _null_ ) insert ( 3768 pg_ts_template_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_ts_template_is_visible _null_ _null_ _null_ _null_ ) insert ( 3758 pg_ts_config_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_ts_config_is_visible _null_ _null_ _null_ _null_ ) insert ( 3815 pg_collation_is_visible 11 10 12 10 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_collation_is_visible _null_ _null_ _null_ _null_ ) insert ( 2854 pg_my_temp_schema 11 10 12 1 0 0 0 f f f t f s r 0 0 26 '' _null_ _null_ _null_ _null_ _null_ pg_my_temp_schema _null_ _null_ _null_ _null_ ) insert ( 2855 pg_is_other_temp_schema 11 10 12 1 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ pg_is_other_temp_schema _null_ _null_ _null_ _null_ ) insert ( 2171 pg_cancel_backend 11 10 12 1 0 0 0 f f f t f v s 1 0 16 23 _null_ _null_ _null_ _null_ _null_ pg_cancel_backend _null_ _null_ _null_ _null_ ) insert ( 2096 pg_terminate_backend 11 10 12 1 0 0 0 f f f t f v s 2 0 16 '23 20' _null_ _null_ '{pid,timeout}' _null_ _null_ pg_terminate_backend _null_ _null_ _null_ _null_ ) insert ( 2172 pg_backup_start 11 10 12 1 0 0 0 f f f t f v r 2 0 3220 '25 16' _null_ _null_ _null_ _null_ _null_ pg_backup_start _null_ _null_ _null_ _null_ ) insert ( 2739 pg_backup_stop 11 10 12 1 0 0 0 f f f t f v r 1 0 2249 16 '{16,3220,25,25}' '{i,o,o,o}' '{wait_for_archive,lsn,labelfile,spcmapfile}' _null_ _null_ pg_backup_stop _null_ _null_ _null_ _null_ ) insert ( 3436 pg_promote 11 10 12 1 0 0 0 f f f t f v s 2 0 16 '16 23' _null_ _null_ '{wait,wait_seconds}' _null_ _null_ pg_promote _null_ _null_ _null_ _null_ ) insert ( 2848 pg_switch_wal 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_switch_wal _null_ _null_ _null_ _null_ ) insert ( 6305 pg_log_standby_snapshot 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_log_standby_snapshot _null_ _null_ _null_ _null_ ) insert ( 3098 pg_create_restore_point 11 10 12 1 0 0 0 f f f t f v s 1 0 3220 25 _null_ _null_ _null_ _null_ _null_ pg_create_restore_point _null_ _null_ _null_ _null_ ) insert ( 2849 pg_current_wal_lsn 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_current_wal_lsn _null_ _null_ _null_ _null_ ) insert ( 2852 pg_current_wal_insert_lsn 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_current_wal_insert_lsn _null_ _null_ _null_ _null_ ) insert ( 3330 pg_current_wal_flush_lsn 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_current_wal_flush_lsn _null_ _null_ _null_ _null_ ) insert ( 2850 pg_walfile_name_offset 11 10 12 1 0 0 0 f f f t f i s 1 0 2249 3220 '{3220,25,23}' '{i,o,o}' '{lsn,file_name,file_offset}' _null_ _null_ pg_walfile_name_offset _null_ _null_ _null_ _null_ ) insert ( 2851 pg_walfile_name 11 10 12 1 0 0 0 f f f t f i s 1 0 25 3220 _null_ _null_ _null_ _null_ _null_ pg_walfile_name _null_ _null_ _null_ _null_ ) insert ( 6213 pg_split_walfile_name 11 10 12 1 0 0 0 f f f t f s s 1 0 2249 25 '{25,1700,20}' '{i,o,o}' '{file_name,segment_number,timeline_id}' _null_ _null_ pg_split_walfile_name _null_ _null_ _null_ _null_ ) insert ( 3165 pg_wal_lsn_diff 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_wal_lsn_diff _null_ _null_ _null_ _null_ ) insert ( 3809 pg_export_snapshot 11 10 12 1 0 0 0 f f f t f v u 0 0 25 '' _null_ _null_ _null_ _null_ _null_ pg_export_snapshot _null_ _null_ _null_ _null_ ) insert ( 3810 pg_is_in_recovery 11 10 12 1 0 0 0 f f f t f v s 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_is_in_recovery _null_ _null_ _null_ _null_ ) insert ( 3820 pg_last_wal_receive_lsn 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_last_wal_receive_lsn _null_ _null_ _null_ _null_ ) insert ( 3821 pg_last_wal_replay_lsn 11 10 12 1 0 0 0 f f f t f v s 0 0 3220 '' _null_ _null_ _null_ _null_ _null_ pg_last_wal_replay_lsn _null_ _null_ _null_ _null_ ) insert ( 3830 pg_last_xact_replay_timestamp 11 10 12 1 0 0 0 f f f t f v s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_last_xact_replay_timestamp _null_ _null_ _null_ _null_ ) insert ( 3071 pg_wal_replay_pause 11 10 12 1 0 0 0 f f f t f v s 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_wal_replay_pause _null_ _null_ _null_ _null_ ) insert ( 3072 pg_wal_replay_resume 11 10 12 1 0 0 0 f f f t f v s 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_wal_replay_resume _null_ _null_ _null_ _null_ ) insert ( 3073 pg_is_wal_replay_paused 11 10 12 1 0 0 0 f f f t f v s 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_is_wal_replay_paused _null_ _null_ _null_ _null_ ) insert ( 1137 pg_get_wal_replay_pause_state 11 10 12 1 0 0 0 f f f t f v s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ pg_get_wal_replay_pause_state _null_ _null_ _null_ _null_ ) insert ( 6224 pg_get_wal_resource_managers 11 10 12 1 50 0 0 f f f t t v s 0 0 2249 '' '{23,25,16}' '{o,o,o}' '{rm_id, rm_name, rm_builtin}' _null_ _null_ pg_get_wal_resource_managers _null_ _null_ _null_ _null_ ) insert ( 2621 pg_reload_conf 11 10 12 1 0 0 0 f f f t f v s 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_reload_conf _null_ _null_ _null_ _null_ ) insert ( 2622 pg_rotate_logfile 11 10 12 1 0 0 0 f f f t f v s 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_rotate_logfile _null_ _null_ _null_ _null_ ) insert ( 3800 pg_current_logfile 11 10 12 1 0 0 0 f f f f f v s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ pg_current_logfile _null_ _null_ _null_ _null_ ) insert ( 3801 pg_current_logfile 11 10 12 1 0 0 0 f f f f f v s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ pg_current_logfile_1arg _null_ _null_ _null_ _null_ ) insert ( 2623 pg_stat_file 11 10 12 1 0 0 0 f f f t f v s 1 0 2249 25 '{25,20,1184,1184,1184,1184,16}' '{i,o,o,o,o,o,o}' '{filename,size,access,modification,change,creation,isdir}' _null_ _null_ pg_stat_file_1arg _null_ _null_ _null_ _null_ ) insert ( 3307 pg_stat_file 11 10 12 1 0 0 0 f f f t f v s 2 0 2249 '25 16' '{25,16,20,1184,1184,1184,1184,16}' '{i,i,o,o,o,o,o,o}' '{filename,missing_ok,size,access,modification,change,creation,isdir}' _null_ _null_ pg_stat_file _null_ _null_ _null_ _null_ ) insert ( 2624 pg_read_file 11 10 12 1 0 0 0 f f f t f v s 3 0 25 '25 20 20' _null_ _null_ _null_ _null_ _null_ pg_read_file_off_len _null_ _null_ _null_ _null_ ) insert ( 3293 pg_read_file 11 10 12 1 0 0 0 f f f t f v s 4 0 25 '25 20 20 16' _null_ _null_ _null_ _null_ _null_ pg_read_file_off_len_missing _null_ _null_ _null_ _null_ ) insert ( 3826 pg_read_file 11 10 12 1 0 0 0 f f f t f v s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ pg_read_file_all _null_ _null_ _null_ _null_ ) insert ( 6208 pg_read_file 11 10 12 1 0 0 0 f f f t f v s 2 0 25 '25 16' _null_ _null_ _null_ _null_ _null_ pg_read_file_all_missing _null_ _null_ _null_ _null_ ) insert ( 3827 pg_read_binary_file 11 10 12 1 0 0 0 f f f t f v s 3 0 17 '25 20 20' _null_ _null_ _null_ _null_ _null_ pg_read_binary_file_off_len _null_ _null_ _null_ _null_ ) insert ( 3295 pg_read_binary_file 11 10 12 1 0 0 0 f f f t f v s 4 0 17 '25 20 20 16' _null_ _null_ _null_ _null_ _null_ pg_read_binary_file_off_len_missing _null_ _null_ _null_ _null_ ) insert ( 3828 pg_read_binary_file 11 10 12 1 0 0 0 f f f t f v s 1 0 17 25 _null_ _null_ _null_ _null_ _null_ pg_read_binary_file_all _null_ _null_ _null_ _null_ ) insert ( 6209 pg_read_binary_file 11 10 12 1 0 0 0 f f f t f v s 2 0 17 '25 16' _null_ _null_ _null_ _null_ _null_ pg_read_binary_file_all_missing _null_ _null_ _null_ _null_ ) insert ( 2625 pg_ls_dir 11 10 12 1 1000 0 0 f f f t t v s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ pg_ls_dir_1arg _null_ _null_ _null_ _null_ ) insert ( 3297 pg_ls_dir 11 10 12 1 1000 0 0 f f f t t v s 3 0 25 '25 16 16' _null_ _null_ _null_ _null_ _null_ pg_ls_dir _null_ _null_ _null_ _null_ ) insert ( 2626 pg_sleep 11 10 12 1 0 0 0 f f f t f v s 1 0 2278 701 _null_ _null_ _null_ _null_ _null_ pg_sleep _null_ _null_ _null_ _null_ ) insert ( 3935 pg_sleep_for 11 10 14 1 0 0 0 f f f t f v s 1 0 2278 1186 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 3936 pg_sleep_until 11 10 14 1 0 0 0 f f f t f v s 1 0 2278 1184 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 315 pg_jit_available 11 10 12 1 0 0 0 f f f t f v s 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_jit_available _null_ _null_ _null_ _null_ ) insert ( 2971 text 11 10 12 1 0 0 0 f f f t f i s 1 0 25 16 _null_ _null_ _null_ _null_ _null_ booltext _null_ _null_ _null_ _null_ ) insert ( 2100 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2101 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2102 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2103 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2104 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2105 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2106 avg 11 10 12 1 0 0 0 a f f f f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2107 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2108 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 20 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2109 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 20 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2110 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2111 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2112 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 790 790 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2113 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2114 sum 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2115 max 11 10 12 1 0 0 0 a f f f f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2116 max 11 10 12 1 0 0 0 a f f f f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2117 max 11 10 12 1 0 0 0 a f f f f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2118 max 11 10 12 1 0 0 0 a f f f f i s 1 0 26 26 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2119 max 11 10 12 1 0 0 0 a f f f f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2120 max 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2122 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1082 1082 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2123 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1083 1083 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2124 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1266 1266 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2125 max 11 10 12 1 0 0 0 a f f f f i s 1 0 790 790 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2126 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1114 1114 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2127 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1184 1184 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2128 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2129 max 11 10 12 1 0 0 0 a f f f f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2130 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2050 max 11 10 12 1 0 0 0 a f f f f i s 1 0 2277 2277 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2244 max 11 10 12 1 0 0 0 a f f f f i s 1 0 1042 1042 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2797 max 11 10 12 1 0 0 0 a f f f f i s 1 0 27 27 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3564 max 11 10 12 1 0 0 0 a f f f f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 4189 max 11 10 12 1 0 0 0 a f f f f i s 1 0 3220 3220 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 5099 max 11 10 12 1 0 0 0 a f f f f i s 1 0 5069 5069 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2131 min 11 10 12 1 0 0 0 a f f f f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2132 min 11 10 12 1 0 0 0 a f f f f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2133 min 11 10 12 1 0 0 0 a f f f f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2134 min 11 10 12 1 0 0 0 a f f f f i s 1 0 26 26 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2135 min 11 10 12 1 0 0 0 a f f f f i s 1 0 700 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2136 min 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2138 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1082 1082 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2139 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1083 1083 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2140 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1266 1266 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2141 min 11 10 12 1 0 0 0 a f f f f i s 1 0 790 790 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2142 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1114 1114 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2143 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1184 1184 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2144 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1186 1186 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2145 min 11 10 12 1 0 0 0 a f f f f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2146 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2051 min 11 10 12 1 0 0 0 a f f f f i s 1 0 2277 2277 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2245 min 11 10 12 1 0 0 0 a f f f f i s 1 0 1042 1042 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2798 min 11 10 12 1 0 0 0 a f f f f i s 1 0 27 27 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3565 min 11 10 12 1 0 0 0 a f f f f i s 1 0 869 869 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 4190 min 11 10 12 1 0 0 0 a f f f f i s 1 0 3220 3220 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 5100 min 11 10 12 1 0 0 0 a f f f f i s 1 0 5069 5069 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2147 count 11 10 12 1 0 0 6236 a f f f f i s 1 0 20 2276 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2803 count 11 10 12 1 0 0 6236 a f f f f i s 0 0 20 '' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6236 int8inc_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ int8inc_support _null_ _null_ _null_ _null_ ) insert ( 2718 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2719 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2720 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2721 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2722 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2723 var_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2641 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2642 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2643 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2644 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2645 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2646 var_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2148 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2149 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2150 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2151 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2152 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2153 variance 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2724 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2725 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2726 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2727 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2728 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2729 stddev_pop 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2712 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2713 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2714 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2715 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2716 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2717 stddev_samp 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2154 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2155 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2156 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2157 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 701 700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2158 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 701 701 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2159 stddev 11 10 12 1 0 0 0 a f f f f i s 1 0 1700 1700 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2818 regr_count 11 10 12 1 0 0 0 a f f f f i s 2 0 20 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2819 regr_sxx 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2820 regr_syy 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2821 regr_sxy 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2822 regr_avgx 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2823 regr_avgy 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2824 regr_r2 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2825 regr_slope 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2826 regr_intercept 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2827 covar_pop 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2828 covar_samp 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2829 corr 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2160 text_pattern_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_pattern_lt _null_ _null_ _null_ _null_ ) insert ( 2161 text_pattern_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_pattern_le _null_ _null_ _null_ _null_ ) insert ( 2163 text_pattern_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_pattern_ge _null_ _null_ _null_ _null_ ) insert ( 2164 text_pattern_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ text_pattern_gt _null_ _null_ _null_ _null_ ) insert ( 2166 bttext_pattern_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ bttext_pattern_cmp _null_ _null_ _null_ _null_ ) insert ( 3332 bttext_pattern_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ bttext_pattern_sortsupport _null_ _null_ _null_ _null_ ) insert ( 2174 bpchar_pattern_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_pattern_lt _null_ _null_ _null_ _null_ ) insert ( 2175 bpchar_pattern_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_pattern_le _null_ _null_ _null_ _null_ ) insert ( 2177 bpchar_pattern_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_pattern_ge _null_ _null_ _null_ _null_ ) insert ( 2178 bpchar_pattern_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '1042 1042' _null_ _null_ _null_ _null_ _null_ bpchar_pattern_gt _null_ _null_ _null_ _null_ ) insert ( 2180 btbpchar_pattern_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '1042 1042' _null_ _null_ _null_ _null_ _null_ btbpchar_pattern_cmp _null_ _null_ _null_ _null_ ) insert ( 3333 btbpchar_pattern_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ btbpchar_pattern_sortsupport _null_ _null_ _null_ _null_ ) insert ( 2188 btint48cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '23 20' _null_ _null_ _null_ _null_ _null_ btint48cmp _null_ _null_ _null_ _null_ ) insert ( 2189 btint84cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '20 23' _null_ _null_ _null_ _null_ _null_ btint84cmp _null_ _null_ _null_ _null_ ) insert ( 2190 btint24cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '21 23' _null_ _null_ _null_ _null_ _null_ btint24cmp _null_ _null_ _null_ _null_ ) insert ( 2191 btint42cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '23 21' _null_ _null_ _null_ _null_ _null_ btint42cmp _null_ _null_ _null_ _null_ ) insert ( 2192 btint28cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '21 20' _null_ _null_ _null_ _null_ _null_ btint28cmp _null_ _null_ _null_ _null_ ) insert ( 2193 btint82cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '20 21' _null_ _null_ _null_ _null_ _null_ btint82cmp _null_ _null_ _null_ _null_ ) insert ( 2194 btfloat48cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '700 701' _null_ _null_ _null_ _null_ _null_ btfloat48cmp _null_ _null_ _null_ _null_ ) insert ( 2195 btfloat84cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '701 700' _null_ _null_ _null_ _null_ _null_ btfloat84cmp _null_ _null_ _null_ _null_ ) insert ( 2212 regprocedurein 11 10 12 1 0 0 0 f f f t f s s 1 0 2202 2275 _null_ _null_ _null_ _null_ _null_ regprocedurein _null_ _null_ _null_ _null_ ) insert ( 2213 regprocedureout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2202 _null_ _null_ _null_ _null_ _null_ regprocedureout _null_ _null_ _null_ _null_ ) insert ( 2214 regoperin 11 10 12 1 0 0 0 f f f t f s s 1 0 2203 2275 _null_ _null_ _null_ _null_ _null_ regoperin _null_ _null_ _null_ _null_ ) insert ( 2215 regoperout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2203 _null_ _null_ _null_ _null_ _null_ regoperout _null_ _null_ _null_ _null_ ) insert ( 3492 to_regoper 11 10 12 1 0 0 0 f f f t f s s 1 0 2203 25 _null_ _null_ _null_ _null_ _null_ to_regoper _null_ _null_ _null_ _null_ ) insert ( 3476 to_regoperator 11 10 12 1 0 0 0 f f f t f s s 1 0 2204 25 _null_ _null_ _null_ _null_ _null_ to_regoperator _null_ _null_ _null_ _null_ ) insert ( 2216 regoperatorin 11 10 12 1 0 0 0 f f f t f s s 1 0 2204 2275 _null_ _null_ _null_ _null_ _null_ regoperatorin _null_ _null_ _null_ _null_ ) insert ( 2217 regoperatorout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2204 _null_ _null_ _null_ _null_ _null_ regoperatorout _null_ _null_ _null_ _null_ ) insert ( 2218 regclassin 11 10 12 1 0 0 0 f f f t f s s 1 0 2205 2275 _null_ _null_ _null_ _null_ _null_ regclassin _null_ _null_ _null_ _null_ ) insert ( 2219 regclassout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2205 _null_ _null_ _null_ _null_ _null_ regclassout _null_ _null_ _null_ _null_ ) insert ( 3495 to_regclass 11 10 12 1 0 0 0 f f f t f s s 1 0 2205 25 _null_ _null_ _null_ _null_ _null_ to_regclass _null_ _null_ _null_ _null_ ) insert ( 4193 regcollationin 11 10 12 1 0 0 0 f f f t f s s 1 0 4191 2275 _null_ _null_ _null_ _null_ _null_ regcollationin _null_ _null_ _null_ _null_ ) insert ( 4194 regcollationout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4191 _null_ _null_ _null_ _null_ _null_ regcollationout _null_ _null_ _null_ _null_ ) insert ( 4195 to_regcollation 11 10 12 1 0 0 0 f f f t f s s 1 0 4191 25 _null_ _null_ _null_ _null_ _null_ to_regcollation _null_ _null_ _null_ _null_ ) insert ( 2220 regtypein 11 10 12 1 0 0 0 f f f t f s s 1 0 2206 2275 _null_ _null_ _null_ _null_ _null_ regtypein _null_ _null_ _null_ _null_ ) insert ( 2221 regtypeout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2206 _null_ _null_ _null_ _null_ _null_ regtypeout _null_ _null_ _null_ _null_ ) insert ( 3493 to_regtype 11 10 12 1 0 0 0 f f f t f s s 1 0 2206 25 _null_ _null_ _null_ _null_ _null_ to_regtype _null_ _null_ _null_ _null_ ) insert ( 6317 to_regtypemod 11 10 12 1 0 0 0 f f f t f s s 1 0 23 25 _null_ _null_ _null_ _null_ _null_ to_regtypemod _null_ _null_ _null_ _null_ ) insert ( 1079 regclass 11 10 12 1 0 0 0 f f f t f s s 1 0 2205 25 _null_ _null_ _null_ _null_ _null_ text_regclass _null_ _null_ _null_ _null_ ) insert ( 4098 regrolein 11 10 12 1 0 0 0 f f f t f s s 1 0 4096 2275 _null_ _null_ _null_ _null_ _null_ regrolein _null_ _null_ _null_ _null_ ) insert ( 4092 regroleout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4096 _null_ _null_ _null_ _null_ _null_ regroleout _null_ _null_ _null_ _null_ ) insert ( 4093 to_regrole 11 10 12 1 0 0 0 f f f t f s s 1 0 4096 25 _null_ _null_ _null_ _null_ _null_ to_regrole _null_ _null_ _null_ _null_ ) insert ( 4084 regnamespacein 11 10 12 1 0 0 0 f f f t f s s 1 0 4089 2275 _null_ _null_ _null_ _null_ _null_ regnamespacein _null_ _null_ _null_ _null_ ) insert ( 4085 regnamespaceout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4089 _null_ _null_ _null_ _null_ _null_ regnamespaceout _null_ _null_ _null_ _null_ ) insert ( 4086 to_regnamespace 11 10 12 1 0 0 0 f f f t f s s 1 0 4089 25 _null_ _null_ _null_ _null_ _null_ to_regnamespace _null_ _null_ _null_ _null_ ) insert ( 6210 pg_input_is_valid 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ pg_input_is_valid _null_ _null_ _null_ _null_ ) insert ( 6211 pg_input_error_info 11 10 12 1 0 0 0 f f f t f s s 2 0 2249 '25 25' '{25,25,25,25,25,25}' '{i,i,o,o,o,o}' '{value,type_name,message,detail,hint,sql_error_code}' _null_ _null_ pg_input_error_info _null_ _null_ _null_ _null_ ) insert ( 1268 parse_ident 11 10 12 1 0 0 0 f f f t f i s 2 0 1009 '25 16' _null_ _null_ '{str,strict}' _null_ _null_ parse_ident _null_ _null_ _null_ _null_ ) insert ( 2246 fmgr_internal_validator 11 10 12 1 0 0 0 f f f t f s s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ fmgr_internal_validator _null_ _null_ _null_ _null_ ) insert ( 2247 fmgr_c_validator 11 10 12 1 0 0 0 f f f t f s s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ fmgr_c_validator _null_ _null_ _null_ _null_ ) insert ( 2248 fmgr_sql_validator 11 10 12 1 0 0 0 f f f t f s s 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ fmgr_sql_validator _null_ _null_ _null_ _null_ ) insert ( 2250 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2251 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2252 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2253 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2254 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2255 has_database_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_database_privilege_id _null_ _null_ _null_ _null_ ) insert ( 2256 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2257 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2258 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2259 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2260 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2261 has_function_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_function_privilege_id _null_ _null_ _null_ _null_ ) insert ( 2262 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2263 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2264 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2265 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2266 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2267 has_language_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_language_privilege_id _null_ _null_ _null_ _null_ ) insert ( 2268 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2269 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2270 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2271 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2272 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2273 has_schema_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_schema_privilege_id _null_ _null_ _null_ _null_ ) insert ( 2390 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 2391 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 2392 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 2393 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 2394 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2395 has_tablespace_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_tablespace_privilege_id _null_ _null_ _null_ _null_ ) insert ( 3000 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 3001 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 3002 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 3003 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 3004 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_name _null_ _null_ _null_ _null_ ) insert ( 3005 has_foreign_data_wrapper_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_foreign_data_wrapper_privilege_id _null_ _null_ _null_ _null_ ) insert ( 3006 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 3007 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 3008 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 3009 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 3010 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_name _null_ _null_ _null_ _null_ ) insert ( 3011 has_server_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_server_privilege_id _null_ _null_ _null_ _null_ ) insert ( 3138 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 3139 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_name_id _null_ _null_ _null_ _null_ ) insert ( 3140 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 3141 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_id_id _null_ _null_ _null_ _null_ ) insert ( 3142 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_name _null_ _null_ _null_ _null_ ) insert ( 3143 has_type_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ has_type_privilege_id _null_ _null_ _null_ _null_ ) insert ( 6205 has_parameter_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 25 25' _null_ _null_ _null_ _null_ _null_ has_parameter_privilege_name_name _null_ _null_ _null_ _null_ ) insert ( 6206 has_parameter_privilege 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 25 25' _null_ _null_ _null_ _null_ _null_ has_parameter_privilege_id_name _null_ _null_ _null_ _null_ ) insert ( 6207 has_parameter_privilege 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ has_parameter_privilege_name _null_ _null_ _null_ _null_ ) insert ( 2705 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 19 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_name_name _null_ _null_ _null_ _null_ ) insert ( 2706 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '19 26 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_name_id _null_ _null_ _null_ _null_ ) insert ( 2707 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 19 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_id_name _null_ _null_ _null_ _null_ ) insert ( 2708 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 3 0 16 '26 26 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_id_id _null_ _null_ _null_ _null_ ) insert ( 2709 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '19 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_name _null_ _null_ _null_ _null_ ) insert ( 2710 pg_has_role 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '26 25' _null_ _null_ _null_ _null_ _null_ pg_has_role_id _null_ _null_ _null_ _null_ ) insert ( 1269 pg_column_size 11 10 12 1 0 0 0 f f f t f s s 1 0 23 2276 _null_ _null_ _null_ _null_ _null_ pg_column_size _null_ _null_ _null_ _null_ ) insert ( 2121 pg_column_compression 11 10 12 1 0 0 0 f f f t f s s 1 0 25 2276 _null_ _null_ _null_ _null_ _null_ pg_column_compression _null_ _null_ _null_ _null_ ) insert ( 6316 pg_column_toast_chunk_id 11 10 12 1 0 0 0 f f f t f s s 1 0 26 2276 _null_ _null_ _null_ _null_ _null_ pg_column_toast_chunk_id _null_ _null_ _null_ _null_ ) insert ( 2322 pg_tablespace_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_tablespace_size_oid _null_ _null_ _null_ _null_ ) insert ( 2323 pg_tablespace_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 19 _null_ _null_ _null_ _null_ _null_ pg_tablespace_size_name _null_ _null_ _null_ _null_ ) insert ( 2324 pg_database_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 26 _null_ _null_ _null_ _null_ _null_ pg_database_size_oid _null_ _null_ _null_ _null_ ) insert ( 2168 pg_database_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 19 _null_ _null_ _null_ _null_ _null_ pg_database_size_name _null_ _null_ _null_ _null_ ) insert ( 2325 pg_relation_size 11 10 14 1 0 0 0 f f f t f v s 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2332 pg_relation_size 11 10 12 1 0 0 0 f f f t f v s 2 0 20 '2205 25' _null_ _null_ _null_ _null_ _null_ pg_relation_size _null_ _null_ _null_ _null_ ) insert ( 2286 pg_total_relation_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ pg_total_relation_size _null_ _null_ _null_ _null_ ) insert ( 2288 pg_size_pretty 11 10 12 1 0 0 0 f f f t f i s 1 0 25 20 _null_ _null_ _null_ _null_ _null_ pg_size_pretty _null_ _null_ _null_ _null_ ) insert ( 3166 pg_size_pretty 11 10 12 1 0 0 0 f f f t f i s 1 0 25 1700 _null_ _null_ _null_ _null_ _null_ pg_size_pretty_numeric _null_ _null_ _null_ _null_ ) insert ( 3334 pg_size_bytes 11 10 12 1 0 0 0 f f f t f i s 1 0 20 25 _null_ _null_ _null_ _null_ _null_ pg_size_bytes _null_ _null_ _null_ _null_ ) insert ( 2997 pg_table_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ pg_table_size _null_ _null_ _null_ _null_ ) insert ( 2998 pg_indexes_size 11 10 12 1 0 0 0 f f f t f v s 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ pg_indexes_size _null_ _null_ _null_ _null_ ) insert ( 2999 pg_relation_filenode 11 10 12 1 0 0 0 f f f t f s s 1 0 26 2205 _null_ _null_ _null_ _null_ _null_ pg_relation_filenode _null_ _null_ _null_ _null_ ) insert ( 3454 pg_filenode_relation 11 10 12 1 0 0 0 f f f t f s s 2 0 2205 '26 26' _null_ _null_ _null_ _null_ _null_ pg_filenode_relation _null_ _null_ _null_ _null_ ) insert ( 3034 pg_relation_filepath 11 10 12 1 0 0 0 f f f t f s s 1 0 25 2205 _null_ _null_ _null_ _null_ _null_ pg_relation_filepath _null_ _null_ _null_ _null_ ) insert ( 2316 postgresql_fdw_validator 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1009 26' _null_ _null_ _null_ _null_ _null_ postgresql_fdw_validator _null_ _null_ _null_ _null_ ) insert ( 2290 record_in 11 10 12 1 0 0 0 f f f t f s s 3 0 2249 '2275 26 23' _null_ _null_ _null_ _null_ _null_ record_in _null_ _null_ _null_ _null_ ) insert ( 2291 record_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2249 _null_ _null_ _null_ _null_ _null_ record_out _null_ _null_ _null_ _null_ ) insert ( 2292 cstring_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2275 _null_ _null_ _null_ _null_ _null_ cstring_in _null_ _null_ _null_ _null_ ) insert ( 2293 cstring_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2275 _null_ _null_ _null_ _null_ _null_ cstring_out _null_ _null_ _null_ _null_ ) insert ( 2294 any_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2276 2275 _null_ _null_ _null_ _null_ _null_ any_in _null_ _null_ _null_ _null_ ) insert ( 2295 any_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2276 _null_ _null_ _null_ _null_ _null_ any_out _null_ _null_ _null_ _null_ ) insert ( 2296 anyarray_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2277 2275 _null_ _null_ _null_ _null_ _null_ anyarray_in _null_ _null_ _null_ _null_ ) insert ( 2297 anyarray_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2277 _null_ _null_ _null_ _null_ _null_ anyarray_out _null_ _null_ _null_ _null_ ) insert ( 2298 void_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2275 _null_ _null_ _null_ _null_ _null_ void_in _null_ _null_ _null_ _null_ ) insert ( 2299 void_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2278 _null_ _null_ _null_ _null_ _null_ void_out _null_ _null_ _null_ _null_ ) insert ( 2300 trigger_in 11 10 12 1 0 0 0 f f f f f i s 1 0 2279 2275 _null_ _null_ _null_ _null_ _null_ trigger_in _null_ _null_ _null_ _null_ ) insert ( 2301 trigger_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2279 _null_ _null_ _null_ _null_ _null_ trigger_out _null_ _null_ _null_ _null_ ) insert ( 3594 event_trigger_in 11 10 12 1 0 0 0 f f f f f i s 1 0 3838 2275 _null_ _null_ _null_ _null_ _null_ event_trigger_in _null_ _null_ _null_ _null_ ) insert ( 3595 event_trigger_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3838 _null_ _null_ _null_ _null_ _null_ event_trigger_out _null_ _null_ _null_ _null_ ) insert ( 2302 language_handler_in 11 10 12 1 0 0 0 f f f f f i s 1 0 2280 2275 _null_ _null_ _null_ _null_ _null_ language_handler_in _null_ _null_ _null_ _null_ ) insert ( 2303 language_handler_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2280 _null_ _null_ _null_ _null_ _null_ language_handler_out _null_ _null_ _null_ _null_ ) insert ( 2304 internal_in 11 10 12 1 0 0 0 f f f f f i s 1 0 2281 2275 _null_ _null_ _null_ _null_ _null_ internal_in _null_ _null_ _null_ _null_ ) insert ( 2305 internal_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2281 _null_ _null_ _null_ _null_ _null_ internal_out _null_ _null_ _null_ _null_ ) insert ( 2312 anyelement_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2283 2275 _null_ _null_ _null_ _null_ _null_ anyelement_in _null_ _null_ _null_ _null_ ) insert ( 2313 anyelement_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2283 _null_ _null_ _null_ _null_ _null_ anyelement_out _null_ _null_ _null_ _null_ ) insert ( 2398 shell_in 11 10 12 1 0 0 0 f f f f f i s 1 0 2278 2275 _null_ _null_ _null_ _null_ _null_ shell_in _null_ _null_ _null_ _null_ ) insert ( 2399 shell_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2278 _null_ _null_ _null_ _null_ _null_ shell_out _null_ _null_ _null_ _null_ ) insert ( 2597 domain_in 11 10 12 1 0 0 0 f f f f f s s 3 0 2276 '2275 26 23' _null_ _null_ _null_ _null_ _null_ domain_in _null_ _null_ _null_ _null_ ) insert ( 2598 domain_recv 11 10 12 1 0 0 0 f f f f f s s 3 0 2276 '2281 26 23' _null_ _null_ _null_ _null_ _null_ domain_recv _null_ _null_ _null_ _null_ ) insert ( 2777 anynonarray_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2776 2275 _null_ _null_ _null_ _null_ _null_ anynonarray_in _null_ _null_ _null_ _null_ ) insert ( 2778 anynonarray_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2776 _null_ _null_ _null_ _null_ _null_ anynonarray_out _null_ _null_ _null_ _null_ ) insert ( 3116 fdw_handler_in 11 10 12 1 0 0 0 f f f f f i s 1 0 3115 2275 _null_ _null_ _null_ _null_ _null_ fdw_handler_in _null_ _null_ _null_ _null_ ) insert ( 3117 fdw_handler_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3115 _null_ _null_ _null_ _null_ _null_ fdw_handler_out _null_ _null_ _null_ _null_ ) insert ( 326 index_am_handler_in 11 10 12 1 0 0 0 f f f f f i s 1 0 325 2275 _null_ _null_ _null_ _null_ _null_ index_am_handler_in _null_ _null_ _null_ _null_ ) insert ( 327 index_am_handler_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 325 _null_ _null_ _null_ _null_ _null_ index_am_handler_out _null_ _null_ _null_ _null_ ) insert ( 3311 tsm_handler_in 11 10 12 1 0 0 0 f f f f f i s 1 0 3310 2275 _null_ _null_ _null_ _null_ _null_ tsm_handler_in _null_ _null_ _null_ _null_ ) insert ( 3312 tsm_handler_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3310 _null_ _null_ _null_ _null_ _null_ tsm_handler_out _null_ _null_ _null_ _null_ ) insert ( 267 table_am_handler_in 11 10 12 1 0 0 0 f f f f f i s 1 0 269 2275 _null_ _null_ _null_ _null_ _null_ table_am_handler_in _null_ _null_ _null_ _null_ ) insert ( 268 table_am_handler_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 269 _null_ _null_ _null_ _null_ _null_ table_am_handler_out _null_ _null_ _null_ _null_ ) insert ( 5086 anycompatible_in 11 10 12 1 0 0 0 f f f t f i s 1 0 5077 2275 _null_ _null_ _null_ _null_ _null_ anycompatible_in _null_ _null_ _null_ _null_ ) insert ( 5087 anycompatible_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 5077 _null_ _null_ _null_ _null_ _null_ anycompatible_out _null_ _null_ _null_ _null_ ) insert ( 5088 anycompatiblearray_in 11 10 12 1 0 0 0 f f f t f i s 1 0 5078 2275 _null_ _null_ _null_ _null_ _null_ anycompatiblearray_in _null_ _null_ _null_ _null_ ) insert ( 5089 anycompatiblearray_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 5078 _null_ _null_ _null_ _null_ _null_ anycompatiblearray_out _null_ _null_ _null_ _null_ ) insert ( 5090 anycompatiblearray_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 5078 2281 _null_ _null_ _null_ _null_ _null_ anycompatiblearray_recv _null_ _null_ _null_ _null_ ) insert ( 5091 anycompatiblearray_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 5078 _null_ _null_ _null_ _null_ _null_ anycompatiblearray_send _null_ _null_ _null_ _null_ ) insert ( 5092 anycompatiblenonarray_in 11 10 12 1 0 0 0 f f f t f i s 1 0 5079 2275 _null_ _null_ _null_ _null_ _null_ anycompatiblenonarray_in _null_ _null_ _null_ _null_ ) insert ( 5093 anycompatiblenonarray_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 5079 _null_ _null_ _null_ _null_ _null_ anycompatiblenonarray_out _null_ _null_ _null_ _null_ ) insert ( 5094 anycompatiblerange_in 11 10 12 1 0 0 0 f f f t f s s 3 0 5080 '2275 26 23' _null_ _null_ _null_ _null_ _null_ anycompatiblerange_in _null_ _null_ _null_ _null_ ) insert ( 5095 anycompatiblerange_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 5080 _null_ _null_ _null_ _null_ _null_ anycompatiblerange_out _null_ _null_ _null_ _null_ ) insert ( 4226 anycompatiblemultirange_in 11 10 12 1 0 0 0 f f f t f s s 3 0 4538 '2275 26 23' _null_ _null_ _null_ _null_ _null_ anycompatiblemultirange_in _null_ _null_ _null_ _null_ ) insert ( 4227 anycompatiblemultirange_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4538 _null_ _null_ _null_ _null_ _null_ anycompatiblemultirange_out _null_ _null_ _null_ _null_ ) insert ( 3313 bernoulli 11 10 12 1 0 0 0 f f f t f v s 1 0 3310 2281 _null_ _null_ _null_ _null_ _null_ tsm_bernoulli_handler _null_ _null_ _null_ _null_ ) insert ( 3314 system 11 10 12 1 0 0 0 f f f t f v s 1 0 3310 2281 _null_ _null_ _null_ _null_ _null_ tsm_system_handler _null_ _null_ _null_ _null_ ) insert ( 2311 md5 11 10 12 1 0 0 0 f f t t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ md5_text _null_ _null_ _null_ _null_ ) insert ( 2321 md5 11 10 12 1 0 0 0 f f t t f i s 1 0 25 17 _null_ _null_ _null_ _null_ _null_ md5_bytea _null_ _null_ _null_ _null_ ) insert ( 3419 sha224 11 10 12 1 0 0 0 f f t t f i s 1 0 17 17 _null_ _null_ _null_ _null_ _null_ sha224_bytea _null_ _null_ _null_ _null_ ) insert ( 3420 sha256 11 10 12 1 0 0 0 f f t t f i s 1 0 17 17 _null_ _null_ _null_ _null_ _null_ sha256_bytea _null_ _null_ _null_ _null_ ) insert ( 3421 sha384 11 10 12 1 0 0 0 f f t t f i s 1 0 17 17 _null_ _null_ _null_ _null_ _null_ sha384_bytea _null_ _null_ _null_ _null_ ) insert ( 3422 sha512 11 10 12 1 0 0 0 f f t t f i s 1 0 17 17 _null_ _null_ _null_ _null_ _null_ sha512_bytea _null_ _null_ _null_ _null_ ) insert ( 2338 date_lt_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_lt_timestamp _null_ _null_ _null_ _null_ ) insert ( 2339 date_le_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_le_timestamp _null_ _null_ _null_ _null_ ) insert ( 2340 date_eq_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_eq_timestamp _null_ _null_ _null_ _null_ ) insert ( 2341 date_gt_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_gt_timestamp _null_ _null_ _null_ _null_ ) insert ( 2342 date_ge_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_ge_timestamp _null_ _null_ _null_ _null_ ) insert ( 2343 date_ne_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_ne_timestamp _null_ _null_ _null_ _null_ ) insert ( 2344 date_cmp_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1082 1114' _null_ _null_ _null_ _null_ _null_ date_cmp_timestamp _null_ _null_ _null_ _null_ ) insert ( 2351 date_lt_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_lt_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2352 date_le_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_le_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2353 date_eq_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_eq_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2354 date_gt_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_gt_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2355 date_ge_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_ge_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2356 date_ne_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_ne_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2357 date_cmp_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 23 '1082 1184' _null_ _null_ _null_ _null_ _null_ date_cmp_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2364 timestamp_lt_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_lt_date _null_ _null_ _null_ _null_ ) insert ( 2365 timestamp_le_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_le_date _null_ _null_ _null_ _null_ ) insert ( 2366 timestamp_eq_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_eq_date _null_ _null_ _null_ _null_ ) insert ( 2367 timestamp_gt_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_gt_date _null_ _null_ _null_ _null_ ) insert ( 2368 timestamp_ge_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_ge_date _null_ _null_ _null_ _null_ ) insert ( 2369 timestamp_ne_date 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_ne_date _null_ _null_ _null_ _null_ ) insert ( 2370 timestamp_cmp_date 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '1114 1082' _null_ _null_ _null_ _null_ _null_ timestamp_cmp_date _null_ _null_ _null_ _null_ ) insert ( 2377 timestamptz_lt_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_lt_date _null_ _null_ _null_ _null_ ) insert ( 2378 timestamptz_le_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_le_date _null_ _null_ _null_ _null_ ) insert ( 2379 timestamptz_eq_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_eq_date _null_ _null_ _null_ _null_ ) insert ( 2380 timestamptz_gt_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_gt_date _null_ _null_ _null_ _null_ ) insert ( 2381 timestamptz_ge_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_ge_date _null_ _null_ _null_ _null_ ) insert ( 2382 timestamptz_ne_date 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_ne_date _null_ _null_ _null_ _null_ ) insert ( 2383 timestamptz_cmp_date 11 10 12 1 0 0 0 f f f t f s s 2 0 23 '1184 1082' _null_ _null_ _null_ _null_ _null_ timestamptz_cmp_date _null_ _null_ _null_ _null_ ) insert ( 2520 timestamp_lt_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_lt_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2521 timestamp_le_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_le_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2522 timestamp_eq_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_eq_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2523 timestamp_gt_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_gt_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2524 timestamp_ge_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_ge_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2525 timestamp_ne_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_ne_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2526 timestamp_cmp_timestamptz 11 10 12 1 0 0 0 f f f t f s s 2 0 23 '1114 1184' _null_ _null_ _null_ _null_ _null_ timestamp_cmp_timestamptz _null_ _null_ _null_ _null_ ) insert ( 2527 timestamptz_lt_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_lt_timestamp _null_ _null_ _null_ _null_ ) insert ( 2528 timestamptz_le_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_le_timestamp _null_ _null_ _null_ _null_ ) insert ( 2529 timestamptz_eq_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_eq_timestamp _null_ _null_ _null_ _null_ ) insert ( 2530 timestamptz_gt_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_gt_timestamp _null_ _null_ _null_ _null_ ) insert ( 2531 timestamptz_ge_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_ge_timestamp _null_ _null_ _null_ _null_ ) insert ( 2532 timestamptz_ne_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 16 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_ne_timestamp _null_ _null_ _null_ _null_ ) insert ( 2533 timestamptz_cmp_timestamp 11 10 12 1 0 0 0 f f f t f s s 2 0 23 '1184 1114' _null_ _null_ _null_ _null_ _null_ timestamptz_cmp_timestamp _null_ _null_ _null_ _null_ ) insert ( 2400 array_recv 11 10 12 1 0 0 0 f f f t f s s 3 0 2277 '2281 26 23' _null_ _null_ _null_ _null_ _null_ array_recv _null_ _null_ _null_ _null_ ) insert ( 2401 array_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 2277 _null_ _null_ _null_ _null_ _null_ array_send _null_ _null_ _null_ _null_ ) insert ( 2402 record_recv 11 10 12 1 0 0 0 f f f t f s s 3 0 2249 '2281 26 23' _null_ _null_ _null_ _null_ _null_ record_recv _null_ _null_ _null_ _null_ ) insert ( 2403 record_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 2249 _null_ _null_ _null_ _null_ _null_ record_send _null_ _null_ _null_ _null_ ) insert ( 2404 int2recv 11 10 12 1 0 0 0 f f f t f i s 1 0 21 2281 _null_ _null_ _null_ _null_ _null_ int2recv _null_ _null_ _null_ _null_ ) insert ( 2405 int2send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 21 _null_ _null_ _null_ _null_ _null_ int2send _null_ _null_ _null_ _null_ ) insert ( 2406 int4recv 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2281 _null_ _null_ _null_ _null_ _null_ int4recv _null_ _null_ _null_ _null_ ) insert ( 2407 int4send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 23 _null_ _null_ _null_ _null_ _null_ int4send _null_ _null_ _null_ _null_ ) insert ( 2408 int8recv 11 10 12 1 0 0 0 f f f t f i s 1 0 20 2281 _null_ _null_ _null_ _null_ _null_ int8recv _null_ _null_ _null_ _null_ ) insert ( 2409 int8send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 20 _null_ _null_ _null_ _null_ _null_ int8send _null_ _null_ _null_ _null_ ) insert ( 2410 int2vectorrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 22 2281 _null_ _null_ _null_ _null_ _null_ int2vectorrecv _null_ _null_ _null_ _null_ ) insert ( 2411 int2vectorsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 22 _null_ _null_ _null_ _null_ _null_ int2vectorsend _null_ _null_ _null_ _null_ ) insert ( 2412 bytearecv 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2281 _null_ _null_ _null_ _null_ _null_ bytearecv _null_ _null_ _null_ _null_ ) insert ( 2413 byteasend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 17 _null_ _null_ _null_ _null_ _null_ byteasend _null_ _null_ _null_ _null_ ) insert ( 2414 textrecv 11 10 12 1 0 0 0 f f f t f s s 1 0 25 2281 _null_ _null_ _null_ _null_ _null_ textrecv _null_ _null_ _null_ _null_ ) insert ( 2415 textsend 11 10 12 1 0 0 0 f f f t f s s 1 0 17 25 _null_ _null_ _null_ _null_ _null_ textsend _null_ _null_ _null_ _null_ ) insert ( 2416 unknownrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 705 2281 _null_ _null_ _null_ _null_ _null_ unknownrecv _null_ _null_ _null_ _null_ ) insert ( 2417 unknownsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 705 _null_ _null_ _null_ _null_ _null_ unknownsend _null_ _null_ _null_ _null_ ) insert ( 2418 oidrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 26 2281 _null_ _null_ _null_ _null_ _null_ oidrecv _null_ _null_ _null_ _null_ ) insert ( 2419 oidsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 26 _null_ _null_ _null_ _null_ _null_ oidsend _null_ _null_ _null_ _null_ ) insert ( 2420 oidvectorrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 30 2281 _null_ _null_ _null_ _null_ _null_ oidvectorrecv _null_ _null_ _null_ _null_ ) insert ( 2421 oidvectorsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 30 _null_ _null_ _null_ _null_ _null_ oidvectorsend _null_ _null_ _null_ _null_ ) insert ( 2422 namerecv 11 10 12 1 0 0 0 f f f t f s s 1 0 19 2281 _null_ _null_ _null_ _null_ _null_ namerecv _null_ _null_ _null_ _null_ ) insert ( 2423 namesend 11 10 12 1 0 0 0 f f f t f s s 1 0 17 19 _null_ _null_ _null_ _null_ _null_ namesend _null_ _null_ _null_ _null_ ) insert ( 2424 float4recv 11 10 12 1 0 0 0 f f f t f i s 1 0 700 2281 _null_ _null_ _null_ _null_ _null_ float4recv _null_ _null_ _null_ _null_ ) insert ( 2425 float4send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 700 _null_ _null_ _null_ _null_ _null_ float4send _null_ _null_ _null_ _null_ ) insert ( 2426 float8recv 11 10 12 1 0 0 0 f f f t f i s 1 0 701 2281 _null_ _null_ _null_ _null_ _null_ float8recv _null_ _null_ _null_ _null_ ) insert ( 2427 float8send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 701 _null_ _null_ _null_ _null_ _null_ float8send _null_ _null_ _null_ _null_ ) insert ( 2428 point_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 600 2281 _null_ _null_ _null_ _null_ _null_ point_recv _null_ _null_ _null_ _null_ ) insert ( 2429 point_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 600 _null_ _null_ _null_ _null_ _null_ point_send _null_ _null_ _null_ _null_ ) insert ( 2430 bpcharrecv 11 10 12 1 0 0 0 f f f t f s s 3 0 1042 '2281 26 23' _null_ _null_ _null_ _null_ _null_ bpcharrecv _null_ _null_ _null_ _null_ ) insert ( 2431 bpcharsend 11 10 12 1 0 0 0 f f f t f s s 1 0 17 1042 _null_ _null_ _null_ _null_ _null_ bpcharsend _null_ _null_ _null_ _null_ ) insert ( 2432 varcharrecv 11 10 12 1 0 0 0 f f f t f s s 3 0 1043 '2281 26 23' _null_ _null_ _null_ _null_ _null_ varcharrecv _null_ _null_ _null_ _null_ ) insert ( 2433 varcharsend 11 10 12 1 0 0 0 f f f t f s s 1 0 17 1043 _null_ _null_ _null_ _null_ _null_ varcharsend _null_ _null_ _null_ _null_ ) insert ( 2434 charrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 18 2281 _null_ _null_ _null_ _null_ _null_ charrecv _null_ _null_ _null_ _null_ ) insert ( 2435 charsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 18 _null_ _null_ _null_ _null_ _null_ charsend _null_ _null_ _null_ _null_ ) insert ( 2436 boolrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ boolrecv _null_ _null_ _null_ _null_ ) insert ( 2437 boolsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 16 _null_ _null_ _null_ _null_ _null_ boolsend _null_ _null_ _null_ _null_ ) insert ( 2438 tidrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 27 2281 _null_ _null_ _null_ _null_ _null_ tidrecv _null_ _null_ _null_ _null_ ) insert ( 2439 tidsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 27 _null_ _null_ _null_ _null_ _null_ tidsend _null_ _null_ _null_ _null_ ) insert ( 2440 xidrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 28 2281 _null_ _null_ _null_ _null_ _null_ xidrecv _null_ _null_ _null_ _null_ ) insert ( 2441 xidsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 28 _null_ _null_ _null_ _null_ _null_ xidsend _null_ _null_ _null_ _null_ ) insert ( 2442 cidrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 29 2281 _null_ _null_ _null_ _null_ _null_ cidrecv _null_ _null_ _null_ _null_ ) insert ( 2443 cidsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 29 _null_ _null_ _null_ _null_ _null_ cidsend _null_ _null_ _null_ _null_ ) insert ( 2444 regprocrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 24 2281 _null_ _null_ _null_ _null_ _null_ regprocrecv _null_ _null_ _null_ _null_ ) insert ( 2445 regprocsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 24 _null_ _null_ _null_ _null_ _null_ regprocsend _null_ _null_ _null_ _null_ ) insert ( 2446 regprocedurerecv 11 10 12 1 0 0 0 f f f t f i s 1 0 2202 2281 _null_ _null_ _null_ _null_ _null_ regprocedurerecv _null_ _null_ _null_ _null_ ) insert ( 2447 regproceduresend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2202 _null_ _null_ _null_ _null_ _null_ regproceduresend _null_ _null_ _null_ _null_ ) insert ( 2448 regoperrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 2203 2281 _null_ _null_ _null_ _null_ _null_ regoperrecv _null_ _null_ _null_ _null_ ) insert ( 2449 regopersend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2203 _null_ _null_ _null_ _null_ _null_ regopersend _null_ _null_ _null_ _null_ ) insert ( 2450 regoperatorrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 2204 2281 _null_ _null_ _null_ _null_ _null_ regoperatorrecv _null_ _null_ _null_ _null_ ) insert ( 2451 regoperatorsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2204 _null_ _null_ _null_ _null_ _null_ regoperatorsend _null_ _null_ _null_ _null_ ) insert ( 2452 regclassrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 2205 2281 _null_ _null_ _null_ _null_ _null_ regclassrecv _null_ _null_ _null_ _null_ ) insert ( 2453 regclasssend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2205 _null_ _null_ _null_ _null_ _null_ regclasssend _null_ _null_ _null_ _null_ ) insert ( 4196 regcollationrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 4191 2281 _null_ _null_ _null_ _null_ _null_ regcollationrecv _null_ _null_ _null_ _null_ ) insert ( 4197 regcollationsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 4191 _null_ _null_ _null_ _null_ _null_ regcollationsend _null_ _null_ _null_ _null_ ) insert ( 2454 regtyperecv 11 10 12 1 0 0 0 f f f t f i s 1 0 2206 2281 _null_ _null_ _null_ _null_ _null_ regtyperecv _null_ _null_ _null_ _null_ ) insert ( 2455 regtypesend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2206 _null_ _null_ _null_ _null_ _null_ regtypesend _null_ _null_ _null_ _null_ ) insert ( 4094 regrolerecv 11 10 12 1 0 0 0 f f f t f i s 1 0 4096 2281 _null_ _null_ _null_ _null_ _null_ regrolerecv _null_ _null_ _null_ _null_ ) insert ( 4095 regrolesend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 4096 _null_ _null_ _null_ _null_ _null_ regrolesend _null_ _null_ _null_ _null_ ) insert ( 4087 regnamespacerecv 11 10 12 1 0 0 0 f f f t f i s 1 0 4089 2281 _null_ _null_ _null_ _null_ _null_ regnamespacerecv _null_ _null_ _null_ _null_ ) insert ( 4088 regnamespacesend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 4089 _null_ _null_ _null_ _null_ _null_ regnamespacesend _null_ _null_ _null_ _null_ ) insert ( 2456 bit_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1560 '2281 26 23' _null_ _null_ _null_ _null_ _null_ bit_recv _null_ _null_ _null_ _null_ ) insert ( 2457 bit_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1560 _null_ _null_ _null_ _null_ _null_ bit_send _null_ _null_ _null_ _null_ ) insert ( 2458 varbit_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1562 '2281 26 23' _null_ _null_ _null_ _null_ _null_ varbit_recv _null_ _null_ _null_ _null_ ) insert ( 2459 varbit_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1562 _null_ _null_ _null_ _null_ _null_ varbit_send _null_ _null_ _null_ _null_ ) insert ( 2460 numeric_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1700 '2281 26 23' _null_ _null_ _null_ _null_ _null_ numeric_recv _null_ _null_ _null_ _null_ ) insert ( 2461 numeric_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1700 _null_ _null_ _null_ _null_ _null_ numeric_send _null_ _null_ _null_ _null_ ) insert ( 2468 date_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 1082 2281 _null_ _null_ _null_ _null_ _null_ date_recv _null_ _null_ _null_ _null_ ) insert ( 2469 date_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1082 _null_ _null_ _null_ _null_ _null_ date_send _null_ _null_ _null_ _null_ ) insert ( 2470 time_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1083 '2281 26 23' _null_ _null_ _null_ _null_ _null_ time_recv _null_ _null_ _null_ _null_ ) insert ( 2471 time_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1083 _null_ _null_ _null_ _null_ _null_ time_send _null_ _null_ _null_ _null_ ) insert ( 2472 timetz_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1266 '2281 26 23' _null_ _null_ _null_ _null_ _null_ timetz_recv _null_ _null_ _null_ _null_ ) insert ( 2473 timetz_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1266 _null_ _null_ _null_ _null_ _null_ timetz_send _null_ _null_ _null_ _null_ ) insert ( 2474 timestamp_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1114 '2281 26 23' _null_ _null_ _null_ _null_ _null_ timestamp_recv _null_ _null_ _null_ _null_ ) insert ( 2475 timestamp_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1114 _null_ _null_ _null_ _null_ _null_ timestamp_send _null_ _null_ _null_ _null_ ) insert ( 2476 timestamptz_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1184 '2281 26 23' _null_ _null_ _null_ _null_ _null_ timestamptz_recv _null_ _null_ _null_ _null_ ) insert ( 2477 timestamptz_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1184 _null_ _null_ _null_ _null_ _null_ timestamptz_send _null_ _null_ _null_ _null_ ) insert ( 2478 interval_recv 11 10 12 1 0 0 0 f f f t f i s 3 0 1186 '2281 26 23' _null_ _null_ _null_ _null_ _null_ interval_recv _null_ _null_ _null_ _null_ ) insert ( 2479 interval_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 1186 _null_ _null_ _null_ _null_ _null_ interval_send _null_ _null_ _null_ _null_ ) insert ( 2480 lseg_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 601 2281 _null_ _null_ _null_ _null_ _null_ lseg_recv _null_ _null_ _null_ _null_ ) insert ( 2481 lseg_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 601 _null_ _null_ _null_ _null_ _null_ lseg_send _null_ _null_ _null_ _null_ ) insert ( 2482 path_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 602 2281 _null_ _null_ _null_ _null_ _null_ path_recv _null_ _null_ _null_ _null_ ) insert ( 2483 path_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 602 _null_ _null_ _null_ _null_ _null_ path_send _null_ _null_ _null_ _null_ ) insert ( 2484 box_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 603 2281 _null_ _null_ _null_ _null_ _null_ box_recv _null_ _null_ _null_ _null_ ) insert ( 2485 box_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 603 _null_ _null_ _null_ _null_ _null_ box_send _null_ _null_ _null_ _null_ ) insert ( 2486 poly_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 604 2281 _null_ _null_ _null_ _null_ _null_ poly_recv _null_ _null_ _null_ _null_ ) insert ( 2487 poly_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 604 _null_ _null_ _null_ _null_ _null_ poly_send _null_ _null_ _null_ _null_ ) insert ( 2488 line_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 628 2281 _null_ _null_ _null_ _null_ _null_ line_recv _null_ _null_ _null_ _null_ ) insert ( 2489 line_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 628 _null_ _null_ _null_ _null_ _null_ line_send _null_ _null_ _null_ _null_ ) insert ( 2490 circle_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 718 2281 _null_ _null_ _null_ _null_ _null_ circle_recv _null_ _null_ _null_ _null_ ) insert ( 2491 circle_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 718 _null_ _null_ _null_ _null_ _null_ circle_send _null_ _null_ _null_ _null_ ) insert ( 2492 cash_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 790 2281 _null_ _null_ _null_ _null_ _null_ cash_recv _null_ _null_ _null_ _null_ ) insert ( 2493 cash_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 790 _null_ _null_ _null_ _null_ _null_ cash_send _null_ _null_ _null_ _null_ ) insert ( 2494 macaddr_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 829 2281 _null_ _null_ _null_ _null_ _null_ macaddr_recv _null_ _null_ _null_ _null_ ) insert ( 2495 macaddr_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 829 _null_ _null_ _null_ _null_ _null_ macaddr_send _null_ _null_ _null_ _null_ ) insert ( 2496 inet_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 869 2281 _null_ _null_ _null_ _null_ _null_ inet_recv _null_ _null_ _null_ _null_ ) insert ( 2497 inet_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 869 _null_ _null_ _null_ _null_ _null_ inet_send _null_ _null_ _null_ _null_ ) insert ( 2498 cidr_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 650 2281 _null_ _null_ _null_ _null_ _null_ cidr_recv _null_ _null_ _null_ _null_ ) insert ( 2499 cidr_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 650 _null_ _null_ _null_ _null_ _null_ cidr_send _null_ _null_ _null_ _null_ ) insert ( 2500 cstring_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 2281 _null_ _null_ _null_ _null_ _null_ cstring_recv _null_ _null_ _null_ _null_ ) insert ( 2501 cstring_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 2275 _null_ _null_ _null_ _null_ _null_ cstring_send _null_ _null_ _null_ _null_ ) insert ( 2502 anyarray_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 2277 2281 _null_ _null_ _null_ _null_ _null_ anyarray_recv _null_ _null_ _null_ _null_ ) insert ( 2503 anyarray_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 2277 _null_ _null_ _null_ _null_ _null_ anyarray_send _null_ _null_ _null_ _null_ ) insert ( 3120 void_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ void_recv _null_ _null_ _null_ _null_ ) insert ( 3121 void_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2278 _null_ _null_ _null_ _null_ _null_ void_send _null_ _null_ _null_ _null_ ) insert ( 3446 macaddr8_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 774 2281 _null_ _null_ _null_ _null_ _null_ macaddr8_recv _null_ _null_ _null_ _null_ ) insert ( 3447 macaddr8_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 774 _null_ _null_ _null_ _null_ _null_ macaddr8_send _null_ _null_ _null_ _null_ ) insert ( 2504 pg_get_ruledef 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '26 16' _null_ _null_ _null_ _null_ _null_ pg_get_ruledef_ext _null_ _null_ _null_ _null_ ) insert ( 2505 pg_get_viewdef 11 10 12 1 0 0 0 f f f t f s r 2 0 25 '25 16' _null_ _null_ _null_ _null_ _null_ pg_get_viewdef_name_ext _null_ _null_ _null_ _null_ ) insert ( 2506 pg_get_viewdef 11 10 12 1 0 0 0 f f f t f s r 2 0 25 '26 16' _null_ _null_ _null_ _null_ _null_ pg_get_viewdef_ext _null_ _null_ _null_ _null_ ) insert ( 3159 pg_get_viewdef 11 10 12 1 0 0 0 f f f t f s r 2 0 25 '26 23' _null_ _null_ _null_ _null_ _null_ pg_get_viewdef_wrap _null_ _null_ _null_ _null_ ) insert ( 2507 pg_get_indexdef 11 10 12 1 0 0 0 f f f t f s s 3 0 25 '26 23 16' _null_ _null_ _null_ _null_ _null_ pg_get_indexdef_ext _null_ _null_ _null_ _null_ ) insert ( 2508 pg_get_constraintdef 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '26 16' _null_ _null_ _null_ _null_ _null_ pg_get_constraintdef_ext _null_ _null_ _null_ _null_ ) insert ( 2509 pg_get_expr 11 10 12 1 0 0 0 f f f t f s s 3 0 25 '194 26 16' _null_ _null_ _null_ _null_ _null_ pg_get_expr_ext _null_ _null_ _null_ _null_ ) insert ( 2510 pg_prepared_statement 11 10 12 1 1000 0 0 f f f t t s r 0 0 2249 '' '{25,25,1184,2211,2211,16,20,20}' '{o,o,o,o,o,o,o,o}' '{name,statement,prepare_time,parameter_types,result_types,from_sql,generic_plans,custom_plans}' _null_ _null_ pg_prepared_statement _null_ _null_ _null_ _null_ ) insert ( 2511 pg_cursor 11 10 12 1 1000 0 0 f f f t t s r 0 0 2249 '' '{25,25,16,16,16,1184}' '{o,o,o,o,o,o}' '{name,statement,is_holdable,is_binary,is_scrollable,creation_time}' _null_ _null_ pg_cursor _null_ _null_ _null_ _null_ ) insert ( 2599 pg_timezone_abbrevs 11 10 12 1 1000 0 0 f f f t t s s 0 0 2249 '' '{25,1186,16}' '{o,o,o}' '{abbrev,utc_offset,is_dst}' _null_ _null_ pg_timezone_abbrevs _null_ _null_ _null_ _null_ ) insert ( 2856 pg_timezone_names 11 10 12 1 1000 0 0 f f f t t s s 0 0 2249 '' '{25,25,1186,16}' '{o,o,o,o}' '{name,abbrev,utc_offset,is_dst}' _null_ _null_ pg_timezone_names _null_ _null_ _null_ _null_ ) insert ( 2730 pg_get_triggerdef 11 10 12 1 0 0 0 f f f t f s s 2 0 25 '26 16' _null_ _null_ _null_ _null_ _null_ pg_get_triggerdef_ext _null_ _null_ _null_ _null_ ) insert ( 3035 pg_listening_channels 11 10 12 1 10 0 0 f f f t t s r 0 0 25 '' _null_ _null_ _null_ _null_ _null_ pg_listening_channels _null_ _null_ _null_ _null_ ) insert ( 3036 pg_notify 11 10 12 1 0 0 0 f f f f f v r 2 0 2278 '25 25' _null_ _null_ _null_ _null_ _null_ pg_notify _null_ _null_ _null_ _null_ ) insert ( 3296 pg_notification_queue_usage 11 10 12 1 0 0 0 f f f t f v r 0 0 701 '' _null_ _null_ _null_ _null_ _null_ pg_notification_queue_usage _null_ _null_ _null_ _null_ ) insert ( 5052 pg_get_shmem_allocations 11 10 12 1 50 0 0 f f f t t v s 0 0 2249 '' '{25,20,20,20}' '{o,o,o,o}' '{name,off,size,allocated_size}' _null_ _null_ pg_get_shmem_allocations _null_ _null_ _null_ _null_ ) insert ( 2282 pg_get_backend_memory_contexts 11 10 12 1 100 0 0 f f f t t v r 0 0 2249 '' '{25,25,25,23,20,20,20,20,20}' '{o,o,o,o,o,o,o,o,o}' '{name, ident, parent, level, total_bytes, total_nblocks, free_bytes, free_chunks, used_bytes}' _null_ _null_ pg_get_backend_memory_contexts _null_ _null_ _null_ _null_ ) insert ( 4543 pg_log_backend_memory_contexts 11 10 12 1 0 0 0 f f f t f v s 1 0 16 23 _null_ _null_ _null_ _null_ _null_ pg_log_backend_memory_contexts _null_ _null_ _null_ _null_ ) insert ( 1066 generate_series 11 10 12 1 1000 0 3994 f f f t t i s 3 0 23 '23 23 23' _null_ _null_ _null_ _null_ _null_ generate_series_step_int4 _null_ _null_ _null_ _null_ ) insert ( 1067 generate_series 11 10 12 1 1000 0 3994 f f f t t i s 2 0 23 '23 23' _null_ _null_ _null_ _null_ _null_ generate_series_int4 _null_ _null_ _null_ _null_ ) insert ( 3994 generate_series_int4_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ generate_series_int4_support _null_ _null_ _null_ _null_ ) insert ( 1068 generate_series 11 10 12 1 1000 0 3995 f f f t t i s 3 0 20 '20 20 20' _null_ _null_ _null_ _null_ _null_ generate_series_step_int8 _null_ _null_ _null_ _null_ ) insert ( 1069 generate_series 11 10 12 1 1000 0 3995 f f f t t i s 2 0 20 '20 20' _null_ _null_ _null_ _null_ _null_ generate_series_int8 _null_ _null_ _null_ _null_ ) insert ( 3995 generate_series_int8_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ generate_series_int8_support _null_ _null_ _null_ _null_ ) insert ( 3259 generate_series 11 10 12 1 1000 0 0 f f f t t i s 3 0 1700 '1700 1700 1700' _null_ _null_ _null_ _null_ _null_ generate_series_step_numeric _null_ _null_ _null_ _null_ ) insert ( 3260 generate_series 11 10 12 1 1000 0 0 f f f t t i s 2 0 1700 '1700 1700' _null_ _null_ _null_ _null_ _null_ generate_series_numeric _null_ _null_ _null_ _null_ ) insert ( 938 generate_series 11 10 12 1 1000 0 0 f f f t t i s 3 0 1114 '1114 1114 1186' _null_ _null_ _null_ _null_ _null_ generate_series_timestamp _null_ _null_ _null_ _null_ ) insert ( 939 generate_series 11 10 12 1 1000 0 0 f f f t t s s 3 0 1184 '1184 1184 1186' _null_ _null_ _null_ _null_ _null_ generate_series_timestamptz _null_ _null_ _null_ _null_ ) insert ( 6274 generate_series 11 10 12 1 1000 0 0 f f f t t i s 4 0 1184 '1184 1184 1186 25' _null_ _null_ _null_ _null_ _null_ generate_series_timestamptz_at_zone _null_ _null_ _null_ _null_ ) insert ( 2515 booland_statefunc 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ booland_statefunc _null_ _null_ _null_ _null_ ) insert ( 2516 boolor_statefunc 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '16 16' _null_ _null_ _null_ _null_ _null_ boolor_statefunc _null_ _null_ _null_ _null_ ) insert ( 3496 bool_accum 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 16' _null_ _null_ _null_ _null_ _null_ bool_accum _null_ _null_ _null_ _null_ ) insert ( 3497 bool_accum_inv 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 16' _null_ _null_ _null_ _null_ _null_ bool_accum_inv _null_ _null_ _null_ _null_ ) insert ( 3498 bool_alltrue 11 10 12 1 0 0 0 f f f t f i s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ bool_alltrue _null_ _null_ _null_ _null_ ) insert ( 3499 bool_anytrue 11 10 12 1 0 0 0 f f f t f i s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ bool_anytrue _null_ _null_ _null_ _null_ ) insert ( 2517 bool_and 11 10 12 1 0 0 0 a f f f f i s 1 0 16 16 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2518 bool_or 11 10 12 1 0 0 0 a f f f f i s 1 0 16 16 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2519 every 11 10 12 1 0 0 0 a f f f f i s 1 0 16 16 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2236 bit_and 11 10 12 1 0 0 0 a f f f f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2237 bit_or 11 10 12 1 0 0 0 a f f f f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6164 bit_xor 11 10 12 1 0 0 0 a f f f f i s 1 0 21 21 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2238 bit_and 11 10 12 1 0 0 0 a f f f f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2239 bit_or 11 10 12 1 0 0 0 a f f f f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6165 bit_xor 11 10 12 1 0 0 0 a f f f f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2240 bit_and 11 10 12 1 0 0 0 a f f f f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2241 bit_or 11 10 12 1 0 0 0 a f f f f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6166 bit_xor 11 10 12 1 0 0 0 a f f f f i s 1 0 20 20 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2242 bit_and 11 10 12 1 0 0 0 a f f f f i s 1 0 1560 1560 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2243 bit_or 11 10 12 1 0 0 0 a f f f f i s 1 0 1560 1560 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6167 bit_xor 11 10 12 1 0 0 0 a f f f f i s 1 0 1560 1560 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2546 interval_pl_date 11 10 14 1 0 0 0 f f f t f i s 2 0 1114 '1186 1082' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2547 interval_pl_timetz 11 10 14 1 0 0 0 f f f t f i s 2 0 1266 '1186 1266' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2548 interval_pl_timestamp 11 10 14 1 0 0 0 f f f t f i s 2 0 1114 '1186 1114' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2549 interval_pl_timestamptz 11 10 14 1 0 0 0 f f f t f s s 2 0 1184 '1186 1184' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2550 integer_pl_date 11 10 14 1 0 0 0 f f f t f i s 2 0 1082 '23 1082' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2556 pg_tablespace_databases 11 10 12 1 1000 0 0 f f f t t s s 1 0 26 26 _null_ _null_ _null_ _null_ _null_ pg_tablespace_databases _null_ _null_ _null_ _null_ ) insert ( 2557 bool 11 10 12 1 0 0 0 f f t t f i s 1 0 16 23 _null_ _null_ _null_ _null_ _null_ int4_bool _null_ _null_ _null_ _null_ ) insert ( 2558 int4 11 10 12 1 0 0 0 f f t t f i s 1 0 23 16 _null_ _null_ _null_ _null_ _null_ bool_int4 _null_ _null_ _null_ _null_ ) insert ( 2559 lastval 11 10 12 1 0 0 0 f f f t f v u 0 0 20 '' _null_ _null_ _null_ _null_ _null_ lastval _null_ _null_ _null_ _null_ ) insert ( 2560 pg_postmaster_start_time 11 10 12 1 0 0 0 f f f t f s s 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_postmaster_start_time _null_ _null_ _null_ _null_ ) insert ( 2034 pg_conf_load_time 11 10 12 1 0 0 0 f f f t f s r 0 0 1184 '' _null_ _null_ _null_ _null_ _null_ pg_conf_load_time _null_ _null_ _null_ _null_ ) insert ( 2562 box_below 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_below _null_ _null_ _null_ _null_ ) insert ( 2563 box_overbelow 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_overbelow _null_ _null_ _null_ _null_ ) insert ( 2564 box_overabove 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_overabove _null_ _null_ _null_ _null_ ) insert ( 2565 box_above 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '603 603' _null_ _null_ _null_ _null_ _null_ box_above _null_ _null_ _null_ _null_ ) insert ( 2566 poly_below 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_below _null_ _null_ _null_ _null_ ) insert ( 2567 poly_overbelow 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_overbelow _null_ _null_ _null_ _null_ ) insert ( 2568 poly_overabove 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_overabove _null_ _null_ _null_ _null_ ) insert ( 2569 poly_above 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '604 604' _null_ _null_ _null_ _null_ _null_ poly_above _null_ _null_ _null_ _null_ ) insert ( 2587 circle_overbelow 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_overbelow _null_ _null_ _null_ _null_ ) insert ( 2588 circle_overabove 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '718 718' _null_ _null_ _null_ _null_ _null_ circle_overabove _null_ _null_ _null_ _null_ ) insert ( 2578 gist_box_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 603 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_box_consistent _null_ _null_ _null_ _null_ ) insert ( 2581 gist_box_penalty 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gist_box_penalty _null_ _null_ _null_ _null_ ) insert ( 2582 gist_box_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ gist_box_picksplit _null_ _null_ _null_ _null_ ) insert ( 2583 gist_box_union 11 10 12 1 0 0 0 f f f t f i s 2 0 603 '2281 2281' _null_ _null_ _null_ _null_ _null_ gist_box_union _null_ _null_ _null_ _null_ ) insert ( 2584 gist_box_same 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '603 603 2281' _null_ _null_ _null_ _null_ _null_ gist_box_same _null_ _null_ _null_ _null_ ) insert ( 3998 gist_box_distance 11 10 12 1 0 0 0 f f f t f i s 5 0 701 '2281 603 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_box_distance _null_ _null_ _null_ _null_ ) insert ( 2585 gist_poly_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 604 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_poly_consistent _null_ _null_ _null_ _null_ ) insert ( 2586 gist_poly_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gist_poly_compress _null_ _null_ _null_ _null_ ) insert ( 2591 gist_circle_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 718 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_circle_consistent _null_ _null_ _null_ _null_ ) insert ( 2592 gist_circle_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gist_circle_compress _null_ _null_ _null_ _null_ ) insert ( 1030 gist_point_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gist_point_compress _null_ _null_ _null_ _null_ ) insert ( 3282 gist_point_fetch 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gist_point_fetch _null_ _null_ _null_ _null_ ) insert ( 2179 gist_point_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 600 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_point_consistent _null_ _null_ _null_ _null_ ) insert ( 3064 gist_point_distance 11 10 12 1 0 0 0 f f f t f i s 5 0 701 '2281 600 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_point_distance _null_ _null_ _null_ _null_ ) insert ( 3280 gist_circle_distance 11 10 12 1 0 0 0 f f f t f i s 5 0 701 '2281 718 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_circle_distance _null_ _null_ _null_ _null_ ) insert ( 3288 gist_poly_distance 11 10 12 1 0 0 0 f f f t f i s 5 0 701 '2281 604 21 26 2281' _null_ _null_ _null_ _null_ _null_ gist_poly_distance _null_ _null_ _null_ _null_ ) insert ( 3435 gist_point_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ gist_point_sortsupport _null_ _null_ _null_ _null_ ) insert ( 2743 ginarrayextract 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2277 2281 2281' _null_ _null_ _null_ _null_ _null_ ginarrayextract _null_ _null_ _null_ _null_ ) insert ( 2774 ginqueryarrayextract 11 10 12 1 0 0 0 f f f t f i s 7 0 2281 '2277 2281 21 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ ginqueryarrayextract _null_ _null_ _null_ _null_ ) insert ( 2744 ginarrayconsistent 11 10 12 1 0 0 0 f f f t f i s 8 0 16 '2281 21 2277 23 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ ginarrayconsistent _null_ _null_ _null_ _null_ ) insert ( 3920 ginarraytriconsistent 11 10 12 1 0 0 0 f f f t f i s 7 0 18 '2281 21 2277 23 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ ginarraytriconsistent _null_ _null_ _null_ _null_ ) insert ( 3076 ginarrayextract 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2277 2281' _null_ _null_ _null_ _null_ _null_ ginarrayextract_2args _null_ _null_ _null_ _null_ ) insert ( 2747 arrayoverlap 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ arrayoverlap _null_ _null_ _null_ _null_ ) insert ( 2748 arraycontains 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ arraycontains _null_ _null_ _null_ _null_ ) insert ( 2749 arraycontained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2277 2277' _null_ _null_ _null_ _null_ _null_ arraycontained _null_ _null_ _null_ _null_ ) insert ( 3383 brin_minmax_opcinfo 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ brin_minmax_opcinfo _null_ _null_ _null_ _null_ ) insert ( 3384 brin_minmax_add_value 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_add_value _null_ _null_ _null_ _null_ ) insert ( 3385 brin_minmax_consistent 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_consistent _null_ _null_ _null_ _null_ ) insert ( 3386 brin_minmax_union 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_union _null_ _null_ _null_ _null_ ) insert ( 4616 brin_minmax_multi_opcinfo 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_opcinfo _null_ _null_ _null_ _null_ ) insert ( 4617 brin_minmax_multi_add_value 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_add_value _null_ _null_ _null_ _null_ ) insert ( 4618 brin_minmax_multi_consistent 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 23' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_consistent _null_ _null_ _null_ _null_ ) insert ( 4619 brin_minmax_multi_union 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_union _null_ _null_ _null_ _null_ ) insert ( 4620 brin_minmax_multi_options 11 10 12 1 0 0 0 f f f f f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_options _null_ _null_ _null_ _null_ ) insert ( 4621 brin_minmax_multi_distance_int2 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_int2 _null_ _null_ _null_ _null_ ) insert ( 4622 brin_minmax_multi_distance_int4 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_int4 _null_ _null_ _null_ _null_ ) insert ( 4623 brin_minmax_multi_distance_int8 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_int8 _null_ _null_ _null_ _null_ ) insert ( 4624 brin_minmax_multi_distance_float4 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_float4 _null_ _null_ _null_ _null_ ) insert ( 4625 brin_minmax_multi_distance_float8 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_float8 _null_ _null_ _null_ _null_ ) insert ( 4626 brin_minmax_multi_distance_numeric 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_numeric _null_ _null_ _null_ _null_ ) insert ( 4627 brin_minmax_multi_distance_tid 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_tid _null_ _null_ _null_ _null_ ) insert ( 4628 brin_minmax_multi_distance_uuid 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_uuid _null_ _null_ _null_ _null_ ) insert ( 4629 brin_minmax_multi_distance_date 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_date _null_ _null_ _null_ _null_ ) insert ( 4630 brin_minmax_multi_distance_time 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_time _null_ _null_ _null_ _null_ ) insert ( 4631 brin_minmax_multi_distance_interval 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_interval _null_ _null_ _null_ _null_ ) insert ( 4632 brin_minmax_multi_distance_timetz 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_timetz _null_ _null_ _null_ _null_ ) insert ( 4633 brin_minmax_multi_distance_pg_lsn 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_pg_lsn _null_ _null_ _null_ _null_ ) insert ( 4634 brin_minmax_multi_distance_macaddr 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_macaddr _null_ _null_ _null_ _null_ ) insert ( 4635 brin_minmax_multi_distance_macaddr8 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_macaddr8 _null_ _null_ _null_ _null_ ) insert ( 4636 brin_minmax_multi_distance_inet 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_inet _null_ _null_ _null_ _null_ ) insert ( 4637 brin_minmax_multi_distance_timestamp 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '2281 2281' _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_distance_timestamp _null_ _null_ _null_ _null_ ) insert ( 4105 brin_inclusion_opcinfo 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ brin_inclusion_opcinfo _null_ _null_ _null_ _null_ ) insert ( 4106 brin_inclusion_add_value 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_inclusion_add_value _null_ _null_ _null_ _null_ ) insert ( 4107 brin_inclusion_consistent 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_inclusion_consistent _null_ _null_ _null_ _null_ ) insert ( 4108 brin_inclusion_union 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_inclusion_union _null_ _null_ _null_ _null_ ) insert ( 4591 brin_bloom_opcinfo 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ brin_bloom_opcinfo _null_ _null_ _null_ _null_ ) insert ( 4592 brin_bloom_add_value 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_bloom_add_value _null_ _null_ _null_ _null_ ) insert ( 4593 brin_bloom_consistent 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '2281 2281 2281 23' _null_ _null_ _null_ _null_ _null_ brin_bloom_consistent _null_ _null_ _null_ _null_ ) insert ( 4594 brin_bloom_union 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ brin_bloom_union _null_ _null_ _null_ _null_ ) insert ( 4595 brin_bloom_options 11 10 12 1 0 0 0 f f f f f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ brin_bloom_options _null_ _null_ _null_ _null_ ) insert ( 2880 pg_advisory_lock 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_lock_int8 _null_ _null_ _null_ _null_ ) insert ( 3089 pg_advisory_xact_lock 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_xact_lock_int8 _null_ _null_ _null_ _null_ ) insert ( 2881 pg_advisory_lock_shared 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_lock_shared_int8 _null_ _null_ _null_ _null_ ) insert ( 3090 pg_advisory_xact_lock_shared 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_xact_lock_shared_int8 _null_ _null_ _null_ _null_ ) insert ( 2882 pg_try_advisory_lock 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_try_advisory_lock_int8 _null_ _null_ _null_ _null_ ) insert ( 3091 pg_try_advisory_xact_lock 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_try_advisory_xact_lock_int8 _null_ _null_ _null_ _null_ ) insert ( 2883 pg_try_advisory_lock_shared 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_try_advisory_lock_shared_int8 _null_ _null_ _null_ _null_ ) insert ( 3092 pg_try_advisory_xact_lock_shared 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_try_advisory_xact_lock_shared_int8 _null_ _null_ _null_ _null_ ) insert ( 2884 pg_advisory_unlock 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_unlock_int8 _null_ _null_ _null_ _null_ ) insert ( 2885 pg_advisory_unlock_shared 11 10 12 1 0 0 0 f f f t f v r 1 0 16 20 _null_ _null_ _null_ _null_ _null_ pg_advisory_unlock_shared_int8 _null_ _null_ _null_ _null_ ) insert ( 2886 pg_advisory_lock 11 10 12 1 0 0 0 f f f t f v r 2 0 2278 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_lock_int4 _null_ _null_ _null_ _null_ ) insert ( 3093 pg_advisory_xact_lock 11 10 12 1 0 0 0 f f f t f v r 2 0 2278 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_xact_lock_int4 _null_ _null_ _null_ _null_ ) insert ( 2887 pg_advisory_lock_shared 11 10 12 1 0 0 0 f f f t f v r 2 0 2278 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_lock_shared_int4 _null_ _null_ _null_ _null_ ) insert ( 3094 pg_advisory_xact_lock_shared 11 10 12 1 0 0 0 f f f t f v r 2 0 2278 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_xact_lock_shared_int4 _null_ _null_ _null_ _null_ ) insert ( 2888 pg_try_advisory_lock 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_try_advisory_lock_int4 _null_ _null_ _null_ _null_ ) insert ( 3095 pg_try_advisory_xact_lock 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_try_advisory_xact_lock_int4 _null_ _null_ _null_ _null_ ) insert ( 2889 pg_try_advisory_lock_shared 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_try_advisory_lock_shared_int4 _null_ _null_ _null_ _null_ ) insert ( 3096 pg_try_advisory_xact_lock_shared 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_try_advisory_xact_lock_shared_int4 _null_ _null_ _null_ _null_ ) insert ( 2890 pg_advisory_unlock 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_unlock_int4 _null_ _null_ _null_ _null_ ) insert ( 2891 pg_advisory_unlock_shared 11 10 12 1 0 0 0 f f f t f v r 2 0 16 '23 23' _null_ _null_ _null_ _null_ _null_ pg_advisory_unlock_shared_int4 _null_ _null_ _null_ _null_ ) insert ( 2892 pg_advisory_unlock_all 11 10 12 1 0 0 0 f f f t f v r 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_advisory_unlock_all _null_ _null_ _null_ _null_ ) insert ( 2893 xml_in 11 10 12 1 0 0 0 f f f t f s s 1 0 142 2275 _null_ _null_ _null_ _null_ _null_ xml_in _null_ _null_ _null_ _null_ ) insert ( 2894 xml_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 142 _null_ _null_ _null_ _null_ _null_ xml_out _null_ _null_ _null_ _null_ ) insert ( 2895 xmlcomment 11 10 12 1 0 0 0 f f f t f i s 1 0 142 25 _null_ _null_ _null_ _null_ _null_ xmlcomment _null_ _null_ _null_ _null_ ) insert ( 2896 xml 11 10 12 1 0 0 0 f f f t f s s 1 0 142 25 _null_ _null_ _null_ _null_ _null_ texttoxml _null_ _null_ _null_ _null_ ) insert ( 2897 xmlvalidate 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '142 25' _null_ _null_ _null_ _null_ _null_ xmlvalidate _null_ _null_ _null_ _null_ ) insert ( 2898 xml_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 142 2281 _null_ _null_ _null_ _null_ _null_ xml_recv _null_ _null_ _null_ _null_ ) insert ( 2899 xml_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 142 _null_ _null_ _null_ _null_ _null_ xml_send _null_ _null_ _null_ _null_ ) insert ( 2900 xmlconcat2 11 10 12 1 0 0 0 f f f f f i s 2 0 142 '142 142' _null_ _null_ _null_ _null_ _null_ xmlconcat2 _null_ _null_ _null_ _null_ ) insert ( 2901 xmlagg 11 10 12 1 0 0 0 a f f f f i s 1 0 142 142 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 2922 text 11 10 12 1 0 0 0 f f f t f i s 1 0 25 142 _null_ _null_ _null_ _null_ _null_ xmltotext _null_ _null_ _null_ _null_ ) insert ( 3813 xmltext 11 10 12 1 0 0 0 f f f t f i s 1 0 142 25 _null_ _null_ _null_ _null_ _null_ xmltext _null_ _null_ _null_ _null_ ) insert ( 2923 table_to_xml 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '2205 16 16 25' _null_ _null_ '{tbl,nulls,tableforest,targetns}' _null_ _null_ table_to_xml _null_ _null_ _null_ _null_ ) insert ( 2924 query_to_xml 11 10 12 100 0 0 0 f f f t f v u 4 0 142 '25 16 16 25' _null_ _null_ '{query,nulls,tableforest,targetns}' _null_ _null_ query_to_xml _null_ _null_ _null_ _null_ ) insert ( 2925 cursor_to_xml 11 10 12 100 0 0 0 f f f t f v u 5 0 142 '1790 23 16 16 25' _null_ _null_ '{cursor,count,nulls,tableforest,targetns}' _null_ _null_ cursor_to_xml _null_ _null_ _null_ _null_ ) insert ( 2926 table_to_xmlschema 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '2205 16 16 25' _null_ _null_ '{tbl,nulls,tableforest,targetns}' _null_ _null_ table_to_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2927 query_to_xmlschema 11 10 12 100 0 0 0 f f f t f v u 4 0 142 '25 16 16 25' _null_ _null_ '{query,nulls,tableforest,targetns}' _null_ _null_ query_to_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2928 cursor_to_xmlschema 11 10 12 100 0 0 0 f f f t f v u 4 0 142 '1790 16 16 25' _null_ _null_ '{cursor,nulls,tableforest,targetns}' _null_ _null_ cursor_to_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2929 table_to_xml_and_xmlschema 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '2205 16 16 25' _null_ _null_ '{tbl,nulls,tableforest,targetns}' _null_ _null_ table_to_xml_and_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2930 query_to_xml_and_xmlschema 11 10 12 100 0 0 0 f f f t f v u 4 0 142 '25 16 16 25' _null_ _null_ '{query,nulls,tableforest,targetns}' _null_ _null_ query_to_xml_and_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2933 schema_to_xml 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '19 16 16 25' _null_ _null_ '{schema,nulls,tableforest,targetns}' _null_ _null_ schema_to_xml _null_ _null_ _null_ _null_ ) insert ( 2934 schema_to_xmlschema 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '19 16 16 25' _null_ _null_ '{schema,nulls,tableforest,targetns}' _null_ _null_ schema_to_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2935 schema_to_xml_and_xmlschema 11 10 12 100 0 0 0 f f f t f s r 4 0 142 '19 16 16 25' _null_ _null_ '{schema,nulls,tableforest,targetns}' _null_ _null_ schema_to_xml_and_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2936 database_to_xml 11 10 12 100 0 0 0 f f f t f s r 3 0 142 '16 16 25' _null_ _null_ '{nulls,tableforest,targetns}' _null_ _null_ database_to_xml _null_ _null_ _null_ _null_ ) insert ( 2937 database_to_xmlschema 11 10 12 100 0 0 0 f f f t f s r 3 0 142 '16 16 25' _null_ _null_ '{nulls,tableforest,targetns}' _null_ _null_ database_to_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2938 database_to_xml_and_xmlschema 11 10 12 100 0 0 0 f f f t f s r 3 0 142 '16 16 25' _null_ _null_ '{nulls,tableforest,targetns}' _null_ _null_ database_to_xml_and_xmlschema _null_ _null_ _null_ _null_ ) insert ( 2931 xpath 11 10 12 1 0 0 0 f f f t f i s 3 0 143 '25 142 1009' _null_ _null_ _null_ _null_ _null_ xpath _null_ _null_ _null_ _null_ ) insert ( 2932 xpath 11 10 14 1 0 0 0 f f f t f i s 2 0 143 '25 142' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 2614 xmlexists 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 142' _null_ _null_ _null_ _null_ _null_ xmlexists _null_ _null_ _null_ _null_ ) insert ( 3049 xpath_exists 11 10 12 1 0 0 0 f f f t f i s 3 0 16 '25 142 1009' _null_ _null_ _null_ _null_ _null_ xpath_exists _null_ _null_ _null_ _null_ ) insert ( 3050 xpath_exists 11 10 14 1 0 0 0 f f f t f i s 2 0 16 '25 142' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 3051 xml_is_well_formed 11 10 12 1 0 0 0 f f f t f s s 1 0 16 25 _null_ _null_ _null_ _null_ _null_ xml_is_well_formed _null_ _null_ _null_ _null_ ) insert ( 3052 xml_is_well_formed_document 11 10 12 1 0 0 0 f f f t f i s 1 0 16 25 _null_ _null_ _null_ _null_ _null_ xml_is_well_formed_document _null_ _null_ _null_ _null_ ) insert ( 3053 xml_is_well_formed_content 11 10 12 1 0 0 0 f f f t f i s 1 0 16 25 _null_ _null_ _null_ _null_ _null_ xml_is_well_formed_content _null_ _null_ _null_ _null_ ) insert ( 321 json_in 11 10 12 1 0 0 0 f f f t f i s 1 0 114 2275 _null_ _null_ _null_ _null_ _null_ json_in _null_ _null_ _null_ _null_ ) insert ( 322 json_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 114 _null_ _null_ _null_ _null_ _null_ json_out _null_ _null_ _null_ _null_ ) insert ( 323 json_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 114 2281 _null_ _null_ _null_ _null_ _null_ json_recv _null_ _null_ _null_ _null_ ) insert ( 324 json_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 114 _null_ _null_ _null_ _null_ _null_ json_send _null_ _null_ _null_ _null_ ) insert ( 3153 array_to_json 11 10 12 1 0 0 0 f f f t f s s 1 0 114 2277 _null_ _null_ _null_ _null_ _null_ array_to_json _null_ _null_ _null_ _null_ ) insert ( 3154 array_to_json 11 10 12 1 0 0 0 f f f t f s s 2 0 114 '2277 16' _null_ _null_ _null_ _null_ _null_ array_to_json_pretty _null_ _null_ _null_ _null_ ) insert ( 3155 row_to_json 11 10 12 1 0 0 0 f f f t f s s 1 0 114 2249 _null_ _null_ _null_ _null_ _null_ row_to_json _null_ _null_ _null_ _null_ ) insert ( 3156 row_to_json 11 10 12 1 0 0 0 f f f t f s s 2 0 114 '2249 16' _null_ _null_ _null_ _null_ _null_ row_to_json_pretty _null_ _null_ _null_ _null_ ) insert ( 3173 json_agg_transfn 11 10 12 1 0 0 0 f f f f f s s 2 0 2281 '2281 2283' _null_ _null_ _null_ _null_ _null_ json_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6275 json_agg_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 2 0 2281 '2281 2283' _null_ _null_ _null_ _null_ _null_ json_agg_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 3174 json_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 1 0 114 2281 _null_ _null_ _null_ _null_ _null_ json_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3175 json_agg 11 10 12 1 0 0 0 a f f f f s s 1 0 114 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6276 json_agg_strict 11 10 12 1 0 0 0 a f f f f s s 1 0 114 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3180 json_object_agg_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ json_object_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6277 json_object_agg_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ json_object_agg_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 6278 json_object_agg_unique_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ json_object_agg_unique_transfn _null_ _null_ _null_ _null_ ) insert ( 6279 json_object_agg_unique_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ json_object_agg_unique_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 3196 json_object_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 1 0 114 2281 _null_ _null_ _null_ _null_ _null_ json_object_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3197 json_object_agg 11 10 12 1 0 0 0 a f f f f s s 2 0 114 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6280 json_object_agg_strict 11 10 12 1 0 0 0 a f f f f s s 2 0 114 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6281 json_object_agg_unique 11 10 12 1 0 0 0 a f f f f s s 2 0 114 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6282 json_object_agg_unique_strict 11 10 12 1 0 0 0 a f f f f s s 2 0 114 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3198 json_build_array 11 10 12 1 0 2276 0 f f f f f s s 1 0 114 2276 '{2276}' '{v}' _null_ _null_ _null_ json_build_array _null_ _null_ _null_ _null_ ) insert ( 3199 json_build_array 11 10 12 1 0 0 0 f f f f f s s 0 0 114 '' _null_ _null_ _null_ _null_ _null_ json_build_array_noargs _null_ _null_ _null_ _null_ ) insert ( 3200 json_build_object 11 10 12 1 0 2276 0 f f f f f s s 1 0 114 2276 '{2276}' '{v}' _null_ _null_ _null_ json_build_object _null_ _null_ _null_ _null_ ) insert ( 3201 json_build_object 11 10 12 1 0 0 0 f f f f f s s 0 0 114 '' _null_ _null_ _null_ _null_ _null_ json_build_object_noargs _null_ _null_ _null_ _null_ ) insert ( 3202 json_object 11 10 12 1 0 0 0 f f f t f i s 1 0 114 1009 _null_ _null_ _null_ _null_ _null_ json_object _null_ _null_ _null_ _null_ ) insert ( 3203 json_object 11 10 12 1 0 0 0 f f f t f i s 2 0 114 '1009 1009' _null_ _null_ _null_ _null_ _null_ json_object_two_arg _null_ _null_ _null_ _null_ ) insert ( 3176 to_json 11 10 12 1 0 0 0 f f f t f s s 1 0 114 2283 _null_ _null_ _null_ _null_ _null_ to_json _null_ _null_ _null_ _null_ ) insert ( 3261 json_strip_nulls 11 10 12 1 0 0 0 f f f t f i s 1 0 114 114 _null_ _null_ _null_ _null_ _null_ json_strip_nulls _null_ _null_ _null_ _null_ ) insert ( 3947 json_object_field 11 10 12 1 0 0 0 f f f t f i s 2 0 114 '114 25' _null_ _null_ '{from_json, field_name}' _null_ _null_ json_object_field _null_ _null_ _null_ _null_ ) insert ( 3948 json_object_field_text 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '114 25' _null_ _null_ '{from_json, field_name}' _null_ _null_ json_object_field_text _null_ _null_ _null_ _null_ ) insert ( 3949 json_array_element 11 10 12 1 0 0 0 f f f t f i s 2 0 114 '114 23' _null_ _null_ '{from_json, element_index}' _null_ _null_ json_array_element _null_ _null_ _null_ _null_ ) insert ( 3950 json_array_element_text 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '114 23' _null_ _null_ '{from_json, element_index}' _null_ _null_ json_array_element_text _null_ _null_ _null_ _null_ ) insert ( 3951 json_extract_path 11 10 12 1 0 25 0 f f f t f i s 2 0 114 '114 1009' '{114,1009}' '{i,v}' '{from_json,path_elems}' _null_ _null_ json_extract_path _null_ _null_ _null_ _null_ ) insert ( 3953 json_extract_path_text 11 10 12 1 0 25 0 f f f t f i s 2 0 25 '114 1009' '{114,1009}' '{i,v}' '{from_json,path_elems}' _null_ _null_ json_extract_path_text _null_ _null_ _null_ _null_ ) insert ( 3955 json_array_elements 11 10 12 1 100 0 0 f f f t t i s 1 0 114 114 '{114,114}' '{i,o}' '{from_json,value}' _null_ _null_ json_array_elements _null_ _null_ _null_ _null_ ) insert ( 3969 json_array_elements_text 11 10 12 1 100 0 0 f f f t t i s 1 0 25 114 '{114,25}' '{i,o}' '{from_json,value}' _null_ _null_ json_array_elements_text _null_ _null_ _null_ _null_ ) insert ( 3956 json_array_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 114 _null_ _null_ _null_ _null_ _null_ json_array_length _null_ _null_ _null_ _null_ ) insert ( 3957 json_object_keys 11 10 12 1 100 0 0 f f f t t i s 1 0 25 114 _null_ _null_ _null_ _null_ _null_ json_object_keys _null_ _null_ _null_ _null_ ) insert ( 3958 json_each 11 10 12 1 100 0 0 f f f t t i s 1 0 2249 114 '{114,25,114}' '{i,o,o}' '{from_json,key,value}' _null_ _null_ json_each _null_ _null_ _null_ _null_ ) insert ( 3959 json_each_text 11 10 12 1 100 0 0 f f f t t i s 1 0 2249 114 '{114,25,25}' '{i,o,o}' '{from_json,key,value}' _null_ _null_ json_each_text _null_ _null_ _null_ _null_ ) insert ( 3960 json_populate_record 11 10 12 1 0 0 0 f f f f f s s 3 0 2283 '2283 114 16' _null_ _null_ _null_ _null_ _null_ json_populate_record _null_ _null_ _null_ _null_ ) insert ( 3961 json_populate_recordset 11 10 12 1 100 0 0 f f f f t s s 3 0 2283 '2283 114 16' _null_ _null_ _null_ _null_ _null_ json_populate_recordset _null_ _null_ _null_ _null_ ) insert ( 3204 json_to_record 11 10 12 1 0 0 0 f f f t f s s 1 0 2249 114 _null_ _null_ _null_ _null_ _null_ json_to_record _null_ _null_ _null_ _null_ ) insert ( 3205 json_to_recordset 11 10 12 1 100 0 0 f f f f t s s 1 0 2249 114 _null_ _null_ _null_ _null_ _null_ json_to_recordset _null_ _null_ _null_ _null_ ) insert ( 3968 json_typeof 11 10 12 1 0 0 0 f f f t f i s 1 0 25 114 _null_ _null_ _null_ _null_ _null_ json_typeof _null_ _null_ _null_ _null_ ) insert ( 2952 uuid_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2950 2275 _null_ _null_ _null_ _null_ _null_ uuid_in _null_ _null_ _null_ _null_ ) insert ( 2953 uuid_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2950 _null_ _null_ _null_ _null_ _null_ uuid_out _null_ _null_ _null_ _null_ ) insert ( 2954 uuid_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_lt _null_ _null_ _null_ _null_ ) insert ( 2955 uuid_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_le _null_ _null_ _null_ _null_ ) insert ( 2956 uuid_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_eq _null_ _null_ _null_ _null_ ) insert ( 2957 uuid_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_ge _null_ _null_ _null_ _null_ ) insert ( 2958 uuid_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_gt _null_ _null_ _null_ _null_ ) insert ( 2959 uuid_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_ne _null_ _null_ _null_ _null_ ) insert ( 2960 uuid_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '2950 2950' _null_ _null_ _null_ _null_ _null_ uuid_cmp _null_ _null_ _null_ _null_ ) insert ( 3300 uuid_sortsupport 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ uuid_sortsupport _null_ _null_ _null_ _null_ ) insert ( 2961 uuid_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 2950 2281 _null_ _null_ _null_ _null_ _null_ uuid_recv _null_ _null_ _null_ _null_ ) insert ( 2962 uuid_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2950 _null_ _null_ _null_ _null_ _null_ uuid_send _null_ _null_ _null_ _null_ ) insert ( 2963 uuid_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2950 _null_ _null_ _null_ _null_ _null_ uuid_hash _null_ _null_ _null_ _null_ ) insert ( 3412 uuid_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '2950 20' _null_ _null_ _null_ _null_ _null_ uuid_hash_extended _null_ _null_ _null_ _null_ ) insert ( 3432 gen_random_uuid 11 10 12 1 0 0 0 f f t t f v s 0 0 2950 '' _null_ _null_ _null_ _null_ _null_ gen_random_uuid _null_ _null_ _null_ _null_ ) insert ( 6342 uuid_extract_timestamp 11 10 12 1 0 0 0 f f t t f i s 1 0 1184 2950 _null_ _null_ _null_ _null_ _null_ uuid_extract_timestamp _null_ _null_ _null_ _null_ ) insert ( 6343 uuid_extract_version 11 10 12 1 0 0 0 f f t t f i s 1 0 21 2950 _null_ _null_ _null_ _null_ _null_ uuid_extract_version _null_ _null_ _null_ _null_ ) insert ( 3229 pg_lsn_in 11 10 12 1 0 0 0 f f f t f i s 1 0 3220 2275 _null_ _null_ _null_ _null_ _null_ pg_lsn_in _null_ _null_ _null_ _null_ ) insert ( 3230 pg_lsn_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3220 _null_ _null_ _null_ _null_ _null_ pg_lsn_out _null_ _null_ _null_ _null_ ) insert ( 3231 pg_lsn_lt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_lt _null_ _null_ _null_ _null_ ) insert ( 3232 pg_lsn_le 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_le _null_ _null_ _null_ _null_ ) insert ( 3233 pg_lsn_eq 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_eq _null_ _null_ _null_ _null_ ) insert ( 3234 pg_lsn_ge 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_ge _null_ _null_ _null_ _null_ ) insert ( 3235 pg_lsn_gt 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_gt _null_ _null_ _null_ _null_ ) insert ( 3236 pg_lsn_ne 11 10 12 1 0 0 0 f f t t f i s 2 0 16 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_ne _null_ _null_ _null_ _null_ ) insert ( 3237 pg_lsn_mi 11 10 12 1 0 0 0 f f f t f i s 2 0 1700 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_mi _null_ _null_ _null_ _null_ ) insert ( 3238 pg_lsn_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 3220 2281 _null_ _null_ _null_ _null_ _null_ pg_lsn_recv _null_ _null_ _null_ _null_ ) insert ( 3239 pg_lsn_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3220 _null_ _null_ _null_ _null_ _null_ pg_lsn_send _null_ _null_ _null_ _null_ ) insert ( 3251 pg_lsn_cmp 11 10 12 1 0 0 0 f f t t f i s 2 0 23 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_cmp _null_ _null_ _null_ _null_ ) insert ( 3252 pg_lsn_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3220 _null_ _null_ _null_ _null_ _null_ pg_lsn_hash _null_ _null_ _null_ _null_ ) insert ( 3413 pg_lsn_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '3220 20' _null_ _null_ _null_ _null_ _null_ pg_lsn_hash_extended _null_ _null_ _null_ _null_ ) insert ( 4187 pg_lsn_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 3220 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_larger _null_ _null_ _null_ _null_ ) insert ( 4188 pg_lsn_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 3220 '3220 3220' _null_ _null_ _null_ _null_ _null_ pg_lsn_smaller _null_ _null_ _null_ _null_ ) insert ( 5022 pg_lsn_pli 11 10 12 1 0 0 0 f f f t f i s 2 0 3220 '3220 1700' _null_ _null_ _null_ _null_ _null_ pg_lsn_pli _null_ _null_ _null_ _null_ ) insert ( 5023 numeric_pl_pg_lsn 11 10 14 1 0 0 0 f f f t f i s 2 0 3220 '1700 3220' _null_ _null_ _null_ _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 5024 pg_lsn_mii 11 10 12 1 0 0 0 f f f t f i s 2 0 3220 '3220 1700' _null_ _null_ _null_ _null_ _null_ pg_lsn_mii _null_ _null_ _null_ _null_ ) insert ( 3504 anyenum_in 11 10 12 1 0 0 0 f f f t f i s 1 0 3500 2275 _null_ _null_ _null_ _null_ _null_ anyenum_in _null_ _null_ _null_ _null_ ) insert ( 3505 anyenum_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3500 _null_ _null_ _null_ _null_ _null_ anyenum_out _null_ _null_ _null_ _null_ ) insert ( 3506 enum_in 11 10 12 1 0 0 0 f f f t f s s 2 0 3500 '2275 26' _null_ _null_ _null_ _null_ _null_ enum_in _null_ _null_ _null_ _null_ ) insert ( 3507 enum_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3500 _null_ _null_ _null_ _null_ _null_ enum_out _null_ _null_ _null_ _null_ ) insert ( 3508 enum_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_eq _null_ _null_ _null_ _null_ ) insert ( 3509 enum_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_ne _null_ _null_ _null_ _null_ ) insert ( 3510 enum_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_lt _null_ _null_ _null_ _null_ ) insert ( 3511 enum_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_gt _null_ _null_ _null_ _null_ ) insert ( 3512 enum_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_le _null_ _null_ _null_ _null_ ) insert ( 3513 enum_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_ge _null_ _null_ _null_ _null_ ) insert ( 3514 enum_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_cmp _null_ _null_ _null_ _null_ ) insert ( 3515 hashenum 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3500 _null_ _null_ _null_ _null_ _null_ hashenum _null_ _null_ _null_ _null_ ) insert ( 3414 hashenumextended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '3500 20' _null_ _null_ _null_ _null_ _null_ hashenumextended _null_ _null_ _null_ _null_ ) insert ( 3524 enum_smaller 11 10 12 1 0 0 0 f f f t f i s 2 0 3500 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_smaller _null_ _null_ _null_ _null_ ) insert ( 3525 enum_larger 11 10 12 1 0 0 0 f f f t f i s 2 0 3500 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_larger _null_ _null_ _null_ _null_ ) insert ( 3526 max 11 10 12 1 0 0 0 a f f f f i s 1 0 3500 3500 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3527 min 11 10 12 1 0 0 0 a f f f f i s 1 0 3500 3500 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3528 enum_first 11 10 12 1 0 0 0 f f f f f s s 1 0 3500 3500 _null_ _null_ _null_ _null_ _null_ enum_first _null_ _null_ _null_ _null_ ) insert ( 3529 enum_last 11 10 12 1 0 0 0 f f f f f s s 1 0 3500 3500 _null_ _null_ _null_ _null_ _null_ enum_last _null_ _null_ _null_ _null_ ) insert ( 3530 enum_range 11 10 12 1 0 0 0 f f f f f s s 2 0 2277 '3500 3500' _null_ _null_ _null_ _null_ _null_ enum_range_bounds _null_ _null_ _null_ _null_ ) insert ( 3531 enum_range 11 10 12 1 0 0 0 f f f f f s s 1 0 2277 3500 _null_ _null_ _null_ _null_ _null_ enum_range_all _null_ _null_ _null_ _null_ ) insert ( 3532 enum_recv 11 10 12 1 0 0 0 f f f t f s s 2 0 3500 '2281 26' _null_ _null_ _null_ _null_ _null_ enum_recv _null_ _null_ _null_ _null_ ) insert ( 3533 enum_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 3500 _null_ _null_ _null_ _null_ _null_ enum_send _null_ _null_ _null_ _null_ ) insert ( 3610 tsvectorin 11 10 12 1 0 0 0 f f f t f i s 1 0 3614 2275 _null_ _null_ _null_ _null_ _null_ tsvectorin _null_ _null_ _null_ _null_ ) insert ( 3639 tsvectorrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 3614 2281 _null_ _null_ _null_ _null_ _null_ tsvectorrecv _null_ _null_ _null_ _null_ ) insert ( 3611 tsvectorout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3614 _null_ _null_ _null_ _null_ _null_ tsvectorout _null_ _null_ _null_ _null_ ) insert ( 3638 tsvectorsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3614 _null_ _null_ _null_ _null_ _null_ tsvectorsend _null_ _null_ _null_ _null_ ) insert ( 3612 tsqueryin 11 10 12 1 0 0 0 f f f t f i s 1 0 3615 2275 _null_ _null_ _null_ _null_ _null_ tsqueryin _null_ _null_ _null_ _null_ ) insert ( 3641 tsqueryrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 3615 2281 _null_ _null_ _null_ _null_ _null_ tsqueryrecv _null_ _null_ _null_ _null_ ) insert ( 3613 tsqueryout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3615 _null_ _null_ _null_ _null_ _null_ tsqueryout _null_ _null_ _null_ _null_ ) insert ( 3640 tsquerysend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3615 _null_ _null_ _null_ _null_ _null_ tsquerysend _null_ _null_ _null_ _null_ ) insert ( 3646 gtsvectorin 11 10 12 1 0 0 0 f f f t f i s 1 0 3642 2275 _null_ _null_ _null_ _null_ _null_ gtsvectorin _null_ _null_ _null_ _null_ ) insert ( 3647 gtsvectorout 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3642 _null_ _null_ _null_ _null_ _null_ gtsvectorout _null_ _null_ _null_ _null_ ) insert ( 3616 tsvector_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_lt _null_ _null_ _null_ _null_ ) insert ( 3617 tsvector_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_le _null_ _null_ _null_ _null_ ) insert ( 3618 tsvector_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_eq _null_ _null_ _null_ _null_ ) insert ( 3619 tsvector_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_ne _null_ _null_ _null_ _null_ ) insert ( 3620 tsvector_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_ge _null_ _null_ _null_ _null_ ) insert ( 3621 tsvector_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_gt _null_ _null_ _null_ _null_ ) insert ( 3622 tsvector_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_cmp _null_ _null_ _null_ _null_ ) insert ( 3711 length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3614 _null_ _null_ _null_ _null_ _null_ tsvector_length _null_ _null_ _null_ _null_ ) insert ( 3623 strip 11 10 12 1 0 0 0 f f f t f i s 1 0 3614 3614 _null_ _null_ _null_ _null_ _null_ tsvector_strip _null_ _null_ _null_ _null_ ) insert ( 3624 setweight 11 10 12 1 0 0 0 f f f t f i s 2 0 3614 '3614 18' _null_ _null_ _null_ _null_ _null_ tsvector_setweight _null_ _null_ _null_ _null_ ) insert ( 3320 setweight 11 10 12 1 0 0 0 f f f t f i s 3 0 3614 '3614 18 1009' _null_ _null_ _null_ _null_ _null_ tsvector_setweight_by_filter _null_ _null_ _null_ _null_ ) insert ( 3625 tsvector_concat 11 10 12 1 0 0 0 f f f t f i s 2 0 3614 '3614 3614' _null_ _null_ _null_ _null_ _null_ tsvector_concat _null_ _null_ _null_ _null_ ) insert ( 3321 ts_delete 11 10 12 1 0 0 0 f f f t f i s 2 0 3614 '3614 25' _null_ _null_ _null_ _null_ _null_ tsvector_delete_str _null_ _null_ _null_ _null_ ) insert ( 3323 ts_delete 11 10 12 1 0 0 0 f f f t f i s 2 0 3614 '3614 1009' _null_ _null_ _null_ _null_ _null_ tsvector_delete_arr _null_ _null_ _null_ _null_ ) insert ( 3322 unnest 11 10 12 1 10 0 0 f f f t t i s 1 0 2249 3614 '{3614,25,1005,1009}' '{i,o,o,o}' '{tsvector,lexeme,positions,weights}' _null_ _null_ tsvector_unnest _null_ _null_ _null_ _null_ ) insert ( 3326 tsvector_to_array 11 10 12 1 0 0 0 f f f t f i s 1 0 1009 3614 _null_ _null_ _null_ _null_ _null_ tsvector_to_array _null_ _null_ _null_ _null_ ) insert ( 3327 array_to_tsvector 11 10 12 1 0 0 0 f f f t f i s 1 0 3614 1009 _null_ _null_ _null_ _null_ _null_ array_to_tsvector _null_ _null_ _null_ _null_ ) insert ( 3319 ts_filter 11 10 12 1 0 0 0 f f f t f i s 2 0 3614 '3614 1002' _null_ _null_ _null_ _null_ _null_ tsvector_filter _null_ _null_ _null_ _null_ ) insert ( 3634 ts_match_vq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3614 3615' _null_ _null_ _null_ _null_ _null_ ts_match_vq _null_ _null_ _null_ _null_ ) insert ( 3635 ts_match_qv 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3614' _null_ _null_ _null_ _null_ _null_ ts_match_qv _null_ _null_ _null_ _null_ ) insert ( 3760 ts_match_tt 11 10 12 100 0 0 0 f f f t f s s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ ts_match_tt _null_ _null_ _null_ _null_ ) insert ( 3761 ts_match_tq 11 10 12 100 0 0 0 f f f t f s s 2 0 16 '25 3615' _null_ _null_ _null_ _null_ _null_ ts_match_tq _null_ _null_ _null_ _null_ ) insert ( 3648 gtsvector_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gtsvector_compress _null_ _null_ _null_ _null_ ) insert ( 3649 gtsvector_decompress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gtsvector_decompress _null_ _null_ _null_ _null_ ) insert ( 3650 gtsvector_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_picksplit _null_ _null_ _null_ _null_ ) insert ( 3651 gtsvector_union 11 10 12 1 0 0 0 f f f t f i s 2 0 3642 '2281 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_union _null_ _null_ _null_ _null_ ) insert ( 3652 gtsvector_same 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '3642 3642 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_same _null_ _null_ _null_ _null_ ) insert ( 3653 gtsvector_penalty 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_penalty _null_ _null_ _null_ _null_ ) insert ( 3654 gtsvector_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 3614 21 26 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_consistent _null_ _null_ _null_ _null_ ) insert ( 3790 gtsvector_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 3642 23 26 2281' _null_ _null_ _null_ _null_ _null_ gtsvector_consistent_oldsig _null_ _null_ _null_ _null_ ) insert ( 3434 gtsvector_options 11 10 12 1 0 0 0 f f f f f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ gtsvector_options _null_ _null_ _null_ _null_ ) insert ( 3656 gin_extract_tsvector 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '3614 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_tsvector _null_ _null_ _null_ _null_ ) insert ( 3657 gin_extract_tsquery 11 10 12 1 0 0 0 f f f t f i s 7 0 2281 '3614 2281 21 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_tsquery _null_ _null_ _null_ _null_ ) insert ( 3658 gin_tsquery_consistent 11 10 12 1 0 0 0 f f f t f i s 8 0 16 '2281 21 3614 23 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_tsquery_consistent _null_ _null_ _null_ _null_ ) insert ( 3921 gin_tsquery_triconsistent 11 10 12 1 0 0 0 f f f t f i s 7 0 18 '2281 21 3614 23 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_tsquery_triconsistent _null_ _null_ _null_ _null_ ) insert ( 3724 gin_cmp_tslexeme 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ gin_cmp_tslexeme _null_ _null_ _null_ _null_ ) insert ( 2700 gin_cmp_prefix 11 10 12 1 0 0 0 f f f t f i s 4 0 23 '25 25 21 2281' _null_ _null_ _null_ _null_ _null_ gin_cmp_prefix _null_ _null_ _null_ _null_ ) insert ( 3077 gin_extract_tsvector 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '3614 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_tsvector_2args _null_ _null_ _null_ _null_ ) insert ( 3087 gin_extract_tsquery 11 10 12 1 0 0 0 f f f t f i s 5 0 2281 '3615 2281 21 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_tsquery_5args _null_ _null_ _null_ _null_ ) insert ( 3088 gin_tsquery_consistent 11 10 12 1 0 0 0 f f f t f i s 6 0 16 '2281 21 3615 23 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_tsquery_consistent_6args _null_ _null_ _null_ _null_ ) insert ( 3791 gin_extract_tsquery 11 10 12 1 0 0 0 f f f t f i s 7 0 2281 '3615 2281 21 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_tsquery_oldsig _null_ _null_ _null_ _null_ ) insert ( 3792 gin_tsquery_consistent 11 10 12 1 0 0 0 f f f t f i s 8 0 16 '2281 21 3615 23 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_tsquery_consistent_oldsig _null_ _null_ _null_ _null_ ) insert ( 3789 gin_clean_pending_list 11 10 12 1 0 0 0 f f f t f v u 1 0 20 2205 _null_ _null_ _null_ _null_ _null_ gin_clean_pending_list _null_ _null_ _null_ _null_ ) insert ( 3662 tsquery_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_lt _null_ _null_ _null_ _null_ ) insert ( 3663 tsquery_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_le _null_ _null_ _null_ _null_ ) insert ( 3664 tsquery_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_eq _null_ _null_ _null_ _null_ ) insert ( 3665 tsquery_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_ne _null_ _null_ _null_ _null_ ) insert ( 3666 tsquery_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_ge _null_ _null_ _null_ _null_ ) insert ( 3667 tsquery_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_gt _null_ _null_ _null_ _null_ ) insert ( 3668 tsquery_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_cmp _null_ _null_ _null_ _null_ ) insert ( 3669 tsquery_and 11 10 12 1 0 0 0 f f f t f i s 2 0 3615 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_and _null_ _null_ _null_ _null_ ) insert ( 3670 tsquery_or 11 10 12 1 0 0 0 f f f t f i s 2 0 3615 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_or _null_ _null_ _null_ _null_ ) insert ( 5003 tsquery_phrase 11 10 12 1 0 0 0 f f f t f i s 2 0 3615 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_phrase _null_ _null_ _null_ _null_ ) insert ( 5004 tsquery_phrase 11 10 12 1 0 0 0 f f f t f i s 3 0 3615 '3615 3615 23' _null_ _null_ _null_ _null_ _null_ tsquery_phrase_distance _null_ _null_ _null_ _null_ ) insert ( 3671 tsquery_not 11 10 12 1 0 0 0 f f f t f i s 1 0 3615 3615 _null_ _null_ _null_ _null_ _null_ tsquery_not _null_ _null_ _null_ _null_ ) insert ( 3691 tsq_mcontains 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsq_mcontains _null_ _null_ _null_ _null_ ) insert ( 3692 tsq_mcontained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3615 3615' _null_ _null_ _null_ _null_ _null_ tsq_mcontained _null_ _null_ _null_ _null_ ) insert ( 3672 numnode 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3615 _null_ _null_ _null_ _null_ _null_ tsquery_numnode _null_ _null_ _null_ _null_ ) insert ( 3673 querytree 11 10 12 1 0 0 0 f f f t f i s 1 0 25 3615 _null_ _null_ _null_ _null_ _null_ tsquerytree _null_ _null_ _null_ _null_ ) insert ( 3684 ts_rewrite 11 10 12 1 0 0 0 f f f t f i s 3 0 3615 '3615 3615 3615' _null_ _null_ _null_ _null_ _null_ tsquery_rewrite _null_ _null_ _null_ _null_ ) insert ( 3685 ts_rewrite 11 10 12 100 0 0 0 f f f t f v u 2 0 3615 '3615 25' _null_ _null_ _null_ _null_ _null_ tsquery_rewrite_query _null_ _null_ _null_ _null_ ) insert ( 3695 gtsquery_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ gtsquery_compress _null_ _null_ _null_ _null_ ) insert ( 3697 gtsquery_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_picksplit _null_ _null_ _null_ _null_ ) insert ( 3698 gtsquery_union 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '2281 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_union _null_ _null_ _null_ _null_ ) insert ( 3699 gtsquery_same 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '20 20 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_same _null_ _null_ _null_ _null_ ) insert ( 3700 gtsquery_penalty 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_penalty _null_ _null_ _null_ _null_ ) insert ( 3701 gtsquery_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 3615 21 26 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_consistent _null_ _null_ _null_ _null_ ) insert ( 3793 gtsquery_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 2281 23 26 2281' _null_ _null_ _null_ _null_ _null_ gtsquery_consistent_oldsig _null_ _null_ _null_ _null_ ) insert ( 3686 tsmatchsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ tsmatchsel _null_ _null_ _null_ _null_ ) insert ( 3687 tsmatchjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ tsmatchjoinsel _null_ _null_ _null_ _null_ ) insert ( 3688 ts_typanalyze 11 10 12 1 0 0 0 f f f t f s s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ ts_typanalyze _null_ _null_ _null_ _null_ ) insert ( 3689 ts_stat 11 10 12 10 10000 0 0 f f f t t v u 1 0 2249 25 '{25,25,23,23}' '{i,o,o,o}' '{query,word,ndoc,nentry}' _null_ _null_ ts_stat1 _null_ _null_ _null_ _null_ ) insert ( 3690 ts_stat 11 10 12 10 10000 0 0 f f f t t v u 2 0 2249 '25 25' '{25,25,25,23,23}' '{i,i,o,o,o}' '{query,weights,word,ndoc,nentry}' _null_ _null_ ts_stat2 _null_ _null_ _null_ _null_ ) insert ( 3703 ts_rank 11 10 12 1 0 0 0 f f f t f i s 4 0 700 '1021 3614 3615 23' _null_ _null_ _null_ _null_ _null_ ts_rank_wttf _null_ _null_ _null_ _null_ ) insert ( 3704 ts_rank 11 10 12 1 0 0 0 f f f t f i s 3 0 700 '1021 3614 3615' _null_ _null_ _null_ _null_ _null_ ts_rank_wtt _null_ _null_ _null_ _null_ ) insert ( 3705 ts_rank 11 10 12 1 0 0 0 f f f t f i s 3 0 700 '3614 3615 23' _null_ _null_ _null_ _null_ _null_ ts_rank_ttf _null_ _null_ _null_ _null_ ) insert ( 3706 ts_rank 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '3614 3615' _null_ _null_ _null_ _null_ _null_ ts_rank_tt _null_ _null_ _null_ _null_ ) insert ( 3707 ts_rank_cd 11 10 12 1 0 0 0 f f f t f i s 4 0 700 '1021 3614 3615 23' _null_ _null_ _null_ _null_ _null_ ts_rankcd_wttf _null_ _null_ _null_ _null_ ) insert ( 3708 ts_rank_cd 11 10 12 1 0 0 0 f f f t f i s 3 0 700 '1021 3614 3615' _null_ _null_ _null_ _null_ _null_ ts_rankcd_wtt _null_ _null_ _null_ _null_ ) insert ( 3709 ts_rank_cd 11 10 12 1 0 0 0 f f f t f i s 3 0 700 '3614 3615 23' _null_ _null_ _null_ _null_ _null_ ts_rankcd_ttf _null_ _null_ _null_ _null_ ) insert ( 3710 ts_rank_cd 11 10 12 1 0 0 0 f f f t f i s 2 0 700 '3614 3615' _null_ _null_ _null_ _null_ _null_ ts_rankcd_tt _null_ _null_ _null_ _null_ ) insert ( 3713 ts_token_type 11 10 12 1 16 0 0 f f f t t i s 1 0 2249 26 '{26,23,25,25}' '{i,o,o,o}' '{parser_oid,tokid,alias,description}' _null_ _null_ ts_token_type_byid _null_ _null_ _null_ _null_ ) insert ( 3714 ts_token_type 11 10 12 1 16 0 0 f f f t t s s 1 0 2249 25 '{25,23,25,25}' '{i,o,o,o}' '{parser_name,tokid,alias,description}' _null_ _null_ ts_token_type_byname _null_ _null_ _null_ _null_ ) insert ( 3715 ts_parse 11 10 12 1 1000 0 0 f f f t t i s 2 0 2249 '26 25' '{26,25,23,25}' '{i,i,o,o}' '{parser_oid,txt,tokid,token}' _null_ _null_ ts_parse_byid _null_ _null_ _null_ _null_ ) insert ( 3716 ts_parse 11 10 12 1 1000 0 0 f f f t t s s 2 0 2249 '25 25' '{25,25,23,25}' '{i,i,o,o}' '{parser_name,txt,tokid,token}' _null_ _null_ ts_parse_byname _null_ _null_ _null_ _null_ ) insert ( 3717 prsd_start 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 23' _null_ _null_ _null_ _null_ _null_ prsd_start _null_ _null_ _null_ _null_ ) insert ( 3718 prsd_nexttoken 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ prsd_nexttoken _null_ _null_ _null_ _null_ ) insert ( 3719 prsd_end 11 10 12 1 0 0 0 f f f t f i s 1 0 2278 2281 _null_ _null_ _null_ _null_ _null_ prsd_end _null_ _null_ _null_ _null_ ) insert ( 3720 prsd_headline 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 3615' _null_ _null_ _null_ _null_ _null_ prsd_headline _null_ _null_ _null_ _null_ ) insert ( 3721 prsd_lextype 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ prsd_lextype _null_ _null_ _null_ _null_ ) insert ( 3723 ts_lexize 11 10 12 1 0 0 0 f f f t f i s 2 0 1009 '3769 25' _null_ _null_ _null_ _null_ _null_ ts_lexize _null_ _null_ _null_ _null_ ) insert ( 6183 ts_debug 11 10 14 1 1000 0 0 f f f t t s s 2 0 2249 '3734 25' '{3734,25,25,25,25,3770,3769,1009}' '{i,i,o,o,o,o,o,o}' '{config,document,alias,description,token,dictionaries,dictionary,lexemes}' _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 6184 ts_debug 11 10 14 1 1000 0 0 f f f t t s s 1 0 2249 25 '{25,25,25,25,3770,3769,1009}' '{i,o,o,o,o,o,o}' '{document,alias,description,token,dictionaries,dictionary,lexemes}' _null_ _null_ 'see system_functions.sql' _null_ _null_ _null_ _null_ ) insert ( 3725 dsimple_init 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ dsimple_init _null_ _null_ _null_ _null_ ) insert ( 3726 dsimple_lexize 11 10 12 1 0 0 0 f f f t f i s 4 0 2281 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ dsimple_lexize _null_ _null_ _null_ _null_ ) insert ( 3728 dsynonym_init 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ dsynonym_init _null_ _null_ _null_ _null_ ) insert ( 3729 dsynonym_lexize 11 10 12 1 0 0 0 f f f t f i s 4 0 2281 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ dsynonym_lexize _null_ _null_ _null_ _null_ ) insert ( 3731 dispell_init 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ dispell_init _null_ _null_ _null_ _null_ ) insert ( 3732 dispell_lexize 11 10 12 1 0 0 0 f f f t f i s 4 0 2281 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ dispell_lexize _null_ _null_ _null_ _null_ ) insert ( 3740 thesaurus_init 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ thesaurus_init _null_ _null_ _null_ _null_ ) insert ( 3741 thesaurus_lexize 11 10 12 1 0 0 0 f f f t f i s 4 0 2281 '2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ thesaurus_lexize _null_ _null_ _null_ _null_ ) insert ( 3743 ts_headline 11 10 12 100 0 0 0 f f f t f i s 4 0 25 '3734 25 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_byid_opt _null_ _null_ _null_ _null_ ) insert ( 3744 ts_headline 11 10 12 100 0 0 0 f f f t f i s 3 0 25 '3734 25 3615' _null_ _null_ _null_ _null_ _null_ ts_headline_byid _null_ _null_ _null_ _null_ ) insert ( 3754 ts_headline 11 10 12 100 0 0 0 f f f t f s s 3 0 25 '25 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_opt _null_ _null_ _null_ _null_ ) insert ( 3755 ts_headline 11 10 12 100 0 0 0 f f f t f s s 2 0 25 '25 3615' _null_ _null_ _null_ _null_ _null_ ts_headline _null_ _null_ _null_ _null_ ) insert ( 4201 ts_headline 11 10 12 100 0 0 0 f f f t f i s 4 0 3802 '3734 3802 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_jsonb_byid_opt _null_ _null_ _null_ _null_ ) insert ( 4202 ts_headline 11 10 12 100 0 0 0 f f f t f i s 3 0 3802 '3734 3802 3615' _null_ _null_ _null_ _null_ _null_ ts_headline_jsonb_byid _null_ _null_ _null_ _null_ ) insert ( 4203 ts_headline 11 10 12 100 0 0 0 f f f t f s s 3 0 3802 '3802 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_jsonb_opt _null_ _null_ _null_ _null_ ) insert ( 4204 ts_headline 11 10 12 100 0 0 0 f f f t f s s 2 0 3802 '3802 3615' _null_ _null_ _null_ _null_ _null_ ts_headline_jsonb _null_ _null_ _null_ _null_ ) insert ( 4205 ts_headline 11 10 12 100 0 0 0 f f f t f i s 4 0 114 '3734 114 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_json_byid_opt _null_ _null_ _null_ _null_ ) insert ( 4206 ts_headline 11 10 12 100 0 0 0 f f f t f i s 3 0 114 '3734 114 3615' _null_ _null_ _null_ _null_ _null_ ts_headline_json_byid _null_ _null_ _null_ _null_ ) insert ( 4207 ts_headline 11 10 12 100 0 0 0 f f f t f s s 3 0 114 '114 3615 25' _null_ _null_ _null_ _null_ _null_ ts_headline_json_opt _null_ _null_ _null_ _null_ ) insert ( 4208 ts_headline 11 10 12 100 0 0 0 f f f t f s s 2 0 114 '114 3615' _null_ _null_ _null_ _null_ _null_ ts_headline_json _null_ _null_ _null_ _null_ ) insert ( 3745 to_tsvector 11 10 12 100 0 0 0 f f f t f i s 2 0 3614 '3734 25' _null_ _null_ _null_ _null_ _null_ to_tsvector_byid _null_ _null_ _null_ _null_ ) insert ( 3746 to_tsquery 11 10 12 100 0 0 0 f f f t f i s 2 0 3615 '3734 25' _null_ _null_ _null_ _null_ _null_ to_tsquery_byid _null_ _null_ _null_ _null_ ) insert ( 3747 plainto_tsquery 11 10 12 100 0 0 0 f f f t f i s 2 0 3615 '3734 25' _null_ _null_ _null_ _null_ _null_ plainto_tsquery_byid _null_ _null_ _null_ _null_ ) insert ( 5006 phraseto_tsquery 11 10 12 100 0 0 0 f f f t f i s 2 0 3615 '3734 25' _null_ _null_ _null_ _null_ _null_ phraseto_tsquery_byid _null_ _null_ _null_ _null_ ) insert ( 5007 websearch_to_tsquery 11 10 12 100 0 0 0 f f f t f i s 2 0 3615 '3734 25' _null_ _null_ _null_ _null_ _null_ websearch_to_tsquery_byid _null_ _null_ _null_ _null_ ) insert ( 3749 to_tsvector 11 10 12 100 0 0 0 f f f t f s s 1 0 3614 25 _null_ _null_ _null_ _null_ _null_ to_tsvector _null_ _null_ _null_ _null_ ) insert ( 3750 to_tsquery 11 10 12 100 0 0 0 f f f t f s s 1 0 3615 25 _null_ _null_ _null_ _null_ _null_ to_tsquery _null_ _null_ _null_ _null_ ) insert ( 3751 plainto_tsquery 11 10 12 100 0 0 0 f f f t f s s 1 0 3615 25 _null_ _null_ _null_ _null_ _null_ plainto_tsquery _null_ _null_ _null_ _null_ ) insert ( 5001 phraseto_tsquery 11 10 12 100 0 0 0 f f f t f s s 1 0 3615 25 _null_ _null_ _null_ _null_ _null_ phraseto_tsquery _null_ _null_ _null_ _null_ ) insert ( 5009 websearch_to_tsquery 11 10 12 100 0 0 0 f f f t f s s 1 0 3615 25 _null_ _null_ _null_ _null_ _null_ websearch_to_tsquery _null_ _null_ _null_ _null_ ) insert ( 4209 to_tsvector 11 10 12 100 0 0 0 f f f t f s s 1 0 3614 3802 _null_ _null_ _null_ _null_ _null_ jsonb_string_to_tsvector _null_ _null_ _null_ _null_ ) insert ( 4213 jsonb_to_tsvector 11 10 12 100 0 0 0 f f f t f s s 2 0 3614 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_to_tsvector _null_ _null_ _null_ _null_ ) insert ( 4210 to_tsvector 11 10 12 100 0 0 0 f f f t f s s 1 0 3614 114 _null_ _null_ _null_ _null_ _null_ json_string_to_tsvector _null_ _null_ _null_ _null_ ) insert ( 4215 json_to_tsvector 11 10 12 100 0 0 0 f f f t f s s 2 0 3614 '114 3802' _null_ _null_ _null_ _null_ _null_ json_to_tsvector _null_ _null_ _null_ _null_ ) insert ( 4211 to_tsvector 11 10 12 100 0 0 0 f f f t f i s 2 0 3614 '3734 3802' _null_ _null_ _null_ _null_ _null_ jsonb_string_to_tsvector_byid _null_ _null_ _null_ _null_ ) insert ( 4214 jsonb_to_tsvector 11 10 12 100 0 0 0 f f f t f i s 3 0 3614 '3734 3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_to_tsvector_byid _null_ _null_ _null_ _null_ ) insert ( 4212 to_tsvector 11 10 12 100 0 0 0 f f f t f i s 2 0 3614 '3734 114' _null_ _null_ _null_ _null_ _null_ json_string_to_tsvector_byid _null_ _null_ _null_ _null_ ) insert ( 4216 json_to_tsvector 11 10 12 100 0 0 0 f f f t f i s 3 0 3614 '3734 114 3802' _null_ _null_ _null_ _null_ _null_ json_to_tsvector_byid _null_ _null_ _null_ _null_ ) insert ( 3752 tsvector_update_trigger 11 10 12 1 0 0 0 f f f f f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ tsvector_update_trigger_byid _null_ _null_ _null_ _null_ ) insert ( 3753 tsvector_update_trigger_column 11 10 12 1 0 0 0 f f f f f v s 0 0 2279 '' _null_ _null_ _null_ _null_ _null_ tsvector_update_trigger_bycolumn _null_ _null_ _null_ _null_ ) insert ( 3759 get_current_ts_config 11 10 12 1 0 0 0 f f f t f s s 0 0 3734 '' _null_ _null_ _null_ _null_ _null_ get_current_ts_config _null_ _null_ _null_ _null_ ) insert ( 3736 regconfigin 11 10 12 1 0 0 0 f f f t f s s 1 0 3734 2275 _null_ _null_ _null_ _null_ _null_ regconfigin _null_ _null_ _null_ _null_ ) insert ( 3737 regconfigout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3734 _null_ _null_ _null_ _null_ _null_ regconfigout _null_ _null_ _null_ _null_ ) insert ( 3738 regconfigrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 3734 2281 _null_ _null_ _null_ _null_ _null_ regconfigrecv _null_ _null_ _null_ _null_ ) insert ( 3739 regconfigsend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3734 _null_ _null_ _null_ _null_ _null_ regconfigsend _null_ _null_ _null_ _null_ ) insert ( 3771 regdictionaryin 11 10 12 1 0 0 0 f f f t f s s 1 0 3769 2275 _null_ _null_ _null_ _null_ _null_ regdictionaryin _null_ _null_ _null_ _null_ ) insert ( 3772 regdictionaryout 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3769 _null_ _null_ _null_ _null_ _null_ regdictionaryout _null_ _null_ _null_ _null_ ) insert ( 3773 regdictionaryrecv 11 10 12 1 0 0 0 f f f t f i s 1 0 3769 2281 _null_ _null_ _null_ _null_ _null_ regdictionaryrecv _null_ _null_ _null_ _null_ ) insert ( 3774 regdictionarysend 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3769 _null_ _null_ _null_ _null_ _null_ regdictionarysend _null_ _null_ _null_ _null_ ) insert ( 3806 jsonb_in 11 10 12 1 0 0 0 f f f t f i s 1 0 3802 2275 _null_ _null_ _null_ _null_ _null_ jsonb_in _null_ _null_ _null_ _null_ ) insert ( 3805 jsonb_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 3802 2281 _null_ _null_ _null_ _null_ _null_ jsonb_recv _null_ _null_ _null_ _null_ ) insert ( 3804 jsonb_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 3802 _null_ _null_ _null_ _null_ _null_ jsonb_out _null_ _null_ _null_ _null_ ) insert ( 3803 jsonb_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 3802 _null_ _null_ _null_ _null_ _null_ jsonb_send _null_ _null_ _null_ _null_ ) insert ( 3263 jsonb_object 11 10 12 1 0 0 0 f f f t f i s 1 0 3802 1009 _null_ _null_ _null_ _null_ _null_ jsonb_object _null_ _null_ _null_ _null_ ) insert ( 3264 jsonb_object 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '1009 1009' _null_ _null_ _null_ _null_ _null_ jsonb_object_two_arg _null_ _null_ _null_ _null_ ) insert ( 3787 to_jsonb 11 10 12 1 0 0 0 f f f t f s s 1 0 3802 2283 _null_ _null_ _null_ _null_ _null_ to_jsonb _null_ _null_ _null_ _null_ ) insert ( 3265 jsonb_agg_transfn 11 10 12 1 0 0 0 f f f f f s s 2 0 2281 '2281 2283' _null_ _null_ _null_ _null_ _null_ jsonb_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6283 jsonb_agg_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 2 0 2281 '2281 2283' _null_ _null_ _null_ _null_ _null_ jsonb_agg_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 3266 jsonb_agg_finalfn 11 10 12 1 0 0 0 f f f f f s s 1 0 3802 2281 _null_ _null_ _null_ _null_ _null_ jsonb_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3267 jsonb_agg 11 10 12 1 0 0 0 a f f f f s s 1 0 3802 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6284 jsonb_agg_strict 11 10 12 1 0 0 0 a f f f f s s 1 0 3802 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3268 jsonb_object_agg_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ jsonb_object_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6285 jsonb_object_agg_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ jsonb_object_agg_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 6286 jsonb_object_agg_unique_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ jsonb_object_agg_unique_transfn _null_ _null_ _null_ _null_ ) insert ( 6287 jsonb_object_agg_unique_strict_transfn 11 10 12 1 0 0 0 f f f f f s s 3 0 2281 '2281 2276 2276' _null_ _null_ _null_ _null_ _null_ jsonb_object_agg_unique_strict_transfn _null_ _null_ _null_ _null_ ) insert ( 3269 jsonb_object_agg_finalfn 11 10 12 1 0 0 0 f f f f f s s 1 0 3802 2281 _null_ _null_ _null_ _null_ _null_ jsonb_object_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 3270 jsonb_object_agg 11 10 12 1 0 0 0 a f f f f i s 2 0 3802 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6288 jsonb_object_agg_strict 11 10 12 1 0 0 0 a f f f f i s 2 0 3802 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6289 jsonb_object_agg_unique 11 10 12 1 0 0 0 a f f f f i s 2 0 3802 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6290 jsonb_object_agg_unique_strict 11 10 12 1 0 0 0 a f f f f i s 2 0 3802 '2276 2276' _null_ _null_ '{key,value}' _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3271 jsonb_build_array 11 10 12 1 0 2276 0 f f f f f s s 1 0 3802 2276 '{2276}' '{v}' _null_ _null_ _null_ jsonb_build_array _null_ _null_ _null_ _null_ ) insert ( 3272 jsonb_build_array 11 10 12 1 0 0 0 f f f f f s s 0 0 3802 '' _null_ _null_ _null_ _null_ _null_ jsonb_build_array_noargs _null_ _null_ _null_ _null_ ) insert ( 3273 jsonb_build_object 11 10 12 1 0 2276 0 f f f f f s s 1 0 3802 2276 '{2276}' '{v}' _null_ _null_ _null_ jsonb_build_object _null_ _null_ _null_ _null_ ) insert ( 3274 jsonb_build_object 11 10 12 1 0 0 0 f f f f f s s 0 0 3802 '' _null_ _null_ _null_ _null_ _null_ jsonb_build_object_noargs _null_ _null_ _null_ _null_ ) insert ( 3262 jsonb_strip_nulls 11 10 12 1 0 0 0 f f f t f i s 1 0 3802 3802 _null_ _null_ _null_ _null_ _null_ jsonb_strip_nulls _null_ _null_ _null_ _null_ ) insert ( 3478 jsonb_object_field 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 25' _null_ _null_ '{from_json, field_name}' _null_ _null_ jsonb_object_field _null_ _null_ _null_ _null_ ) insert ( 3214 jsonb_object_field_text 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '3802 25' _null_ _null_ '{from_json, field_name}' _null_ _null_ jsonb_object_field_text _null_ _null_ _null_ _null_ ) insert ( 3215 jsonb_array_element 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 23' _null_ _null_ '{from_json, element_index}' _null_ _null_ jsonb_array_element _null_ _null_ _null_ _null_ ) insert ( 3216 jsonb_array_element_text 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '3802 23' _null_ _null_ '{from_json, element_index}' _null_ _null_ jsonb_array_element_text _null_ _null_ _null_ _null_ ) insert ( 3217 jsonb_extract_path 11 10 12 1 0 25 0 f f f t f i s 2 0 3802 '3802 1009' '{3802,1009}' '{i,v}' '{from_json,path_elems}' _null_ _null_ jsonb_extract_path _null_ _null_ _null_ _null_ ) insert ( 3940 jsonb_extract_path_text 11 10 12 1 0 25 0 f f f t f i s 2 0 25 '3802 1009' '{3802,1009}' '{i,v}' '{from_json,path_elems}' _null_ _null_ jsonb_extract_path_text _null_ _null_ _null_ _null_ ) insert ( 3219 jsonb_array_elements 11 10 12 1 100 0 0 f f f t t i s 1 0 3802 3802 '{3802,3802}' '{i,o}' '{from_json,value}' _null_ _null_ jsonb_array_elements _null_ _null_ _null_ _null_ ) insert ( 3465 jsonb_array_elements_text 11 10 12 1 100 0 0 f f f t t i s 1 0 25 3802 '{3802,25}' '{i,o}' '{from_json,value}' _null_ _null_ jsonb_array_elements_text _null_ _null_ _null_ _null_ ) insert ( 3207 jsonb_array_length 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3802 _null_ _null_ _null_ _null_ _null_ jsonb_array_length _null_ _null_ _null_ _null_ ) insert ( 3931 jsonb_object_keys 11 10 12 1 100 0 0 f f f t t i s 1 0 25 3802 _null_ _null_ _null_ _null_ _null_ jsonb_object_keys _null_ _null_ _null_ _null_ ) insert ( 3208 jsonb_each 11 10 12 1 100 0 0 f f f t t i s 1 0 2249 3802 '{3802,25,3802}' '{i,o,o}' '{from_json,key,value}' _null_ _null_ jsonb_each _null_ _null_ _null_ _null_ ) insert ( 3932 jsonb_each_text 11 10 12 1 100 0 0 f f f t t i s 1 0 2249 3802 '{3802,25,25}' '{i,o,o}' '{from_json,key,value}' _null_ _null_ jsonb_each_text _null_ _null_ _null_ _null_ ) insert ( 3209 jsonb_populate_record 11 10 12 1 0 0 0 f f f f f s s 2 0 2283 '2283 3802' _null_ _null_ _null_ _null_ _null_ jsonb_populate_record _null_ _null_ _null_ _null_ ) insert ( 6338 jsonb_populate_record_valid 11 10 12 1 0 0 0 f f f f f s s 2 0 16 '2283 3802' _null_ _null_ _null_ _null_ _null_ jsonb_populate_record_valid _null_ _null_ _null_ _null_ ) insert ( 3475 jsonb_populate_recordset 11 10 12 1 100 0 0 f f f f t s s 2 0 2283 '2283 3802' _null_ _null_ _null_ _null_ _null_ jsonb_populate_recordset _null_ _null_ _null_ _null_ ) insert ( 3490 jsonb_to_record 11 10 12 1 0 0 0 f f f t f s s 1 0 2249 3802 _null_ _null_ _null_ _null_ _null_ jsonb_to_record _null_ _null_ _null_ _null_ ) insert ( 3491 jsonb_to_recordset 11 10 12 1 100 0 0 f f f f t s s 1 0 2249 3802 _null_ _null_ _null_ _null_ _null_ jsonb_to_recordset _null_ _null_ _null_ _null_ ) insert ( 3210 jsonb_typeof 11 10 12 1 0 0 0 f f f t f i s 1 0 25 3802 _null_ _null_ _null_ _null_ _null_ jsonb_typeof _null_ _null_ _null_ _null_ ) insert ( 4038 jsonb_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_ne _null_ _null_ _null_ _null_ ) insert ( 4039 jsonb_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_lt _null_ _null_ _null_ _null_ ) insert ( 4040 jsonb_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_gt _null_ _null_ _null_ _null_ ) insert ( 4041 jsonb_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_le _null_ _null_ _null_ _null_ ) insert ( 4042 jsonb_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_ge _null_ _null_ _null_ _null_ ) insert ( 4043 jsonb_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_eq _null_ _null_ _null_ _null_ ) insert ( 4044 jsonb_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_cmp _null_ _null_ _null_ _null_ ) insert ( 4045 jsonb_hash 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3802 _null_ _null_ _null_ _null_ _null_ jsonb_hash _null_ _null_ _null_ _null_ ) insert ( 3416 jsonb_hash_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '3802 20' _null_ _null_ _null_ _null_ _null_ jsonb_hash_extended _null_ _null_ _null_ _null_ ) insert ( 4046 jsonb_contains 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_contains _null_ _null_ _null_ _null_ ) insert ( 4047 jsonb_exists 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 25' _null_ _null_ _null_ _null_ _null_ jsonb_exists _null_ _null_ _null_ _null_ ) insert ( 4048 jsonb_exists_any 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 1009' _null_ _null_ _null_ _null_ _null_ jsonb_exists_any _null_ _null_ _null_ _null_ ) insert ( 4049 jsonb_exists_all 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 1009' _null_ _null_ _null_ _null_ _null_ jsonb_exists_all _null_ _null_ _null_ _null_ ) insert ( 4050 jsonb_contained 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_contained _null_ _null_ _null_ _null_ ) insert ( 3480 gin_compare_jsonb 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '25 25' _null_ _null_ _null_ _null_ _null_ gin_compare_jsonb _null_ _null_ _null_ _null_ ) insert ( 3482 gin_extract_jsonb 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '3802 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_jsonb _null_ _null_ _null_ _null_ ) insert ( 3483 gin_extract_jsonb_query 11 10 12 1 0 0 0 f f f t f i s 7 0 2281 '3802 2281 21 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_jsonb_query _null_ _null_ _null_ _null_ ) insert ( 3484 gin_consistent_jsonb 11 10 12 1 0 0 0 f f f t f i s 8 0 16 '2281 21 3802 23 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_consistent_jsonb _null_ _null_ _null_ _null_ ) insert ( 3488 gin_triconsistent_jsonb 11 10 12 1 0 0 0 f f f t f i s 7 0 18 '2281 21 3802 23 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_triconsistent_jsonb _null_ _null_ _null_ _null_ ) insert ( 3485 gin_extract_jsonb_path 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '3802 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_jsonb_path _null_ _null_ _null_ _null_ ) insert ( 3486 gin_extract_jsonb_query_path 11 10 12 1 0 0 0 f f f t f i s 7 0 2281 '3802 2281 21 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_extract_jsonb_query_path _null_ _null_ _null_ _null_ ) insert ( 3487 gin_consistent_jsonb_path 11 10 12 1 0 0 0 f f f t f i s 8 0 16 '2281 21 3802 23 2281 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_consistent_jsonb_path _null_ _null_ _null_ _null_ ) insert ( 3489 gin_triconsistent_jsonb_path 11 10 12 1 0 0 0 f f f t f i s 7 0 18 '2281 21 3802 23 2281 2281 2281' _null_ _null_ _null_ _null_ _null_ gin_triconsistent_jsonb_path _null_ _null_ _null_ _null_ ) insert ( 3301 jsonb_concat 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 3802' _null_ _null_ _null_ _null_ _null_ jsonb_concat _null_ _null_ _null_ _null_ ) insert ( 3302 jsonb_delete 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 25' _null_ _null_ _null_ _null_ _null_ jsonb_delete _null_ _null_ _null_ _null_ ) insert ( 3303 jsonb_delete 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 23' _null_ _null_ _null_ _null_ _null_ jsonb_delete_idx _null_ _null_ _null_ _null_ ) insert ( 3343 jsonb_delete 11 10 12 1 0 25 0 f f f t f i s 2 0 3802 '3802 1009' '{3802,1009}' '{i,v}' '{from_json,path_elems}' _null_ _null_ jsonb_delete_array _null_ _null_ _null_ _null_ ) insert ( 3304 jsonb_delete_path 11 10 12 1 0 0 0 f f f t f i s 2 0 3802 '3802 1009' _null_ _null_ _null_ _null_ _null_ jsonb_delete_path _null_ _null_ _null_ _null_ ) insert ( 5054 jsonb_set_lax 11 10 12 1 0 0 0 f f f f f i s 5 0 3802 '3802 1009 3802 16 25' _null_ _null_ _null_ _null_ _null_ jsonb_set_lax _null_ _null_ _null_ _null_ ) insert ( 3305 jsonb_set 11 10 12 1 0 0 0 f f f t f i s 4 0 3802 '3802 1009 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_set _null_ _null_ _null_ _null_ ) insert ( 3306 jsonb_pretty 11 10 12 1 0 0 0 f f f t f i s 1 0 25 3802 _null_ _null_ _null_ _null_ _null_ jsonb_pretty _null_ _null_ _null_ _null_ ) insert ( 3579 jsonb_insert 11 10 12 1 0 0 0 f f f t f i s 4 0 3802 '3802 1009 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_insert _null_ _null_ _null_ _null_ ) insert ( 4001 jsonpath_in 11 10 12 1 0 0 0 f f f t f i s 1 0 4072 2275 _null_ _null_ _null_ _null_ _null_ jsonpath_in _null_ _null_ _null_ _null_ ) insert ( 4002 jsonpath_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 4072 2281 _null_ _null_ _null_ _null_ _null_ jsonpath_recv _null_ _null_ _null_ _null_ ) insert ( 4003 jsonpath_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 4072 _null_ _null_ _null_ _null_ _null_ jsonpath_out _null_ _null_ _null_ _null_ ) insert ( 4004 jsonpath_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 4072 _null_ _null_ _null_ _null_ _null_ jsonpath_send _null_ _null_ _null_ _null_ ) insert ( 4005 jsonb_path_exists 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_exists _null_ _null_ _null_ _null_ ) insert ( 4006 jsonb_path_query 11 10 12 1 1000 0 0 f f f t t i s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query _null_ _null_ _null_ _null_ ) insert ( 4007 jsonb_path_query_array 11 10 12 1 0 0 0 f f f t f i s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query_array _null_ _null_ _null_ _null_ ) insert ( 4008 jsonb_path_query_first 11 10 12 1 0 0 0 f f f t f i s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query_first _null_ _null_ _null_ _null_ ) insert ( 4009 jsonb_path_match 11 10 12 1 0 0 0 f f f t f i s 4 0 16 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_match _null_ _null_ _null_ _null_ ) insert ( 1177 jsonb_path_exists_tz 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_exists_tz _null_ _null_ _null_ _null_ ) insert ( 1179 jsonb_path_query_tz 11 10 12 1 1000 0 0 f f f t t s s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query_tz _null_ _null_ _null_ _null_ ) insert ( 1180 jsonb_path_query_array_tz 11 10 12 1 0 0 0 f f f t f s s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query_array_tz _null_ _null_ _null_ _null_ ) insert ( 2023 jsonb_path_query_first_tz 11 10 12 1 0 0 0 f f f t f s s 4 0 3802 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_query_first_tz _null_ _null_ _null_ _null_ ) insert ( 2030 jsonb_path_match_tz 11 10 12 1 0 0 0 f f f t f s s 4 0 16 '3802 4072 3802 16' _null_ _null_ _null_ _null_ _null_ jsonb_path_match_tz _null_ _null_ _null_ _null_ ) insert ( 4010 jsonb_path_exists_opr 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 4072' _null_ _null_ _null_ _null_ _null_ jsonb_path_exists_opr _null_ _null_ _null_ _null_ ) insert ( 4011 jsonb_path_match_opr 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3802 4072' _null_ _null_ _null_ _null_ _null_ jsonb_path_match_opr _null_ _null_ _null_ _null_ ) insert ( 2939 txid_snapshot_in 11 10 12 1 0 0 0 f f f t f i s 1 0 2970 2275 _null_ _null_ _null_ _null_ _null_ pg_snapshot_in _null_ _null_ _null_ _null_ ) insert ( 2940 txid_snapshot_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 2970 _null_ _null_ _null_ _null_ _null_ pg_snapshot_out _null_ _null_ _null_ _null_ ) insert ( 2941 txid_snapshot_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 2970 2281 _null_ _null_ _null_ _null_ _null_ pg_snapshot_recv _null_ _null_ _null_ _null_ ) insert ( 2942 txid_snapshot_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 2970 _null_ _null_ _null_ _null_ _null_ pg_snapshot_send _null_ _null_ _null_ _null_ ) insert ( 2943 txid_current 11 10 12 1 0 0 0 f f f t f s u 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_current_xact_id _null_ _null_ _null_ _null_ ) insert ( 3348 txid_current_if_assigned 11 10 12 1 0 0 0 f f f t f s u 0 0 20 '' _null_ _null_ _null_ _null_ _null_ pg_current_xact_id_if_assigned _null_ _null_ _null_ _null_ ) insert ( 2944 txid_current_snapshot 11 10 12 1 0 0 0 f f f t f s s 0 0 2970 '' _null_ _null_ _null_ _null_ _null_ pg_current_snapshot _null_ _null_ _null_ _null_ ) insert ( 2945 txid_snapshot_xmin 11 10 12 1 0 0 0 f f f t f i s 1 0 20 2970 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xmin _null_ _null_ _null_ _null_ ) insert ( 2946 txid_snapshot_xmax 11 10 12 1 0 0 0 f f f t f i s 1 0 20 2970 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xmax _null_ _null_ _null_ _null_ ) insert ( 2947 txid_snapshot_xip 11 10 12 1 50 0 0 f f f t t i s 1 0 20 2970 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xip _null_ _null_ _null_ _null_ ) insert ( 2948 txid_visible_in_snapshot 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '20 2970' _null_ _null_ _null_ _null_ _null_ pg_visible_in_snapshot _null_ _null_ _null_ _null_ ) insert ( 3360 txid_status 11 10 12 1 0 0 0 f f f t f v s 1 0 25 20 _null_ _null_ _null_ _null_ _null_ pg_xact_status _null_ _null_ _null_ _null_ ) insert ( 5055 pg_snapshot_in 11 10 12 1 0 0 0 f f f t f i s 1 0 5038 2275 _null_ _null_ _null_ _null_ _null_ pg_snapshot_in _null_ _null_ _null_ _null_ ) insert ( 5056 pg_snapshot_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 5038 _null_ _null_ _null_ _null_ _null_ pg_snapshot_out _null_ _null_ _null_ _null_ ) insert ( 5057 pg_snapshot_recv 11 10 12 1 0 0 0 f f f t f i s 1 0 5038 2281 _null_ _null_ _null_ _null_ _null_ pg_snapshot_recv _null_ _null_ _null_ _null_ ) insert ( 5058 pg_snapshot_send 11 10 12 1 0 0 0 f f f t f i s 1 0 17 5038 _null_ _null_ _null_ _null_ _null_ pg_snapshot_send _null_ _null_ _null_ _null_ ) insert ( 5061 pg_current_snapshot 11 10 12 1 0 0 0 f f f t f s s 0 0 5038 '' _null_ _null_ _null_ _null_ _null_ pg_current_snapshot _null_ _null_ _null_ _null_ ) insert ( 5062 pg_snapshot_xmin 11 10 12 1 0 0 0 f f f t f i s 1 0 5069 5038 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xmin _null_ _null_ _null_ _null_ ) insert ( 5063 pg_snapshot_xmax 11 10 12 1 0 0 0 f f f t f i s 1 0 5069 5038 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xmax _null_ _null_ _null_ _null_ ) insert ( 5064 pg_snapshot_xip 11 10 12 1 50 0 0 f f f t t i s 1 0 5069 5038 _null_ _null_ _null_ _null_ _null_ pg_snapshot_xip _null_ _null_ _null_ _null_ ) insert ( 5065 pg_visible_in_snapshot 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '5069 5038' _null_ _null_ _null_ _null_ _null_ pg_visible_in_snapshot _null_ _null_ _null_ _null_ ) insert ( 5059 pg_current_xact_id 11 10 12 1 0 0 0 f f f t f s u 0 0 5069 '' _null_ _null_ _null_ _null_ _null_ pg_current_xact_id _null_ _null_ _null_ _null_ ) insert ( 5060 pg_current_xact_id_if_assigned 11 10 12 1 0 0 0 f f f t f s u 0 0 5069 '' _null_ _null_ _null_ _null_ _null_ pg_current_xact_id_if_assigned _null_ _null_ _null_ _null_ ) insert ( 5066 pg_xact_status 11 10 12 1 0 0 0 f f f t f v s 1 0 25 5069 _null_ _null_ _null_ _null_ _null_ pg_xact_status _null_ _null_ _null_ _null_ ) insert ( 2981 record_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_eq _null_ _null_ _null_ _null_ ) insert ( 2982 record_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_ne _null_ _null_ _null_ _null_ ) insert ( 2983 record_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_lt _null_ _null_ _null_ _null_ ) insert ( 2984 record_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_gt _null_ _null_ _null_ _null_ ) insert ( 2985 record_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_le _null_ _null_ _null_ _null_ ) insert ( 2986 record_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_ge _null_ _null_ _null_ _null_ ) insert ( 2987 btrecordcmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2249 2249' _null_ _null_ _null_ _null_ _null_ btrecordcmp _null_ _null_ _null_ _null_ ) insert ( 6192 hash_record 11 10 12 1 0 0 0 f f f t f i s 1 0 23 2249 _null_ _null_ _null_ _null_ _null_ hash_record _null_ _null_ _null_ _null_ ) insert ( 6193 hash_record_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '2249 20' _null_ _null_ _null_ _null_ _null_ hash_record_extended _null_ _null_ _null_ _null_ ) insert ( 3181 record_image_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_eq _null_ _null_ _null_ _null_ ) insert ( 3182 record_image_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_ne _null_ _null_ _null_ _null_ ) insert ( 3183 record_image_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_lt _null_ _null_ _null_ _null_ ) insert ( 3184 record_image_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_gt _null_ _null_ _null_ _null_ ) insert ( 3185 record_image_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_le _null_ _null_ _null_ _null_ ) insert ( 3186 record_image_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2249 2249' _null_ _null_ _null_ _null_ _null_ record_image_ge _null_ _null_ _null_ _null_ ) insert ( 3187 btrecordimagecmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '2249 2249' _null_ _null_ _null_ _null_ _null_ btrecordimagecmp _null_ _null_ _null_ _null_ ) insert ( 5051 btequalimage 11 10 12 1 0 0 0 f f f t f i s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ btequalimage _null_ _null_ _null_ _null_ ) insert ( 3082 pg_available_extensions 11 10 12 10 100 0 0 f f f t t s s 0 0 2249 '' '{19,25,25}' '{o,o,o}' '{name,default_version,comment}' _null_ _null_ pg_available_extensions _null_ _null_ _null_ _null_ ) insert ( 3083 pg_available_extension_versions 11 10 12 10 100 0 0 f f f t t s s 0 0 2249 '' '{19,25,16,16,16,19,1003,25}' '{o,o,o,o,o,o,o,o}' '{name,version,superuser,trusted,relocatable,schema,requires,comment}' _null_ _null_ pg_available_extension_versions _null_ _null_ _null_ _null_ ) insert ( 3084 pg_extension_update_paths 11 10 12 10 100 0 0 f f f t t s s 1 0 2249 19 '{19,25,25,25}' '{i,o,o,o}' '{name,source,target,path}' _null_ _null_ pg_extension_update_paths _null_ _null_ _null_ _null_ ) insert ( 3086 pg_extension_config_dump 11 10 12 1 0 0 0 f f f t f v u 2 0 2278 '2205 25' _null_ _null_ _null_ _null_ _null_ pg_extension_config_dump _null_ _null_ _null_ _null_ ) insert ( 3100 row_number 11 10 12 1 0 0 6233 w f f f f i s 0 0 20 '' _null_ _null_ _null_ _null_ _null_ window_row_number _null_ _null_ _null_ _null_ ) insert ( 6233 window_row_number_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_row_number_support _null_ _null_ _null_ _null_ ) insert ( 3101 rank 11 10 12 1 0 0 6234 w f f f f i s 0 0 20 '' _null_ _null_ _null_ _null_ _null_ window_rank _null_ _null_ _null_ _null_ ) insert ( 6234 window_rank_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_rank_support _null_ _null_ _null_ _null_ ) insert ( 3102 dense_rank 11 10 12 1 0 0 6235 w f f f f i s 0 0 20 '' _null_ _null_ _null_ _null_ _null_ window_dense_rank _null_ _null_ _null_ _null_ ) insert ( 6235 window_dense_rank_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_dense_rank_support _null_ _null_ _null_ _null_ ) insert ( 3103 percent_rank 11 10 12 1 0 0 6306 w f f f f i s 0 0 701 '' _null_ _null_ _null_ _null_ _null_ window_percent_rank _null_ _null_ _null_ _null_ ) insert ( 6306 window_percent_rank_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_percent_rank_support _null_ _null_ _null_ _null_ ) insert ( 3104 cume_dist 11 10 12 1 0 0 6307 w f f f f i s 0 0 701 '' _null_ _null_ _null_ _null_ _null_ window_cume_dist _null_ _null_ _null_ _null_ ) insert ( 6307 window_cume_dist_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_cume_dist_support _null_ _null_ _null_ _null_ ) insert ( 3105 ntile 11 10 12 1 0 0 6308 w f f t f i s 1 0 23 23 _null_ _null_ _null_ _null_ _null_ window_ntile _null_ _null_ _null_ _null_ ) insert ( 6308 window_ntile_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ window_ntile_support _null_ _null_ _null_ _null_ ) insert ( 3106 lag 11 10 12 1 0 0 0 w f f t f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ window_lag _null_ _null_ _null_ _null_ ) insert ( 3107 lag 11 10 12 1 0 0 0 w f f t f i s 2 0 2283 '2283 23' _null_ _null_ _null_ _null_ _null_ window_lag_with_offset _null_ _null_ _null_ _null_ ) insert ( 3108 lag 11 10 12 1 0 0 0 w f f t f i s 3 0 5077 '5077 23 5077' _null_ _null_ _null_ _null_ _null_ window_lag_with_offset_and_default _null_ _null_ _null_ _null_ ) insert ( 3109 lead 11 10 12 1 0 0 0 w f f t f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ window_lead _null_ _null_ _null_ _null_ ) insert ( 3110 lead 11 10 12 1 0 0 0 w f f t f i s 2 0 2283 '2283 23' _null_ _null_ _null_ _null_ _null_ window_lead_with_offset _null_ _null_ _null_ _null_ ) insert ( 3111 lead 11 10 12 1 0 0 0 w f f t f i s 3 0 5077 '5077 23 5077' _null_ _null_ _null_ _null_ _null_ window_lead_with_offset_and_default _null_ _null_ _null_ _null_ ) insert ( 3112 first_value 11 10 12 1 0 0 0 w f f t f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ window_first_value _null_ _null_ _null_ _null_ ) insert ( 3113 last_value 11 10 12 1 0 0 0 w f f t f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ window_last_value _null_ _null_ _null_ _null_ ) insert ( 3114 nth_value 11 10 12 1 0 0 0 w f f t f i s 2 0 2283 '2283 23' _null_ _null_ _null_ _null_ _null_ window_nth_value _null_ _null_ _null_ _null_ ) insert ( 3832 anyrange_in 11 10 12 1 0 0 0 f f f t f s s 3 0 3831 '2275 26 23' _null_ _null_ _null_ _null_ _null_ anyrange_in _null_ _null_ _null_ _null_ ) insert ( 3833 anyrange_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3831 _null_ _null_ _null_ _null_ _null_ anyrange_out _null_ _null_ _null_ _null_ ) insert ( 3834 range_in 11 10 12 1 0 0 0 f f f t f s s 3 0 3831 '2275 26 23' _null_ _null_ _null_ _null_ _null_ range_in _null_ _null_ _null_ _null_ ) insert ( 3835 range_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 3831 _null_ _null_ _null_ _null_ _null_ range_out _null_ _null_ _null_ _null_ ) insert ( 3836 range_recv 11 10 12 1 0 0 0 f f f t f s s 3 0 3831 '2281 26 23' _null_ _null_ _null_ _null_ _null_ range_recv _null_ _null_ _null_ _null_ ) insert ( 3837 range_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 3831 _null_ _null_ _null_ _null_ _null_ range_send _null_ _null_ _null_ _null_ ) insert ( 3848 lower 11 10 12 1 0 0 0 f f f t f i s 1 0 2283 3831 _null_ _null_ _null_ _null_ _null_ range_lower _null_ _null_ _null_ _null_ ) insert ( 3849 upper 11 10 12 1 0 0 0 f f f t f i s 1 0 2283 3831 _null_ _null_ _null_ _null_ _null_ range_upper _null_ _null_ _null_ _null_ ) insert ( 3850 isempty 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3831 _null_ _null_ _null_ _null_ _null_ range_empty _null_ _null_ _null_ _null_ ) insert ( 3851 lower_inc 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3831 _null_ _null_ _null_ _null_ _null_ range_lower_inc _null_ _null_ _null_ _null_ ) insert ( 3852 upper_inc 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3831 _null_ _null_ _null_ _null_ _null_ range_upper_inc _null_ _null_ _null_ _null_ ) insert ( 3853 lower_inf 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3831 _null_ _null_ _null_ _null_ _null_ range_lower_inf _null_ _null_ _null_ _null_ ) insert ( 3854 upper_inf 11 10 12 1 0 0 0 f f f t f i s 1 0 16 3831 _null_ _null_ _null_ _null_ _null_ range_upper_inf _null_ _null_ _null_ _null_ ) insert ( 3855 range_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_eq _null_ _null_ _null_ _null_ ) insert ( 3856 range_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_ne _null_ _null_ _null_ _null_ ) insert ( 3857 range_overlaps 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_overlaps _null_ _null_ _null_ _null_ ) insert ( 3858 range_contains_elem 11 10 12 1 0 0 6345 f f f t f i s 2 0 16 '3831 2283' _null_ _null_ _null_ _null_ _null_ range_contains_elem _null_ _null_ _null_ _null_ ) insert ( 3859 range_contains 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_contains _null_ _null_ _null_ _null_ ) insert ( 3860 elem_contained_by_range 11 10 12 1 0 0 6346 f f f t f i s 2 0 16 '2283 3831' _null_ _null_ _null_ _null_ _null_ elem_contained_by_range _null_ _null_ _null_ _null_ ) insert ( 3861 range_contained_by 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_contained_by _null_ _null_ _null_ _null_ ) insert ( 3862 range_adjacent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_adjacent _null_ _null_ _null_ _null_ ) insert ( 3863 range_before 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_before _null_ _null_ _null_ _null_ ) insert ( 3864 range_after 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_after _null_ _null_ _null_ _null_ ) insert ( 3865 range_overleft 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_overleft _null_ _null_ _null_ _null_ ) insert ( 3866 range_overright 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_overright _null_ _null_ _null_ _null_ ) insert ( 3867 range_union 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_union _null_ _null_ _null_ _null_ ) insert ( 6345 range_contains_elem_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ range_contains_elem_support _null_ _null_ _null_ _null_ ) insert ( 6346 elem_contained_by_range_support 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ elem_contained_by_range_support _null_ _null_ _null_ _null_ ) insert ( 4057 range_merge 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_merge _null_ _null_ _null_ _null_ ) insert ( 4228 range_merge 11 10 12 1 0 0 0 f f f t f i s 1 0 3831 4537 _null_ _null_ _null_ _null_ _null_ range_merge_from_multirange _null_ _null_ _null_ _null_ ) insert ( 3868 range_intersect 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_intersect _null_ _null_ _null_ _null_ ) insert ( 3869 range_minus 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_minus _null_ _null_ _null_ _null_ ) insert ( 3870 range_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_cmp _null_ _null_ _null_ _null_ ) insert ( 3871 range_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_lt _null_ _null_ _null_ _null_ ) insert ( 3872 range_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_le _null_ _null_ _null_ _null_ ) insert ( 3873 range_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_ge _null_ _null_ _null_ _null_ ) insert ( 3874 range_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_gt _null_ _null_ _null_ _null_ ) insert ( 3875 range_gist_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 3831 21 26 2281' _null_ _null_ _null_ _null_ _null_ range_gist_consistent _null_ _null_ _null_ _null_ ) insert ( 3876 range_gist_union 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '2281 2281' _null_ _null_ _null_ _null_ _null_ range_gist_union _null_ _null_ _null_ _null_ ) insert ( 3879 range_gist_penalty 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '2281 2281 2281' _null_ _null_ _null_ _null_ _null_ range_gist_penalty _null_ _null_ _null_ _null_ ) insert ( 3880 range_gist_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2281 '2281 2281' _null_ _null_ _null_ _null_ _null_ range_gist_picksplit _null_ _null_ _null_ _null_ ) insert ( 3881 range_gist_same 11 10 12 1 0 0 0 f f f t f i s 3 0 2281 '3831 3831 2281' _null_ _null_ _null_ _null_ _null_ range_gist_same _null_ _null_ _null_ _null_ ) insert ( 6154 multirange_gist_consistent 11 10 12 1 0 0 0 f f f t f i s 5 0 16 '2281 4537 21 26 2281' _null_ _null_ _null_ _null_ _null_ multirange_gist_consistent _null_ _null_ _null_ _null_ ) insert ( 6156 multirange_gist_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ multirange_gist_compress _null_ _null_ _null_ _null_ ) insert ( 3902 hash_range 11 10 12 1 0 0 0 f f f t f i s 1 0 23 3831 _null_ _null_ _null_ _null_ _null_ hash_range _null_ _null_ _null_ _null_ ) insert ( 3417 hash_range_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '3831 20' _null_ _null_ _null_ _null_ _null_ hash_range_extended _null_ _null_ _null_ _null_ ) insert ( 3916 range_typanalyze 11 10 12 1 0 0 0 f f f t f s s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ range_typanalyze _null_ _null_ _null_ _null_ ) insert ( 3169 rangesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ rangesel _null_ _null_ _null_ _null_ ) insert ( 4401 range_intersect_agg_transfn 11 10 12 1 0 0 0 f f f t f i s 2 0 3831 '3831 3831' _null_ _null_ _null_ _null_ _null_ range_intersect_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 4450 range_intersect_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 3831 3831 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3914 int4range_canonical 11 10 12 1 0 0 0 f f f t f i s 1 0 3904 3904 _null_ _null_ _null_ _null_ _null_ int4range_canonical _null_ _null_ _null_ _null_ ) insert ( 3928 int8range_canonical 11 10 12 1 0 0 0 f f f t f i s 1 0 3926 3926 _null_ _null_ _null_ _null_ _null_ int8range_canonical _null_ _null_ _null_ _null_ ) insert ( 3915 daterange_canonical 11 10 12 1 0 0 0 f f f t f i s 1 0 3912 3912 _null_ _null_ _null_ _null_ _null_ daterange_canonical _null_ _null_ _null_ _null_ ) insert ( 3922 int4range_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '23 23' _null_ _null_ _null_ _null_ _null_ int4range_subdiff _null_ _null_ _null_ _null_ ) insert ( 3923 int8range_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '20 20' _null_ _null_ _null_ _null_ _null_ int8range_subdiff _null_ _null_ _null_ _null_ ) insert ( 3924 numrange_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '1700 1700' _null_ _null_ _null_ _null_ _null_ numrange_subdiff _null_ _null_ _null_ _null_ ) insert ( 3925 daterange_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '1082 1082' _null_ _null_ _null_ _null_ _null_ daterange_subdiff _null_ _null_ _null_ _null_ ) insert ( 3929 tsrange_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '1114 1114' _null_ _null_ _null_ _null_ _null_ tsrange_subdiff _null_ _null_ _null_ _null_ ) insert ( 3930 tstzrange_subdiff 11 10 12 1 0 0 0 f f f t f i s 2 0 701 '1184 1184' _null_ _null_ _null_ _null_ _null_ tstzrange_subdiff _null_ _null_ _null_ _null_ ) insert ( 3840 int4range 11 10 12 1 0 0 0 f f f f f i s 2 0 3904 '23 23' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3841 int4range 11 10 12 1 0 0 0 f f f f f i s 3 0 3904 '23 23 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 3844 numrange 11 10 12 1 0 0 0 f f f f f i s 2 0 3906 '1700 1700' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3845 numrange 11 10 12 1 0 0 0 f f f f f i s 3 0 3906 '1700 1700 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 3933 tsrange 11 10 12 1 0 0 0 f f f f f i s 2 0 3908 '1114 1114' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3934 tsrange 11 10 12 1 0 0 0 f f f f f i s 3 0 3908 '1114 1114 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 3937 tstzrange 11 10 12 1 0 0 0 f f f f f i s 2 0 3910 '1184 1184' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3938 tstzrange 11 10 12 1 0 0 0 f f f f f i s 3 0 3910 '1184 1184 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 3941 daterange 11 10 12 1 0 0 0 f f f f f i s 2 0 3912 '1082 1082' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3942 daterange 11 10 12 1 0 0 0 f f f f f i s 3 0 3912 '1082 1082 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 3945 int8range 11 10 12 1 0 0 0 f f f f f i s 2 0 3926 '20 20' _null_ _null_ _null_ _null_ _null_ range_constructor2 _null_ _null_ _null_ _null_ ) insert ( 3946 int8range 11 10 12 1 0 0 0 f f f f f i s 3 0 3926 '20 20 25' _null_ _null_ _null_ _null_ _null_ range_constructor3 _null_ _null_ _null_ _null_ ) insert ( 4229 anymultirange_in 11 10 12 1 0 0 0 f f f t f s s 3 0 4537 '2275 26 23' _null_ _null_ _null_ _null_ _null_ anymultirange_in _null_ _null_ _null_ _null_ ) insert ( 4230 anymultirange_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4537 _null_ _null_ _null_ _null_ _null_ anymultirange_out _null_ _null_ _null_ _null_ ) insert ( 4231 multirange_in 11 10 12 1 0 0 0 f f f t f s s 3 0 4537 '2275 26 23' _null_ _null_ _null_ _null_ _null_ multirange_in _null_ _null_ _null_ _null_ ) insert ( 4232 multirange_out 11 10 12 1 0 0 0 f f f t f s s 1 0 2275 4537 _null_ _null_ _null_ _null_ _null_ multirange_out _null_ _null_ _null_ _null_ ) insert ( 4233 multirange_recv 11 10 12 1 0 0 0 f f f t f s s 3 0 4537 '2281 26 23' _null_ _null_ _null_ _null_ _null_ multirange_recv _null_ _null_ _null_ _null_ ) insert ( 4234 multirange_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 4537 _null_ _null_ _null_ _null_ _null_ multirange_send _null_ _null_ _null_ _null_ ) insert ( 4235 lower 11 10 12 1 0 0 0 f f f t f i s 1 0 2283 4537 _null_ _null_ _null_ _null_ _null_ multirange_lower _null_ _null_ _null_ _null_ ) insert ( 4236 upper 11 10 12 1 0 0 0 f f f t f i s 1 0 2283 4537 _null_ _null_ _null_ _null_ _null_ multirange_upper _null_ _null_ _null_ _null_ ) insert ( 4237 isempty 11 10 12 1 0 0 0 f f f t f i s 1 0 16 4537 _null_ _null_ _null_ _null_ _null_ multirange_empty _null_ _null_ _null_ _null_ ) insert ( 4238 lower_inc 11 10 12 1 0 0 0 f f f t f i s 1 0 16 4537 _null_ _null_ _null_ _null_ _null_ multirange_lower_inc _null_ _null_ _null_ _null_ ) insert ( 4239 upper_inc 11 10 12 1 0 0 0 f f f t f i s 1 0 16 4537 _null_ _null_ _null_ _null_ _null_ multirange_upper_inc _null_ _null_ _null_ _null_ ) insert ( 4240 lower_inf 11 10 12 1 0 0 0 f f f t f i s 1 0 16 4537 _null_ _null_ _null_ _null_ _null_ multirange_lower_inf _null_ _null_ _null_ _null_ ) insert ( 4241 upper_inf 11 10 12 1 0 0 0 f f f t f i s 1 0 16 4537 _null_ _null_ _null_ _null_ _null_ multirange_upper_inf _null_ _null_ _null_ _null_ ) insert ( 4242 multirange_typanalyze 11 10 12 1 0 0 0 f f f t f s s 1 0 16 2281 _null_ _null_ _null_ _null_ _null_ multirange_typanalyze _null_ _null_ _null_ _null_ ) insert ( 4243 multirangesel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ multirangesel _null_ _null_ _null_ _null_ ) insert ( 4244 multirange_eq 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_eq _null_ _null_ _null_ _null_ ) insert ( 4245 multirange_ne 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_ne _null_ _null_ _null_ _null_ ) insert ( 4246 range_overlaps_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_overlaps_multirange _null_ _null_ _null_ _null_ ) insert ( 4247 multirange_overlaps_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_overlaps_range _null_ _null_ _null_ _null_ ) insert ( 4248 multirange_overlaps_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_overlaps_multirange _null_ _null_ _null_ _null_ ) insert ( 4249 multirange_contains_elem 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 2283' _null_ _null_ _null_ _null_ _null_ multirange_contains_elem _null_ _null_ _null_ _null_ ) insert ( 4250 multirange_contains_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_contains_range _null_ _null_ _null_ _null_ ) insert ( 4251 multirange_contains_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_contains_multirange _null_ _null_ _null_ _null_ ) insert ( 4252 elem_contained_by_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2283 4537' _null_ _null_ _null_ _null_ _null_ elem_contained_by_multirange _null_ _null_ _null_ _null_ ) insert ( 4253 range_contained_by_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_contained_by_multirange _null_ _null_ _null_ _null_ ) insert ( 4541 range_contains_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_contains_multirange _null_ _null_ _null_ _null_ ) insert ( 4542 multirange_contained_by_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_contained_by_range _null_ _null_ _null_ _null_ ) insert ( 4254 multirange_contained_by_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_contained_by_multirange _null_ _null_ _null_ _null_ ) insert ( 4255 range_adjacent_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_adjacent_multirange _null_ _null_ _null_ _null_ ) insert ( 4256 multirange_adjacent_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_adjacent_multirange _null_ _null_ _null_ _null_ ) insert ( 4257 multirange_adjacent_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_adjacent_range _null_ _null_ _null_ _null_ ) insert ( 4258 range_before_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_before_multirange _null_ _null_ _null_ _null_ ) insert ( 4259 multirange_before_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_before_range _null_ _null_ _null_ _null_ ) insert ( 4260 multirange_before_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_before_multirange _null_ _null_ _null_ _null_ ) insert ( 4261 range_after_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_after_multirange _null_ _null_ _null_ _null_ ) insert ( 4262 multirange_after_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_after_range _null_ _null_ _null_ _null_ ) insert ( 4263 multirange_after_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_after_multirange _null_ _null_ _null_ _null_ ) insert ( 4264 range_overleft_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_overleft_multirange _null_ _null_ _null_ _null_ ) insert ( 4265 multirange_overleft_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_overleft_range _null_ _null_ _null_ _null_ ) insert ( 4266 multirange_overleft_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_overleft_multirange _null_ _null_ _null_ _null_ ) insert ( 4267 range_overright_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '3831 4537' _null_ _null_ _null_ _null_ _null_ range_overright_multirange _null_ _null_ _null_ _null_ ) insert ( 4268 multirange_overright_range 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 3831' _null_ _null_ _null_ _null_ _null_ multirange_overright_range _null_ _null_ _null_ _null_ ) insert ( 4269 multirange_overright_multirange 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_overright_multirange _null_ _null_ _null_ _null_ ) insert ( 4270 multirange_union 11 10 12 1 0 0 0 f f f t f i s 2 0 4537 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_union _null_ _null_ _null_ _null_ ) insert ( 4271 multirange_minus 11 10 12 1 0 0 0 f f f t f i s 2 0 4537 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_minus _null_ _null_ _null_ _null_ ) insert ( 4272 multirange_intersect 11 10 12 1 0 0 0 f f f t f i s 2 0 4537 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_intersect _null_ _null_ _null_ _null_ ) insert ( 4273 multirange_cmp 11 10 12 1 0 0 0 f f f t f i s 2 0 23 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_cmp _null_ _null_ _null_ _null_ ) insert ( 4274 multirange_lt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_lt _null_ _null_ _null_ _null_ ) insert ( 4275 multirange_le 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_le _null_ _null_ _null_ _null_ ) insert ( 4276 multirange_ge 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_ge _null_ _null_ _null_ _null_ ) insert ( 4277 multirange_gt 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_gt _null_ _null_ _null_ _null_ ) insert ( 4278 hash_multirange 11 10 12 1 0 0 0 f f f t f i s 1 0 23 4537 _null_ _null_ _null_ _null_ _null_ hash_multirange _null_ _null_ _null_ _null_ ) insert ( 4279 hash_multirange_extended 11 10 12 1 0 0 0 f f f t f i s 2 0 20 '4537 20' _null_ _null_ _null_ _null_ _null_ hash_multirange_extended _null_ _null_ _null_ _null_ ) insert ( 4280 int4multirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4451 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4281 int4multirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4451 3904 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4282 int4multirange 11 10 12 1 0 3904 0 f f f t f i s 1 0 4451 3905 '{3905}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4283 nummultirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4532 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4284 nummultirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4532 3906 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4285 nummultirange 11 10 12 1 0 3906 0 f f f t f i s 1 0 4532 3907 '{3907}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4286 tsmultirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4533 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4287 tsmultirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4533 3908 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4288 tsmultirange 11 10 12 1 0 3908 0 f f f t f i s 1 0 4533 3909 '{3909}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4289 tstzmultirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4534 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4290 tstzmultirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4534 3910 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4291 tstzmultirange 11 10 12 1 0 3910 0 f f f t f i s 1 0 4534 3911 '{3911}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4292 datemultirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4535 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4293 datemultirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4535 3912 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4294 datemultirange 11 10 12 1 0 3912 0 f f f t f i s 1 0 4535 3913 '{3913}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4295 int8multirange 11 10 12 1 0 0 0 f f f t f i s 0 0 4536 '' _null_ _null_ _null_ _null_ _null_ multirange_constructor0 _null_ _null_ _null_ _null_ ) insert ( 4296 int8multirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4536 3926 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4297 int8multirange 11 10 12 1 0 3926 0 f f f t f i s 1 0 4536 3927 '{3927}' '{v}' _null_ _null_ _null_ multirange_constructor2 _null_ _null_ _null_ _null_ ) insert ( 4298 multirange 11 10 12 1 0 0 0 f f f t f i s 1 0 4537 3831 _null_ _null_ _null_ _null_ _null_ multirange_constructor1 _null_ _null_ _null_ _null_ ) insert ( 4299 range_agg_transfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 3831' _null_ _null_ _null_ _null_ _null_ range_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 4300 range_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 2 0 4537 '2281 3831' _null_ _null_ _null_ _null_ _null_ range_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 4301 range_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 4537 3831 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6225 multirange_agg_transfn 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 4537' _null_ _null_ _null_ _null_ _null_ multirange_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 6226 multirange_agg_finalfn 11 10 12 1 0 0 0 f f f f f i s 2 0 4537 '2281 4537' _null_ _null_ _null_ _null_ _null_ range_agg_finalfn _null_ _null_ _null_ _null_ ) insert ( 6227 range_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 4537 4537 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 4388 multirange_intersect_agg_transfn 11 10 12 1 0 0 0 f f f t f i s 2 0 4537 '4537 4537' _null_ _null_ _null_ _null_ _null_ multirange_intersect_agg_transfn _null_ _null_ _null_ _null_ ) insert ( 4389 range_intersect_agg 11 10 12 1 0 0 0 a f f f f i s 1 0 4537 4537 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 1293 unnest 11 10 12 1 100 0 0 f f f t t i s 1 0 3831 4537 _null_ _null_ _null_ _null_ _null_ multirange_unnest _null_ _null_ _null_ _null_ ) insert ( 3846 make_date 11 10 12 1 0 0 0 f f f t f i s 3 0 1082 '23 23 23' _null_ _null_ '{year,month,day}' _null_ _null_ make_date _null_ _null_ _null_ _null_ ) insert ( 3847 make_time 11 10 12 1 0 0 0 f f f t f i s 3 0 1083 '23 23 701' _null_ _null_ '{hour,min,sec}' _null_ _null_ make_time _null_ _null_ _null_ _null_ ) insert ( 3461 make_timestamp 11 10 12 1 0 0 0 f f f t f i s 6 0 1114 '23 23 23 23 23 701' _null_ _null_ '{year,month,mday,hour,min,sec}' _null_ _null_ make_timestamp _null_ _null_ _null_ _null_ ) insert ( 3462 make_timestamptz 11 10 12 1 0 0 0 f f f t f s s 6 0 1184 '23 23 23 23 23 701' _null_ _null_ '{year,month,mday,hour,min,sec}' _null_ _null_ make_timestamptz _null_ _null_ _null_ _null_ ) insert ( 3463 make_timestamptz 11 10 12 1 0 0 0 f f f t f s s 7 0 1184 '23 23 23 23 23 701 25' _null_ _null_ '{year,month,mday,hour,min,sec,timezone}' _null_ _null_ make_timestamptz_at_timezone _null_ _null_ _null_ _null_ ) insert ( 3464 make_interval 11 10 12 1 0 0 0 f f f t f i s 7 0 1186 '23 23 23 23 23 23 701' _null_ _null_ '{years,months,weeks,days,hours,mins,secs}' _null_ _null_ make_interval _null_ _null_ _null_ _null_ ) insert ( 4018 spg_quad_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_quad_config _null_ _null_ _null_ _null_ ) insert ( 4019 spg_quad_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_quad_choose _null_ _null_ _null_ _null_ ) insert ( 4020 spg_quad_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_quad_picksplit _null_ _null_ _null_ _null_ ) insert ( 4021 spg_quad_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_quad_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 4022 spg_quad_leaf_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_quad_leaf_consistent _null_ _null_ _null_ _null_ ) insert ( 4023 spg_kd_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_kd_config _null_ _null_ _null_ _null_ ) insert ( 4024 spg_kd_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_kd_choose _null_ _null_ _null_ _null_ ) insert ( 4025 spg_kd_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_kd_picksplit _null_ _null_ _null_ _null_ ) insert ( 4026 spg_kd_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_kd_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 4027 spg_text_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_text_config _null_ _null_ _null_ _null_ ) insert ( 4028 spg_text_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_text_choose _null_ _null_ _null_ _null_ ) insert ( 4029 spg_text_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_text_picksplit _null_ _null_ _null_ _null_ ) insert ( 4030 spg_text_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_text_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 4031 spg_text_leaf_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_text_leaf_consistent _null_ _null_ _null_ _null_ ) insert ( 3469 spg_range_quad_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_range_quad_config _null_ _null_ _null_ _null_ ) insert ( 3470 spg_range_quad_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_range_quad_choose _null_ _null_ _null_ _null_ ) insert ( 3471 spg_range_quad_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_range_quad_picksplit _null_ _null_ _null_ _null_ ) insert ( 3472 spg_range_quad_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_range_quad_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 3473 spg_range_quad_leaf_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_range_quad_leaf_consistent _null_ _null_ _null_ _null_ ) insert ( 5012 spg_box_quad_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_box_quad_config _null_ _null_ _null_ _null_ ) insert ( 5013 spg_box_quad_choose 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_box_quad_choose _null_ _null_ _null_ _null_ ) insert ( 5014 spg_box_quad_picksplit 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_box_quad_picksplit _null_ _null_ _null_ _null_ ) insert ( 5015 spg_box_quad_inner_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_box_quad_inner_consistent _null_ _null_ _null_ _null_ ) insert ( 5016 spg_box_quad_leaf_consistent 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_box_quad_leaf_consistent _null_ _null_ _null_ _null_ ) insert ( 5010 spg_bbox_quad_config 11 10 12 1 0 0 0 f f f t f i s 2 0 2278 '2281 2281' _null_ _null_ _null_ _null_ _null_ spg_bbox_quad_config _null_ _null_ _null_ _null_ ) insert ( 5011 spg_poly_quad_compress 11 10 12 1 0 0 0 f f f t f i s 1 0 603 604 _null_ _null_ _null_ _null_ _null_ spg_poly_quad_compress _null_ _null_ _null_ _null_ ) insert ( 3779 pg_create_physical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 3 0 2249 '19 16 16' '{19,16,16,19,3220}' '{i,i,i,o,o}' '{slot_name,immediately_reserve,temporary,slot_name,lsn}' _null_ _null_ pg_create_physical_replication_slot _null_ _null_ _null_ _null_ ) insert ( 4220 pg_copy_physical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 3 0 2249 '19 19 16' '{19,19,16,19,3220}' '{i,i,i,o,o}' '{src_slot_name,dst_slot_name,temporary,slot_name,lsn}' _null_ _null_ pg_copy_physical_replication_slot_a _null_ _null_ _null_ _null_ ) insert ( 4221 pg_copy_physical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 2 0 2249 '19 19' '{19,19,19,3220}' '{i,i,o,o}' '{src_slot_name,dst_slot_name,slot_name,lsn}' _null_ _null_ pg_copy_physical_replication_slot_b _null_ _null_ _null_ _null_ ) insert ( 3780 pg_drop_replication_slot 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 19 _null_ _null_ _null_ _null_ _null_ pg_drop_replication_slot _null_ _null_ _null_ _null_ ) insert ( 3781 pg_get_replication_slots 11 10 12 1 10 0 0 f f f f t s s 0 0 2249 '' '{19,19,25,26,16,16,23,28,28,3220,3220,25,20,16,1184,16,25,16,16}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{slot_name,plugin,slot_type,datoid,temporary,active,active_pid,xmin,catalog_xmin,restart_lsn,confirmed_flush_lsn,wal_status,safe_wal_size,two_phase,inactive_since,conflicting,invalidation_reason,failover,synced}' _null_ _null_ pg_get_replication_slots _null_ _null_ _null_ _null_ ) insert ( 3786 pg_create_logical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 5 0 2249 '19 19 16 16 16' '{19,19,16,16,16,19,3220}' '{i,i,i,i,i,o,o}' '{slot_name,plugin,temporary,twophase,failover,slot_name,lsn}' _null_ _null_ pg_create_logical_replication_slot _null_ _null_ _null_ _null_ ) insert ( 4222 pg_copy_logical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 4 0 2249 '19 19 16 19' '{19,19,16,19,19,3220}' '{i,i,i,i,o,o}' '{src_slot_name,dst_slot_name,temporary,plugin,slot_name,lsn}' _null_ _null_ pg_copy_logical_replication_slot_a _null_ _null_ _null_ _null_ ) insert ( 4223 pg_copy_logical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 3 0 2249 '19 19 16' '{19,19,16,19,3220}' '{i,i,i,o,o}' '{src_slot_name,dst_slot_name,temporary,slot_name,lsn}' _null_ _null_ pg_copy_logical_replication_slot_b _null_ _null_ _null_ _null_ ) insert ( 4224 pg_copy_logical_replication_slot 11 10 12 1 0 0 0 f f f t f v u 2 0 2249 '19 19' '{19,19,19,3220}' '{i,i,o,o}' '{src_slot_name,dst_slot_name,slot_name,lsn}' _null_ _null_ pg_copy_logical_replication_slot_c _null_ _null_ _null_ _null_ ) insert ( 3782 pg_logical_slot_get_changes 11 10 12 1000 1000 25 0 f f f f t v u 4 0 2249 '19 3220 23 1009' '{19,3220,23,1009,3220,28,25}' '{i,i,i,v,o,o,o}' '{slot_name,upto_lsn,upto_nchanges,options,lsn,xid,data}' _null_ _null_ pg_logical_slot_get_changes _null_ _null_ _null_ _null_ ) insert ( 3783 pg_logical_slot_get_binary_changes 11 10 12 1000 1000 25 0 f f f f t v u 4 0 2249 '19 3220 23 1009' '{19,3220,23,1009,3220,28,17}' '{i,i,i,v,o,o,o}' '{slot_name,upto_lsn,upto_nchanges,options,lsn,xid,data}' _null_ _null_ pg_logical_slot_get_binary_changes _null_ _null_ _null_ _null_ ) insert ( 3784 pg_logical_slot_peek_changes 11 10 12 1000 1000 25 0 f f f f t v u 4 0 2249 '19 3220 23 1009' '{19,3220,23,1009,3220,28,25}' '{i,i,i,v,o,o,o}' '{slot_name,upto_lsn,upto_nchanges,options,lsn,xid,data}' _null_ _null_ pg_logical_slot_peek_changes _null_ _null_ _null_ _null_ ) insert ( 3785 pg_logical_slot_peek_binary_changes 11 10 12 1000 1000 25 0 f f f f t v u 4 0 2249 '19 3220 23 1009' '{19,3220,23,1009,3220,28,17}' '{i,i,i,v,o,o,o}' '{slot_name,upto_lsn,upto_nchanges,options,lsn,xid,data}' _null_ _null_ pg_logical_slot_peek_binary_changes _null_ _null_ _null_ _null_ ) insert ( 3878 pg_replication_slot_advance 11 10 12 1 0 0 0 f f f t f v u 2 0 2249 '19 3220' '{19,3220,19,3220}' '{i,i,o,o}' '{slot_name,upto_lsn,slot_name,end_lsn}' _null_ _null_ pg_replication_slot_advance _null_ _null_ _null_ _null_ ) insert ( 3577 pg_logical_emit_message 11 10 12 1 0 0 0 f f f t f v u 4 0 3220 '16 25 25 16' _null_ _null_ _null_ _null_ _null_ pg_logical_emit_message_text _null_ _null_ _null_ _null_ ) insert ( 3578 pg_logical_emit_message 11 10 12 1 0 0 0 f f f t f v u 4 0 3220 '16 25 17 16' _null_ _null_ _null_ _null_ _null_ pg_logical_emit_message_bytea _null_ _null_ _null_ _null_ ) insert ( 6344 pg_sync_replication_slots 11 10 12 1 0 0 0 f f f t f v u 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_sync_replication_slots _null_ _null_ _null_ _null_ ) insert ( 3566 pg_event_trigger_dropped_objects 11 10 12 10 100 0 0 f f f t t s r 0 0 2249 '' '{26,26,23,16,16,16,25,25,25,25,1009,1009}' '{o,o,o,o,o,o,o,o,o,o,o,o}' '{classid, objid, objsubid, original, normal, is_temporary, object_type, schema_name, object_name, object_identity, address_names, address_args}' _null_ _null_ pg_event_trigger_dropped_objects _null_ _null_ _null_ _null_ ) insert ( 4566 pg_event_trigger_table_rewrite_oid 11 10 12 1 0 0 0 f f f t f s r 0 0 26 '' '{26}' '{o}' '{oid}' _null_ _null_ pg_event_trigger_table_rewrite_oid _null_ _null_ _null_ _null_ ) insert ( 4567 pg_event_trigger_table_rewrite_reason 11 10 12 1 0 0 0 f f f t f s r 0 0 23 '' _null_ _null_ _null_ _null_ _null_ pg_event_trigger_table_rewrite_reason _null_ _null_ _null_ _null_ ) insert ( 4568 pg_event_trigger_ddl_commands 11 10 12 10 100 0 0 f f f t t s r 0 0 2249 '' '{26,26,23,25,25,25,25,16,32}' '{o,o,o,o,o,o,o,o,o}' '{classid, objid, objsubid, command_tag, object_type, schema_name, object_identity, in_extension, command}' _null_ _null_ pg_event_trigger_ddl_commands _null_ _null_ _null_ _null_ ) insert ( 3970 ordered_set_transition 11 10 12 1 0 0 0 f f f f f i s 2 0 2281 '2281 2276' _null_ _null_ _null_ _null_ _null_ ordered_set_transition _null_ _null_ _null_ _null_ ) insert ( 3971 ordered_set_transition_multi 11 10 12 1 0 2276 0 f f f f f i s 2 0 2281 '2281 2276' '{2281,2276}' '{i,v}' _null_ _null_ _null_ ordered_set_transition_multi _null_ _null_ _null_ _null_ ) insert ( 3972 percentile_disc 11 10 12 1 0 0 0 a f f f f i s 2 0 2283 '701 2283' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3973 percentile_disc_final 11 10 12 1 0 0 0 f f f f f i s 3 0 2283 '2281 701 2283' _null_ _null_ _null_ _null_ _null_ percentile_disc_final _null_ _null_ _null_ _null_ ) insert ( 3974 percentile_cont 11 10 12 1 0 0 0 a f f f f i s 2 0 701 '701 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3975 percentile_cont_float8_final 11 10 12 1 0 0 0 f f f f f i s 2 0 701 '2281 701' _null_ _null_ _null_ _null_ _null_ percentile_cont_float8_final _null_ _null_ _null_ _null_ ) insert ( 3976 percentile_cont 11 10 12 1 0 0 0 a f f f f i s 2 0 1186 '701 1186' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3977 percentile_cont_interval_final 11 10 12 1 0 0 0 f f f f f i s 2 0 1186 '2281 701' _null_ _null_ _null_ _null_ _null_ percentile_cont_interval_final _null_ _null_ _null_ _null_ ) insert ( 3978 percentile_disc 11 10 12 1 0 0 0 a f f f f i s 2 0 2277 '1022 2283' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3979 percentile_disc_multi_final 11 10 12 1 0 0 0 f f f f f i s 3 0 2277 '2281 1022 2283' _null_ _null_ _null_ _null_ _null_ percentile_disc_multi_final _null_ _null_ _null_ _null_ ) insert ( 3980 percentile_cont 11 10 12 1 0 0 0 a f f f f i s 2 0 1022 '1022 701' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3981 percentile_cont_float8_multi_final 11 10 12 1 0 0 0 f f f f f i s 2 0 1022 '2281 1022' _null_ _null_ _null_ _null_ _null_ percentile_cont_float8_multi_final _null_ _null_ _null_ _null_ ) insert ( 3982 percentile_cont 11 10 12 1 0 0 0 a f f f f i s 2 0 1187 '1022 1186' _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3983 percentile_cont_interval_multi_final 11 10 12 1 0 0 0 f f f f f i s 2 0 1187 '2281 1022' _null_ _null_ _null_ _null_ _null_ percentile_cont_interval_multi_final _null_ _null_ _null_ _null_ ) insert ( 3984 mode 11 10 12 1 0 0 0 a f f f f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3985 mode_final 11 10 12 1 0 0 0 f f f f f i s 2 0 2283 '2281 2283' _null_ _null_ _null_ _null_ _null_ mode_final _null_ _null_ _null_ _null_ ) insert ( 3986 rank 11 10 12 1 0 2276 0 a f f f f i s 1 0 20 2276 '{2276}' '{v}' _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3987 rank_final 11 10 12 1 0 2276 0 f f f f f i s 2 0 20 '2281 2276' '{2281,2276}' '{i,v}' _null_ _null_ _null_ hypothetical_rank_final _null_ _null_ _null_ _null_ ) insert ( 3988 percent_rank 11 10 12 1 0 2276 0 a f f f f i s 1 0 701 2276 '{2276}' '{v}' _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3989 percent_rank_final 11 10 12 1 0 2276 0 f f f f f i s 2 0 701 '2281 2276' '{2281,2276}' '{i,v}' _null_ _null_ _null_ hypothetical_percent_rank_final _null_ _null_ _null_ _null_ ) insert ( 3990 cume_dist 11 10 12 1 0 2276 0 a f f f f i s 1 0 701 2276 '{2276}' '{v}' _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3991 cume_dist_final 11 10 12 1 0 2276 0 f f f f f i s 2 0 701 '2281 2276' '{2281,2276}' '{i,v}' _null_ _null_ _null_ hypothetical_cume_dist_final _null_ _null_ _null_ _null_ ) insert ( 3992 dense_rank 11 10 12 1 0 2276 0 a f f f f i s 1 0 20 2276 '{2276}' '{v}' _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 3993 dense_rank_final 11 10 12 1 0 2276 0 f f f f f i s 2 0 20 '2281 2276' '{2281,2276}' '{i,v}' _null_ _null_ _null_ hypothetical_dense_rank_final _null_ _null_ _null_ _null_ ) insert ( 3582 binary_upgrade_set_next_pg_type_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_pg_type_oid _null_ _null_ _null_ _null_ ) insert ( 3584 binary_upgrade_set_next_array_pg_type_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_array_pg_type_oid _null_ _null_ _null_ _null_ ) insert ( 4390 binary_upgrade_set_next_multirange_pg_type_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_multirange_pg_type_oid _null_ _null_ _null_ _null_ ) insert ( 4391 binary_upgrade_set_next_multirange_array_pg_type_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_multirange_array_pg_type_oid _null_ _null_ _null_ _null_ ) insert ( 3586 binary_upgrade_set_next_heap_pg_class_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_heap_pg_class_oid _null_ _null_ _null_ _null_ ) insert ( 3587 binary_upgrade_set_next_index_pg_class_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_index_pg_class_oid _null_ _null_ _null_ _null_ ) insert ( 3588 binary_upgrade_set_next_toast_pg_class_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_toast_pg_class_oid _null_ _null_ _null_ _null_ ) insert ( 3589 binary_upgrade_set_next_pg_enum_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_pg_enum_oid _null_ _null_ _null_ _null_ ) insert ( 3590 binary_upgrade_set_next_pg_authid_oid 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_pg_authid_oid _null_ _null_ _null_ _null_ ) insert ( 3591 binary_upgrade_create_empty_extension 11 10 12 1 0 0 0 f f f f f v u 7 0 2278 '25 25 16 25 1028 1009 1009' _null_ _null_ _null_ _null_ _null_ binary_upgrade_create_empty_extension _null_ _null_ _null_ _null_ ) insert ( 4083 binary_upgrade_set_record_init_privs 11 10 12 1 0 0 0 f f f t f v r 1 0 2278 16 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_record_init_privs _null_ _null_ _null_ _null_ ) insert ( 4101 binary_upgrade_set_missing_value 11 10 12 1 0 0 0 f f f t f v u 3 0 2278 '26 25 25' _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_missing_value _null_ _null_ _null_ _null_ ) insert ( 4545 binary_upgrade_set_next_heap_relfilenode 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_heap_relfilenode _null_ _null_ _null_ _null_ ) insert ( 4546 binary_upgrade_set_next_index_relfilenode 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_index_relfilenode _null_ _null_ _null_ _null_ ) insert ( 4547 binary_upgrade_set_next_toast_relfilenode 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_toast_relfilenode _null_ _null_ _null_ _null_ ) insert ( 4548 binary_upgrade_set_next_pg_tablespace_oid 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 26 _null_ _null_ _null_ _null_ _null_ binary_upgrade_set_next_pg_tablespace_oid _null_ _null_ _null_ _null_ ) insert ( 6312 binary_upgrade_logical_slot_has_caught_up 11 10 12 1 0 0 0 f f f t f v u 1 0 16 19 _null_ _null_ _null_ _null_ _null_ binary_upgrade_logical_slot_has_caught_up _null_ _null_ _null_ _null_ ) insert ( 6319 binary_upgrade_add_sub_rel_state 11 10 12 1 0 0 0 f f f f f v u 4 0 2278 '25 26 18 3220' _null_ _null_ _null_ _null_ _null_ binary_upgrade_add_sub_rel_state _null_ _null_ _null_ _null_ ) insert ( 6320 binary_upgrade_replorigin_advance 11 10 12 1 0 0 0 f f f f f v u 2 0 2278 '25 3220' _null_ _null_ _null_ _null_ _null_ binary_upgrade_replorigin_advance _null_ _null_ _null_ _null_ ) insert ( 4302 koi8r_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8r_to_mic '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4303 mic_to_koi8r 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_koi8r '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4304 iso_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso_to_mic '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4305 mic_to_iso 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_iso '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4306 win1251_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1251_to_mic '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4307 mic_to_win1251 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_win1251 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4308 win866_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win866_to_mic '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4309 mic_to_win866 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_win866 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4310 koi8r_to_win1251 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8r_to_win1251 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4311 win1251_to_koi8r 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1251_to_koi8r '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4312 koi8r_to_win866 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8r_to_win866 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4313 win866_to_koi8r 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win866_to_koi8r '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4314 win866_to_win1251 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win866_to_win1251 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4315 win1251_to_win866 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1251_to_win866 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4316 iso_to_koi8r 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso_to_koi8r '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4317 koi8r_to_iso 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8r_to_iso '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4318 iso_to_win1251 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso_to_win1251 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4319 win1251_to_iso 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1251_to_iso '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4320 iso_to_win866 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso_to_win866 '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4321 win866_to_iso 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win866_to_iso '$libdir/cyrillic_and_mic' _null_ _null_ _null_ ) insert ( 4322 euc_cn_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_cn_to_mic '$libdir/euc_cn_and_mic' _null_ _null_ _null_ ) insert ( 4323 mic_to_euc_cn 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_euc_cn '$libdir/euc_cn_and_mic' _null_ _null_ _null_ ) insert ( 4324 euc_jp_to_sjis 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_jp_to_sjis '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4325 sjis_to_euc_jp 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ sjis_to_euc_jp '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4326 euc_jp_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_jp_to_mic '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4327 sjis_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ sjis_to_mic '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4328 mic_to_euc_jp 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_euc_jp '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4329 mic_to_sjis 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_sjis '$libdir/euc_jp_and_sjis' _null_ _null_ _null_ ) insert ( 4330 euc_kr_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_kr_to_mic '$libdir/euc_kr_and_mic' _null_ _null_ _null_ ) insert ( 4331 mic_to_euc_kr 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_euc_kr '$libdir/euc_kr_and_mic' _null_ _null_ _null_ ) insert ( 4332 euc_tw_to_big5 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_tw_to_big5 '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4333 big5_to_euc_tw 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ big5_to_euc_tw '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4334 euc_tw_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_tw_to_mic '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4335 big5_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ big5_to_mic '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4336 mic_to_euc_tw 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_euc_tw '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4337 mic_to_big5 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_big5 '$libdir/euc_tw_and_big5' _null_ _null_ _null_ ) insert ( 4338 latin2_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ latin2_to_mic '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4339 mic_to_latin2 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_latin2 '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4340 win1250_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1250_to_mic '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4341 mic_to_win1250 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_win1250 '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4342 latin2_to_win1250 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ latin2_to_win1250 '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4343 win1250_to_latin2 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win1250_to_latin2 '$libdir/latin2_and_win1250' _null_ _null_ _null_ ) insert ( 4344 latin1_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ latin1_to_mic '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4345 mic_to_latin1 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_latin1 '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4346 latin3_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ latin3_to_mic '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4347 mic_to_latin3 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_latin3 '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4348 latin4_to_mic 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ latin4_to_mic '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4349 mic_to_latin4 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ mic_to_latin4 '$libdir/latin_and_mic' _null_ _null_ _null_ ) insert ( 4352 big5_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ big5_to_utf8 '$libdir/utf8_and_big5' _null_ _null_ _null_ ) insert ( 4353 utf8_to_big5 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_big5 '$libdir/utf8_and_big5' _null_ _null_ _null_ ) insert ( 4354 utf8_to_koi8r 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_koi8r '$libdir/utf8_and_cyrillic' _null_ _null_ _null_ ) insert ( 4355 koi8r_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8r_to_utf8 '$libdir/utf8_and_cyrillic' _null_ _null_ _null_ ) insert ( 4356 utf8_to_koi8u 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_koi8u '$libdir/utf8_and_cyrillic' _null_ _null_ _null_ ) insert ( 4357 koi8u_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ koi8u_to_utf8 '$libdir/utf8_and_cyrillic' _null_ _null_ _null_ ) insert ( 4358 utf8_to_win 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_win '$libdir/utf8_and_win' _null_ _null_ _null_ ) insert ( 4359 win_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ win_to_utf8 '$libdir/utf8_and_win' _null_ _null_ _null_ ) insert ( 4360 euc_cn_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_cn_to_utf8 '$libdir/utf8_and_euc_cn' _null_ _null_ _null_ ) insert ( 4361 utf8_to_euc_cn 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_euc_cn '$libdir/utf8_and_euc_cn' _null_ _null_ _null_ ) insert ( 4362 euc_jp_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_jp_to_utf8 '$libdir/utf8_and_euc_jp' _null_ _null_ _null_ ) insert ( 4363 utf8_to_euc_jp 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_euc_jp '$libdir/utf8_and_euc_jp' _null_ _null_ _null_ ) insert ( 4364 euc_kr_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_kr_to_utf8 '$libdir/utf8_and_euc_kr' _null_ _null_ _null_ ) insert ( 4365 utf8_to_euc_kr 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_euc_kr '$libdir/utf8_and_euc_kr' _null_ _null_ _null_ ) insert ( 4366 euc_tw_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_tw_to_utf8 '$libdir/utf8_and_euc_tw' _null_ _null_ _null_ ) insert ( 4367 utf8_to_euc_tw 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_euc_tw '$libdir/utf8_and_euc_tw' _null_ _null_ _null_ ) insert ( 4368 gb18030_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ gb18030_to_utf8 '$libdir/utf8_and_gb18030' _null_ _null_ _null_ ) insert ( 4369 utf8_to_gb18030 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_gb18030 '$libdir/utf8_and_gb18030' _null_ _null_ _null_ ) insert ( 4370 gbk_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ gbk_to_utf8 '$libdir/utf8_and_gbk' _null_ _null_ _null_ ) insert ( 4371 utf8_to_gbk 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_gbk '$libdir/utf8_and_gbk' _null_ _null_ _null_ ) insert ( 4372 utf8_to_iso8859 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_iso8859 '$libdir/utf8_and_iso8859' _null_ _null_ _null_ ) insert ( 4373 iso8859_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso8859_to_utf8 '$libdir/utf8_and_iso8859' _null_ _null_ _null_ ) insert ( 4374 iso8859_1_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ iso8859_1_to_utf8 '$libdir/utf8_and_iso8859_1' _null_ _null_ _null_ ) insert ( 4375 utf8_to_iso8859_1 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_iso8859_1 '$libdir/utf8_and_iso8859_1' _null_ _null_ _null_ ) insert ( 4376 johab_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ johab_to_utf8 '$libdir/utf8_and_johab' _null_ _null_ _null_ ) insert ( 4377 utf8_to_johab 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_johab '$libdir/utf8_and_johab' _null_ _null_ _null_ ) insert ( 4378 sjis_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ sjis_to_utf8 '$libdir/utf8_and_sjis' _null_ _null_ _null_ ) insert ( 4379 utf8_to_sjis 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_sjis '$libdir/utf8_and_sjis' _null_ _null_ _null_ ) insert ( 4380 uhc_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ uhc_to_utf8 '$libdir/utf8_and_uhc' _null_ _null_ _null_ ) insert ( 4381 utf8_to_uhc 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_uhc '$libdir/utf8_and_uhc' _null_ _null_ _null_ ) insert ( 4382 euc_jis_2004_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_jis_2004_to_utf8 '$libdir/utf8_and_euc2004' _null_ _null_ _null_ ) insert ( 4383 utf8_to_euc_jis_2004 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_euc_jis_2004 '$libdir/utf8_and_euc2004' _null_ _null_ _null_ ) insert ( 4384 shift_jis_2004_to_utf8 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ shift_jis_2004_to_utf8 '$libdir/utf8_and_sjis2004' _null_ _null_ _null_ ) insert ( 4385 utf8_to_shift_jis_2004 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ utf8_to_shift_jis_2004 '$libdir/utf8_and_sjis2004' _null_ _null_ _null_ ) insert ( 4386 euc_jis_2004_to_shift_jis_2004 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ euc_jis_2004_to_shift_jis_2004 '$libdir/euc2004_sjis2004' _null_ _null_ _null_ ) insert ( 4387 shift_jis_2004_to_euc_jis_2004 11 10 13 1 0 0 0 f f f t f i s 6 0 23 '23 23 2275 2281 23 16' _null_ _null_ _null_ _null_ _null_ shift_jis_2004_to_euc_jis_2004 '$libdir/euc2004_sjis2004' _null_ _null_ _null_ ) insert ( 5040 matchingsel 11 10 12 1 0 0 0 f f f t f s s 4 0 701 '2281 26 2281 23' _null_ _null_ _null_ _null_ _null_ matchingsel _null_ _null_ _null_ _null_ ) insert ( 5041 matchingjoinsel 11 10 12 1 0 0 0 f f f t f s s 5 0 701 '2281 26 2281 21 2281' _null_ _null_ _null_ _null_ _null_ matchingjoinsel _null_ _null_ _null_ _null_ ) insert ( 6003 pg_replication_origin_create 11 10 12 1 0 0 0 f f f t f v u 1 0 26 25 _null_ _null_ _null_ _null_ _null_ pg_replication_origin_create _null_ _null_ _null_ _null_ ) insert ( 6004 pg_replication_origin_drop 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 25 _null_ _null_ _null_ _null_ _null_ pg_replication_origin_drop _null_ _null_ _null_ _null_ ) insert ( 6005 pg_replication_origin_oid 11 10 12 1 0 0 0 f f f t f s s 1 0 26 25 _null_ _null_ _null_ _null_ _null_ pg_replication_origin_oid _null_ _null_ _null_ _null_ ) insert ( 6006 pg_replication_origin_session_setup 11 10 12 1 0 0 0 f f f t f v u 1 0 2278 25 _null_ _null_ _null_ _null_ _null_ pg_replication_origin_session_setup _null_ _null_ _null_ _null_ ) insert ( 6007 pg_replication_origin_session_reset 11 10 12 1 0 0 0 f f f t f v u 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_session_reset _null_ _null_ _null_ _null_ ) insert ( 6008 pg_replication_origin_session_is_setup 11 10 12 1 0 0 0 f f f t f v r 0 0 16 '' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_session_is_setup _null_ _null_ _null_ _null_ ) insert ( 6009 pg_replication_origin_session_progress 11 10 12 1 0 0 0 f f f t f v u 1 0 3220 16 _null_ _null_ _null_ _null_ _null_ pg_replication_origin_session_progress _null_ _null_ _null_ _null_ ) insert ( 6010 pg_replication_origin_xact_setup 11 10 12 1 0 0 0 f f f t f v r 2 0 2278 '3220 1184' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_xact_setup _null_ _null_ _null_ _null_ ) insert ( 6011 pg_replication_origin_xact_reset 11 10 12 1 0 0 0 f f f t f v r 0 0 2278 '' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_xact_reset _null_ _null_ _null_ _null_ ) insert ( 6012 pg_replication_origin_advance 11 10 12 1 0 0 0 f f f t f v u 2 0 2278 '25 3220' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_advance _null_ _null_ _null_ _null_ ) insert ( 6013 pg_replication_origin_progress 11 10 12 1 0 0 0 f f f t f v u 2 0 3220 '25 16' _null_ _null_ _null_ _null_ _null_ pg_replication_origin_progress _null_ _null_ _null_ _null_ ) insert ( 6014 pg_show_replication_origin_status 11 10 12 1 100 0 0 f f f f t v r 0 0 2249 '' '{26,25,3220,3220}' '{o,o,o,o}' '{local_id, external_id, remote_lsn, local_lsn}' _null_ _null_ pg_show_replication_origin_status _null_ _null_ _null_ _null_ ) insert ( 6119 pg_get_publication_tables 11 10 12 1 1000 25 0 f f f t t s s 1 0 2249 1009 '{1009,26,26,22,194}' '{v,o,o,o,o}' '{pubname,pubid,relid,attrs,qual}' _null_ _null_ pg_get_publication_tables _null_ _null_ _null_ _null_ ) insert ( 6121 pg_relation_is_publishable 11 10 12 1 0 0 0 f f f t f s s 1 0 16 2205 _null_ _null_ _null_ _null_ _null_ pg_relation_is_publishable _null_ _null_ _null_ _null_ ) insert ( 3298 row_security_active 11 10 12 1 0 0 0 f f f t f s s 1 0 16 26 _null_ _null_ _null_ _null_ _null_ row_security_active _null_ _null_ _null_ _null_ ) insert ( 3299 row_security_active 11 10 12 1 0 0 0 f f f t f s s 1 0 16 25 _null_ _null_ _null_ _null_ _null_ row_security_active_name _null_ _null_ _null_ _null_ ) insert ( 3400 pg_config 11 10 12 1 23 0 0 f f f t t s r 0 0 2249 '' '{25,25}' '{o,o}' '{name,setting}' _null_ _null_ pg_config _null_ _null_ _null_ _null_ ) insert ( 3441 pg_control_system 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{23,23,20,1184}' '{o,o,o,o}' '{pg_control_version,catalog_version_no,system_identifier,pg_control_last_modified}' _null_ _null_ pg_control_system _null_ _null_ _null_ _null_ ) insert ( 3442 pg_control_checkpoint 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{3220,3220,25,23,23,16,25,26,28,28,28,26,28,28,26,28,28,1184}' '{o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o,o}' '{checkpoint_lsn,redo_lsn,redo_wal_file,timeline_id,prev_timeline_id,full_page_writes,next_xid,next_oid,next_multixact_id,next_multi_offset,oldest_xid,oldest_xid_dbid,oldest_active_xid,oldest_multi_xid,oldest_multi_dbid,oldest_commit_ts_xid,newest_commit_ts_xid,checkpoint_time}' _null_ _null_ pg_control_checkpoint _null_ _null_ _null_ _null_ ) insert ( 3443 pg_control_recovery 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{3220,23,3220,3220,16}' '{o,o,o,o,o}' '{min_recovery_end_lsn,min_recovery_end_timeline,backup_start_lsn,backup_end_lsn,end_of_backup_record_required}' _null_ _null_ pg_control_recovery _null_ _null_ _null_ _null_ ) insert ( 3444 pg_control_init 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{23,23,23,23,23,23,23,23,23,16,23}' '{o,o,o,o,o,o,o,o,o,o,o}' '{max_data_alignment,database_block_size,blocks_per_segment,wal_block_size,bytes_per_wal_segment,max_identifier_length,max_index_columns,max_toast_chunk_size,large_object_chunk_size,float8_pass_by_value,data_page_checksum_version}' _null_ _null_ pg_control_init _null_ _null_ _null_ _null_ ) insert ( 6179 array_subscript_handler 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ array_subscript_handler _null_ _null_ _null_ _null_ ) insert ( 6180 raw_array_subscript_handler 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ raw_array_subscript_handler _null_ _null_ _null_ _null_ ) insert ( 6098 jsonb_subscript_handler 11 10 12 1 0 0 0 f f f t f i s 1 0 2281 2281 _null_ _null_ _null_ _null_ _null_ jsonb_subscript_handler _null_ _null_ _null_ _null_ ) insert ( 3445 pg_import_system_collations 11 10 12 100 0 0 0 f f f t f v u 1 0 23 4089 _null_ _null_ _null_ _null_ _null_ pg_import_system_collations _null_ _null_ _null_ _null_ ) insert ( 3448 pg_collation_actual_version 11 10 12 100 0 0 0 f f f t f v s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_collation_actual_version _null_ _null_ _null_ _null_ ) insert ( 6249 pg_database_collation_actual_version 11 10 12 100 0 0 0 f f f t f v s 1 0 25 26 _null_ _null_ _null_ _null_ _null_ pg_database_collation_actual_version _null_ _null_ _null_ _null_ ) insert ( 3353 pg_ls_logdir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_logdir _null_ _null_ _null_ _null_ ) insert ( 3354 pg_ls_waldir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_waldir _null_ _null_ _null_ _null_ ) insert ( 5031 pg_ls_archive_statusdir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_archive_statusdir _null_ _null_ _null_ _null_ ) insert ( 5029 pg_ls_tmpdir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_tmpdir_noargs _null_ _null_ _null_ _null_ ) insert ( 5030 pg_ls_tmpdir 11 10 12 10 20 0 0 f f f t t v s 1 0 2249 26 '{26,25,20,1184}' '{i,o,o,o}' '{tablespace,name,size,modification}' _null_ _null_ pg_ls_tmpdir_1arg _null_ _null_ _null_ _null_ ) insert ( 6270 pg_ls_logicalsnapdir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_logicalsnapdir _null_ _null_ _null_ _null_ ) insert ( 6271 pg_ls_logicalmapdir 11 10 12 10 20 0 0 f f f t t v s 0 0 2249 '' '{25,20,1184}' '{o,o,o}' '{name,size,modification}' _null_ _null_ pg_ls_logicalmapdir _null_ _null_ _null_ _null_ ) insert ( 6272 pg_ls_replslotdir 11 10 12 10 20 0 0 f f f t t v s 1 0 2249 25 '{25,25,20,1184}' '{i,o,o,o}' '{slot_name,name,size,modification}' _null_ _null_ pg_ls_replslotdir _null_ _null_ _null_ _null_ ) insert ( 5028 satisfies_hash_partition 11 10 12 1 0 2276 0 f f f f f i s 4 0 16 '26 23 23 2276' _null_ '{i,i,i,v}' _null_ _null_ _null_ satisfies_hash_partition _null_ _null_ _null_ _null_ ) insert ( 3423 pg_partition_tree 11 10 12 1 1000 0 0 f f f t t v s 1 0 2249 2205 '{2205,2205,2205,16,23}' '{i,o,o,o,o}' '{rootrelid,relid,parentrelid,isleaf,level}' _null_ _null_ pg_partition_tree _null_ _null_ _null_ _null_ ) insert ( 3425 pg_partition_ancestors 11 10 12 1 10 0 0 f f f t t v s 1 0 2205 2205 '{2205,2205}' '{i,o}' '{partitionid,relid}' _null_ _null_ pg_partition_ancestors _null_ _null_ _null_ _null_ ) insert ( 3424 pg_partition_root 11 10 12 1 0 0 0 f f f t f i s 1 0 2205 2205 _null_ _null_ _null_ _null_ _null_ pg_partition_root _null_ _null_ _null_ _null_ ) insert ( 4549 unicode_version 11 10 12 1 0 0 0 f f f t f i s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ unicode_version _null_ _null_ _null_ _null_ ) insert ( 6099 icu_unicode_version 11 10 12 1 0 0 0 f f f t f i s 0 0 25 '' _null_ _null_ _null_ _null_ _null_ icu_unicode_version _null_ _null_ _null_ _null_ ) insert ( 6105 unicode_assigned 11 10 12 1 0 0 0 f f f t f i s 1 0 16 25 _null_ _null_ _null_ _null_ _null_ unicode_assigned _null_ _null_ _null_ _null_ ) insert ( 4350 normalize 11 10 12 1 0 0 0 f f f t f i s 2 0 25 '25 25' _null_ _null_ _null_ _null_ _null_ unicode_normalize_func _null_ _null_ _null_ _null_ ) insert ( 4351 is_normalized 11 10 12 1 0 0 0 f f f t f i s 2 0 16 '25 25' _null_ _null_ _null_ _null_ _null_ unicode_is_normalized _null_ _null_ _null_ _null_ ) insert ( 6198 unistr 11 10 12 1 0 0 0 f f f t f i s 1 0 25 25 _null_ _null_ _null_ _null_ _null_ unistr _null_ _null_ _null_ _null_ ) insert ( 4596 brin_bloom_summary_in 11 10 12 1 0 0 0 f f f t f i s 1 0 4600 2275 _null_ _null_ _null_ _null_ _null_ brin_bloom_summary_in _null_ _null_ _null_ _null_ ) insert ( 4597 brin_bloom_summary_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 4600 _null_ _null_ _null_ _null_ _null_ brin_bloom_summary_out _null_ _null_ _null_ _null_ ) insert ( 4598 brin_bloom_summary_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 4600 2281 _null_ _null_ _null_ _null_ _null_ brin_bloom_summary_recv _null_ _null_ _null_ _null_ ) insert ( 4599 brin_bloom_summary_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 4600 _null_ _null_ _null_ _null_ _null_ brin_bloom_summary_send _null_ _null_ _null_ _null_ ) insert ( 4638 brin_minmax_multi_summary_in 11 10 12 1 0 0 0 f f f t f i s 1 0 4601 2275 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_summary_in _null_ _null_ _null_ _null_ ) insert ( 4639 brin_minmax_multi_summary_out 11 10 12 1 0 0 0 f f f t f i s 1 0 2275 4601 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_summary_out _null_ _null_ _null_ _null_ ) insert ( 4640 brin_minmax_multi_summary_recv 11 10 12 1 0 0 0 f f f t f s s 1 0 4601 2281 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_summary_recv _null_ _null_ _null_ _null_ ) insert ( 4641 brin_minmax_multi_summary_send 11 10 12 1 0 0 0 f f f t f s s 1 0 17 4601 _null_ _null_ _null_ _null_ _null_ brin_minmax_multi_summary_send _null_ _null_ _null_ _null_ ) insert ( 6291 any_value 11 10 12 1 0 0 0 a f f f f i s 1 0 2283 2283 _null_ _null_ _null_ _null_ _null_ aggregate_dummy _null_ _null_ _null_ _null_ ) insert ( 6292 any_value_transfn 11 10 12 1 0 0 0 f f f t f i s 2 0 2283 '2283 2283' _null_ _null_ _null_ _null_ _null_ any_value_transfn _null_ _null_ _null_ _null_ ) insert ( 6321 pg_available_wal_summaries 11 10 12 1 100 0 0 f f f t t v s 0 0 2249 '' '{20,3220,3220}' '{o,o,o}' '{tli,start_lsn,end_lsn}' _null_ _null_ pg_available_wal_summaries _null_ _null_ _null_ _null_ ) insert ( 6322 pg_wal_summary_contents 11 10 12 1 100 0 0 f f f t t v s 3 0 2249 '20 3220 3220' '{20,3220,3220,26,26,26,21,20,16}' '{i,i,i,o,o,o,o,o,o}' '{tli,start_lsn,end_lsn,relfilenode,reltablespace,reldatabase,relforknumber,relblocknumber,is_limit_block}' _null_ _null_ pg_wal_summary_contents _null_ _null_ _null_ _null_ ) insert ( 6323 pg_get_wal_summarizer_state 11 10 12 1 0 0 0 f f f t f v s 0 0 2249 '' '{20,3220,3220,23}' '{o,o,o,o}' '{summarized_tli,summarized_lsn,pending_lsn,summarizer_pid}' _null_ _null_ pg_get_wal_summarizer_state _null_ _null_ _null_ _null_ ) close pg_proc create pg_type 1247 bootstrap rowtype_oid 71 ( oid = oid , typname = name , typnamespace = oid , typowner = oid , typlen = int2 , typbyval = bool , typtype = char , typcategory = char , typispreferred = bool , typisdefined = bool , typdelim = char , typrelid = oid , typsubscript = regproc , typelem = oid , typarray = oid , typinput = regproc , typoutput = regproc , typreceive = regproc , typsend = regproc , typmodin = regproc , typmodout = regproc , typanalyze = regproc , typalign = char , typstorage = char , typnotnull = bool , typbasetype = oid , typtypmod = int4 , typndims = int4 , typcollation = oid , typdefaultbin = pg_node_tree , typdefault = text , typacl = _aclitem ) insert ( 16 bool 11 10 1 t b B t t ',' 0 - 0 1000 1242 1243 2436 2437 - - - c p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 17 bytea 11 10 -1 f b U f t ',' 0 - 0 1001 1244 31 2412 2413 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 18 char 11 10 1 t b Z f t ',' 0 - 0 1002 1245 33 2434 2435 - - - c p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 19 name 11 10 NAMEDATALEN f b S f t ',' 0 6180 18 1003 34 35 2422 2423 - - - c p f 0 -1 0 950 _null_ _null_ _null_ ) insert ( 20 int8 11 10 8 FLOAT8PASSBYVAL b N f t ',' 0 - 0 1016 460 461 2408 2409 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 21 int2 11 10 2 t b N f t ',' 0 - 0 1005 38 39 2404 2405 - - - s p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 22 int2vector 11 10 -1 f b A f t ',' 0 6179 21 1006 40 41 2410 2411 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 23 int4 11 10 4 t b N f t ',' 0 - 0 1007 42 43 2406 2407 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 24 regproc 11 10 4 t b N f t ',' 0 - 0 1008 44 45 2444 2445 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 25 text 11 10 -1 f b S t t ',' 0 - 0 1009 46 47 2414 2415 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 26 oid 11 10 4 t b N t t ',' 0 - 0 1028 1798 1799 2418 2419 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 27 tid 11 10 6 f b U f t ',' 0 - 0 1010 48 49 2438 2439 - - - s p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 28 xid 11 10 4 t b U f t ',' 0 - 0 1011 50 51 2440 2441 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 29 cid 11 10 4 t b U f t ',' 0 - 0 1012 52 53 2442 2443 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 30 oidvector 11 10 -1 f b A f t ',' 0 6179 26 1013 54 55 2420 2421 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 71 pg_type 11 10 -1 f c C f t ',' 1247 - 0 210 2290 2291 2402 2403 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 75 pg_attribute 11 10 -1 f c C f t ',' 1249 - 0 270 2290 2291 2402 2403 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 81 pg_proc 11 10 -1 f c C f t ',' 1255 - 0 272 2290 2291 2402 2403 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 83 pg_class 11 10 -1 f c C f t ',' 1259 - 0 273 2290 2291 2402 2403 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 114 json 11 10 -1 f b U f t ',' 0 - 0 199 321 322 323 324 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 142 xml 11 10 -1 f b U f t ',' 0 - 0 143 2893 2894 2898 2899 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 194 pg_node_tree 11 10 -1 f b Z f t ',' 0 - 0 0 195 196 197 198 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 3361 pg_ndistinct 11 10 -1 f b Z f t ',' 0 - 0 0 3355 3356 3357 3358 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 3402 pg_dependencies 11 10 -1 f b Z f t ',' 0 - 0 0 3404 3405 3406 3407 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 5017 pg_mcv_list 11 10 -1 f b Z f t ',' 0 - 0 0 5018 5019 5020 5021 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 32 pg_ddl_command 11 10 SIZEOF_POINTER t p P f t ',' 0 - 0 0 86 87 88 90 - - - ALIGNOF_POINTER p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5069 xid8 11 10 8 FLOAT8PASSBYVAL b U f t ',' 0 - 0 271 5070 5081 5082 5083 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 600 point 11 10 16 f b G f t ',' 0 6180 701 1017 117 118 2428 2429 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 601 lseg 11 10 32 f b G f t ',' 0 6180 600 1018 119 120 2480 2481 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 602 path 11 10 -1 f b G f t ',' 0 - 0 1019 121 122 2482 2483 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 603 box 11 10 32 f b G f t ';' 0 6180 600 1020 123 124 2484 2485 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 604 polygon 11 10 -1 f b G f t ',' 0 - 0 1027 347 348 2486 2487 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 628 line 11 10 24 f b G f t ',' 0 6180 701 629 1490 1491 2488 2489 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 700 float4 11 10 4 t b N f t ',' 0 - 0 1021 200 201 2424 2425 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 701 float8 11 10 8 FLOAT8PASSBYVAL b N t t ',' 0 - 0 1022 214 215 2426 2427 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 705 unknown 11 10 -2 f p X f t ',' 0 - 0 0 109 110 2416 2417 - - - c p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 718 circle 11 10 24 f b G f t ',' 0 - 0 719 1450 1451 2490 2491 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 790 money 11 10 8 FLOAT8PASSBYVAL b N f t ',' 0 - 0 791 886 887 2492 2493 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 829 macaddr 11 10 6 f b U f t ',' 0 - 0 1040 436 437 2494 2495 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 869 inet 11 10 -1 f b I t t ',' 0 - 0 1041 910 911 2496 2497 - - - i m f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 650 cidr 11 10 -1 f b I f t ',' 0 - 0 651 1267 1427 2498 2499 - - - i m f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 774 macaddr8 11 10 8 f b U f t ',' 0 - 0 775 4110 4111 3446 3447 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1033 aclitem 11 10 16 f b U f t ',' 0 - 0 1034 1031 1032 - - - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1042 bpchar 11 10 -1 f b S f t ',' 0 - 0 1014 1044 1045 2430 2431 2913 2914 - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1043 varchar 11 10 -1 f b S f t ',' 0 - 0 1015 1046 1047 2432 2433 2915 2916 - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1082 date 11 10 4 t b D f t ',' 0 - 0 1182 1084 1085 2468 2469 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1083 time 11 10 8 FLOAT8PASSBYVAL b D f t ',' 0 - 0 1183 1143 1144 2470 2471 2909 2910 - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1114 timestamp 11 10 8 FLOAT8PASSBYVAL b D f t ',' 0 - 0 1115 1312 1313 2474 2475 2905 2906 - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1184 timestamptz 11 10 8 FLOAT8PASSBYVAL b D t t ',' 0 - 0 1185 1150 1151 2476 2477 2907 2908 - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1186 interval 11 10 16 f b T t t ',' 0 - 0 1187 1160 1161 2478 2479 2903 2904 - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1266 timetz 11 10 12 f b D f t ',' 0 - 0 1270 1350 1351 2472 2473 2911 2912 - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1560 bit 11 10 -1 f b V f t ',' 0 - 0 1561 1564 1565 2456 2457 2919 2920 - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1562 varbit 11 10 -1 f b V t t ',' 0 - 0 1563 1579 1580 2458 2459 2902 2921 - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1700 numeric 11 10 -1 f b N f t ',' 0 - 0 1231 1701 1702 2460 2461 2917 2918 - i m f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1790 refcursor 11 10 -1 f b U f t ',' 0 - 0 2201 46 47 2414 2415 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2202 regprocedure 11 10 4 t b N f t ',' 0 - 0 2207 2212 2213 2446 2447 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2203 regoper 11 10 4 t b N f t ',' 0 - 0 2208 2214 2215 2448 2449 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2204 regoperator 11 10 4 t b N f t ',' 0 - 0 2209 2216 2217 2450 2451 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2205 regclass 11 10 4 t b N f t ',' 0 - 0 2210 2218 2219 2452 2453 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4191 regcollation 11 10 4 t b N f t ',' 0 - 0 4192 4193 4194 4196 4197 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2206 regtype 11 10 4 t b N f t ',' 0 - 0 2211 2220 2221 2454 2455 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4096 regrole 11 10 4 t b N f t ',' 0 - 0 4097 4098 4092 4094 4095 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4089 regnamespace 11 10 4 t b N f t ',' 0 - 0 4090 4084 4085 4087 4088 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2950 uuid 11 10 16 f b U f t ',' 0 - 0 2951 2952 2953 2961 2962 - - - c p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3220 pg_lsn 11 10 8 FLOAT8PASSBYVAL b U f t ',' 0 - 0 3221 3229 3230 3238 3239 - - - d p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3614 tsvector 11 10 -1 f b U f t ',' 0 - 0 3643 3610 3611 3639 3638 - - 3688 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3642 gtsvector 11 10 -1 f b U f t ',' 0 - 0 3644 3646 3647 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3615 tsquery 11 10 -1 f b U f t ',' 0 - 0 3645 3612 3613 3641 3640 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3734 regconfig 11 10 4 t b N f t ',' 0 - 0 3735 3736 3737 3738 3739 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3769 regdictionary 11 10 4 t b N f t ',' 0 - 0 3770 3771 3772 3773 3774 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3802 jsonb 11 10 -1 f b U f t ',' 0 6098 0 3807 3806 3804 3805 3803 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4072 jsonpath 11 10 -1 f b U f t ',' 0 - 0 4073 4001 4003 4002 4004 - - - i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2970 txid_snapshot 11 10 -1 f b U f t ',' 0 - 0 2949 2939 2940 2941 2942 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5038 pg_snapshot 11 10 -1 f b U f t ',' 0 - 0 5039 5055 5056 5057 5058 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3904 int4range 11 10 -1 f r R f t ',' 0 - 0 3905 3834 3835 3836 3837 - - 3916 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3906 numrange 11 10 -1 f r R f t ',' 0 - 0 3907 3834 3835 3836 3837 - - 3916 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3908 tsrange 11 10 -1 f r R f t ',' 0 - 0 3909 3834 3835 3836 3837 - - 3916 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3910 tstzrange 11 10 -1 f r R f t ',' 0 - 0 3911 3834 3835 3836 3837 - - 3916 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3912 daterange 11 10 -1 f r R f t ',' 0 - 0 3913 3834 3835 3836 3837 - - 3916 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3926 int8range 11 10 -1 f r R f t ',' 0 - 0 3927 3834 3835 3836 3837 - - 3916 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4451 int4multirange 11 10 -1 f m R f t ',' 0 - 0 6150 4231 4232 4233 4234 - - 4242 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4532 nummultirange 11 10 -1 f m R f t ',' 0 - 0 6151 4231 4232 4233 4234 - - 4242 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4533 tsmultirange 11 10 -1 f m R f t ',' 0 - 0 6152 4231 4232 4233 4234 - - 4242 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4534 tstzmultirange 11 10 -1 f m R f t ',' 0 - 0 6153 4231 4232 4233 4234 - - 4242 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4535 datemultirange 11 10 -1 f m R f t ',' 0 - 0 6155 4231 4232 4233 4234 - - 4242 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4536 int8multirange 11 10 -1 f m R f t ',' 0 - 0 6157 4231 4232 4233 4234 - - 4242 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2249 record 11 10 -1 f p P f t ',' 0 - 0 2287 2290 2291 2402 2403 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2287 _record 11 10 -1 f p P f t ',' 0 6179 2249 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2275 cstring 11 10 -2 f p P f t ',' 0 - 0 1263 2292 2293 2500 2501 - - - c p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2276 any 11 10 4 t p P f t ',' 0 - 0 0 2294 2295 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2277 anyarray 11 10 -1 f p P f t ',' 0 - 0 0 2296 2297 2502 2503 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2278 void 11 10 4 t p P f t ',' 0 - 0 0 2298 2299 3120 3121 - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2279 trigger 11 10 4 t p P f t ',' 0 - 0 0 2300 2301 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3838 event_trigger 11 10 4 t p P f t ',' 0 - 0 0 3594 3595 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2280 language_handler 11 10 4 t p P f t ',' 0 - 0 0 2302 2303 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2281 internal 11 10 SIZEOF_POINTER t p P f t ',' 0 - 0 0 2304 2305 - - - - - ALIGNOF_POINTER p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2283 anyelement 11 10 4 t p P f t ',' 0 - 0 0 2312 2313 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2776 anynonarray 11 10 4 t p P f t ',' 0 - 0 0 2777 2778 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3500 anyenum 11 10 4 t p P f t ',' 0 - 0 0 3504 3505 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3115 fdw_handler 11 10 4 t p P f t ',' 0 - 0 0 3116 3117 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 325 index_am_handler 11 10 4 t p P f t ',' 0 - 0 0 326 327 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3310 tsm_handler 11 10 4 t p P f t ',' 0 - 0 0 3311 3312 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 269 table_am_handler 11 10 4 t p P f t ',' 0 - 0 0 267 268 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3831 anyrange 11 10 -1 f p P f t ',' 0 - 0 0 3832 3833 - - - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5077 anycompatible 11 10 4 t p P f t ',' 0 - 0 0 5086 5087 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5078 anycompatiblearray 11 10 -1 f p P f t ',' 0 - 0 0 5088 5089 5090 5091 - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5079 anycompatiblenonarray 11 10 4 t p P f t ',' 0 - 0 0 5092 5093 - - - - - i p f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5080 anycompatiblerange 11 10 -1 f p P f t ',' 0 - 0 0 5094 5095 - - - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4537 anymultirange 11 10 -1 f p P f t ',' 0 - 0 0 4229 4230 - - - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4538 anycompatiblemultirange 11 10 -1 f p P f t ',' 0 - 0 0 4226 4227 - - - - - d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4600 pg_brin_bloom_summary 11 10 -1 f b Z f t ',' 0 - 0 0 4596 4597 4598 4599 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 4601 pg_brin_minmax_multi_summary 11 10 -1 f b Z f t ',' 0 - 0 0 4638 4639 4640 4641 - - - i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1000 _bool 11 10 -1 f b A f t ',' 0 6179 16 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1001 _bytea 11 10 -1 f b A f t ',' 0 6179 17 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1002 _char 11 10 -1 f b A f t ',' 0 6179 18 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1003 _name 11 10 -1 f b A f t ',' 0 6179 19 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 950 _null_ _null_ _null_ ) insert ( 1016 _int8 11 10 -1 f b A f t ',' 0 6179 20 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1005 _int2 11 10 -1 f b A f t ',' 0 6179 21 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1006 _int2vector 11 10 -1 f b A f t ',' 0 6179 22 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1007 _int4 11 10 -1 f b A f t ',' 0 6179 23 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1008 _regproc 11 10 -1 f b A f t ',' 0 6179 24 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1009 _text 11 10 -1 f b A f t ',' 0 6179 25 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1028 _oid 11 10 -1 f b A f t ',' 0 6179 26 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1010 _tid 11 10 -1 f b A f t ',' 0 6179 27 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1011 _xid 11 10 -1 f b A f t ',' 0 6179 28 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1012 _cid 11 10 -1 f b A f t ',' 0 6179 29 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1013 _oidvector 11 10 -1 f b A f t ',' 0 6179 30 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 210 _pg_type 11 10 -1 f b A f t ',' 0 6179 71 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 270 _pg_attribute 11 10 -1 f b A f t ',' 0 6179 75 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 272 _pg_proc 11 10 -1 f b A f t ',' 0 6179 81 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 273 _pg_class 11 10 -1 f b A f t ',' 0 6179 83 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 199 _json 11 10 -1 f b A f t ',' 0 6179 114 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 143 _xml 11 10 -1 f b A f t ',' 0 6179 142 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 271 _xid8 11 10 -1 f b A f t ',' 0 6179 5069 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1017 _point 11 10 -1 f b A f t ',' 0 6179 600 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1018 _lseg 11 10 -1 f b A f t ',' 0 6179 601 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1019 _path 11 10 -1 f b A f t ',' 0 6179 602 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1020 _box 11 10 -1 f b A f t ';' 0 6179 603 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1027 _polygon 11 10 -1 f b A f t ',' 0 6179 604 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 629 _line 11 10 -1 f b A f t ',' 0 6179 628 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1021 _float4 11 10 -1 f b A f t ',' 0 6179 700 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1022 _float8 11 10 -1 f b A f t ',' 0 6179 701 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 719 _circle 11 10 -1 f b A f t ',' 0 6179 718 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 791 _money 11 10 -1 f b A f t ',' 0 6179 790 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1040 _macaddr 11 10 -1 f b A f t ',' 0 6179 829 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1041 _inet 11 10 -1 f b A f t ',' 0 6179 869 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 651 _cidr 11 10 -1 f b A f t ',' 0 6179 650 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 775 _macaddr8 11 10 -1 f b A f t ',' 0 6179 774 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1034 _aclitem 11 10 -1 f b A f t ',' 0 6179 1033 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1014 _bpchar 11 10 -1 f b A f t ',' 0 6179 1042 0 750 751 2400 2401 2913 2914 3816 i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1015 _varchar 11 10 -1 f b A f t ',' 0 6179 1043 0 750 751 2400 2401 2915 2916 3816 i x f 0 -1 0 100 _null_ _null_ _null_ ) insert ( 1182 _date 11 10 -1 f b A f t ',' 0 6179 1082 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1183 _time 11 10 -1 f b A f t ',' 0 6179 1083 0 750 751 2400 2401 2909 2910 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1115 _timestamp 11 10 -1 f b A f t ',' 0 6179 1114 0 750 751 2400 2401 2905 2906 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1185 _timestamptz 11 10 -1 f b A f t ',' 0 6179 1184 0 750 751 2400 2401 2907 2908 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1187 _interval 11 10 -1 f b A f t ',' 0 6179 1186 0 750 751 2400 2401 2903 2904 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1270 _timetz 11 10 -1 f b A f t ',' 0 6179 1266 0 750 751 2400 2401 2911 2912 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1561 _bit 11 10 -1 f b A f t ',' 0 6179 1560 0 750 751 2400 2401 2919 2920 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1563 _varbit 11 10 -1 f b A f t ',' 0 6179 1562 0 750 751 2400 2401 2902 2921 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1231 _numeric 11 10 -1 f b A f t ',' 0 6179 1700 0 750 751 2400 2401 2917 2918 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2201 _refcursor 11 10 -1 f b A f t ',' 0 6179 1790 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2207 _regprocedure 11 10 -1 f b A f t ',' 0 6179 2202 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2208 _regoper 11 10 -1 f b A f t ',' 0 6179 2203 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2209 _regoperator 11 10 -1 f b A f t ',' 0 6179 2204 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2210 _regclass 11 10 -1 f b A f t ',' 0 6179 2205 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4192 _regcollation 11 10 -1 f b A f t ',' 0 6179 4191 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2211 _regtype 11 10 -1 f b A f t ',' 0 6179 2206 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4097 _regrole 11 10 -1 f b A f t ',' 0 6179 4096 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4090 _regnamespace 11 10 -1 f b A f t ',' 0 6179 4089 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2951 _uuid 11 10 -1 f b A f t ',' 0 6179 2950 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3221 _pg_lsn 11 10 -1 f b A f t ',' 0 6179 3220 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3643 _tsvector 11 10 -1 f b A f t ',' 0 6179 3614 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3644 _gtsvector 11 10 -1 f b A f t ',' 0 6179 3642 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3645 _tsquery 11 10 -1 f b A f t ',' 0 6179 3615 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3735 _regconfig 11 10 -1 f b A f t ',' 0 6179 3734 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3770 _regdictionary 11 10 -1 f b A f t ',' 0 6179 3769 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3807 _jsonb 11 10 -1 f b A f t ',' 0 6179 3802 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 4073 _jsonpath 11 10 -1 f b A f t ',' 0 6179 4072 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 2949 _txid_snapshot 11 10 -1 f b A f t ',' 0 6179 2970 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 5039 _pg_snapshot 11 10 -1 f b A f t ',' 0 6179 5038 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3905 _int4range 11 10 -1 f b A f t ',' 0 6179 3904 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3907 _numrange 11 10 -1 f b A f t ',' 0 6179 3906 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3909 _tsrange 11 10 -1 f b A f t ',' 0 6179 3908 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3911 _tstzrange 11 10 -1 f b A f t ',' 0 6179 3910 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3913 _daterange 11 10 -1 f b A f t ',' 0 6179 3912 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 3927 _int8range 11 10 -1 f b A f t ',' 0 6179 3926 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6150 _int4multirange 11 10 -1 f b A f t ',' 0 6179 4451 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6151 _nummultirange 11 10 -1 f b A f t ',' 0 6179 4532 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6152 _tsmultirange 11 10 -1 f b A f t ',' 0 6179 4533 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6153 _tstzmultirange 11 10 -1 f b A f t ',' 0 6179 4534 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6155 _datemultirange 11 10 -1 f b A f t ',' 0 6179 4535 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 6157 _int8multirange 11 10 -1 f b A f t ',' 0 6179 4536 0 750 751 2400 2401 - - 3816 d x f 0 -1 0 0 _null_ _null_ _null_ ) insert ( 1263 _cstring 11 10 -1 f b A f t ',' 0 6179 2275 0 750 751 2400 2401 - - 3816 i x f 0 -1 0 0 _null_ _null_ _null_ ) close pg_type create pg_attribute 1249 bootstrap rowtype_oid 75 ( attrelid = oid , attname = name , atttypid = oid , attlen = int2 , attnum = int2 , attcacheoff = int4 , atttypmod = int4 , attndims = int2 , attbyval = bool , attalign = char , attstorage = char , attcompression = char , attnotnull = bool , atthasdef = bool , atthasmissing = bool , attidentity = char , attgenerated = char , attisdropped = bool , attislocal = bool , attinhcount = int2 , attcollation = oid , attstattarget = int2 FORCE NULL , attacl = _aclitem , attoptions = _text , attfdwoptions = _text , attmissingval = anyarray ) insert ( 1255 oid 26 4 1 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proname 19 NAMEDATALEN 2 -1 -1 0 f c p '' t f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 pronamespace 26 4 3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proowner 26 4 4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prolang 26 4 5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 procost 700 4 6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prorows 700 4 7 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 provariadic 26 4 8 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prosupport 24 4 9 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prokind 18 1 10 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prosecdef 16 1 11 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proleakproof 16 1 12 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proisstrict 16 1 13 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proretset 16 1 14 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 provolatile 18 1 15 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proparallel 18 1 16 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 pronargs 21 2 17 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 pronargdefaults 21 2 18 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prorettype 26 4 19 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proargtypes 30 -1 20 -1 -1 1 f i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proallargtypes 1028 -1 21 -1 -1 1 f i x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proargmodes 1002 -1 22 -1 -1 1 f i x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proargnames 1009 -1 23 -1 -1 1 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proargdefaults 194 -1 24 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 protrftypes 1028 -1 25 -1 -1 1 f i x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prosrc 25 -1 26 -1 -1 0 f i x '' t f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 probin 25 -1 27 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 prosqlbody 194 -1 28 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proconfig 1009 -1 29 -1 -1 1 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 proacl 1034 -1 30 -1 -1 1 f d x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 ctid 27 6 -1 -1 -1 0 f s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 xmin 28 4 -2 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 cmin 29 4 -3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 xmax 28 4 -4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 cmax 29 4 -5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1255 tableoid 26 4 -6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 oid 26 4 1 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typname 19 NAMEDATALEN 2 -1 -1 0 f c p '' t f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typnamespace 26 4 3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typowner 26 4 4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typlen 21 2 5 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typbyval 16 1 6 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typtype 18 1 7 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typcategory 18 1 8 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typispreferred 16 1 9 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typisdefined 16 1 10 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typdelim 18 1 11 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typrelid 26 4 12 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typsubscript 24 4 13 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typelem 26 4 14 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typarray 26 4 15 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typinput 24 4 16 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typoutput 24 4 17 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typreceive 24 4 18 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typsend 24 4 19 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typmodin 24 4 20 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typmodout 24 4 21 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typanalyze 24 4 22 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typalign 18 1 23 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typstorage 18 1 24 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typnotnull 16 1 25 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typbasetype 26 4 26 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typtypmod 23 4 27 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typndims 23 4 28 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typcollation 26 4 29 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typdefaultbin 194 -1 30 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typdefault 25 -1 31 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 typacl 1034 -1 32 -1 -1 1 f d x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 ctid 27 6 -1 -1 -1 0 f s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 xmin 28 4 -2 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 cmin 29 4 -3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 xmax 28 4 -4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 cmax 29 4 -5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1247 tableoid 26 4 -6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attrelid 26 4 1 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attname 19 NAMEDATALEN 2 -1 -1 0 f c p '' t f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 atttypid 26 4 3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attlen 21 2 4 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attnum 21 2 5 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attcacheoff 23 4 6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 atttypmod 23 4 7 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attndims 21 2 8 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attbyval 16 1 9 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attalign 18 1 10 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attstorage 18 1 11 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attcompression 18 1 12 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attnotnull 16 1 13 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 atthasdef 16 1 14 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 atthasmissing 16 1 15 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attidentity 18 1 16 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attgenerated 18 1 17 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attisdropped 16 1 18 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attislocal 16 1 19 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attinhcount 21 2 20 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attcollation 26 4 21 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attstattarget 21 2 22 -1 -1 0 t s p '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attacl 1034 -1 23 -1 -1 1 f d x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attoptions 1009 -1 24 -1 -1 1 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attfdwoptions 1009 -1 25 -1 -1 1 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 attmissingval 2277 -1 26 -1 -1 0 f d x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 ctid 27 6 -1 -1 -1 0 f s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 xmin 28 4 -2 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 cmin 29 4 -3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 xmax 28 4 -4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 cmax 29 4 -5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1249 tableoid 26 4 -6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 oid 26 4 1 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relname 19 NAMEDATALEN 2 -1 -1 0 f c p '' t f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relnamespace 26 4 3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reltype 26 4 4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reloftype 26 4 5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relowner 26 4 6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relam 26 4 7 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relfilenode 26 4 8 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reltablespace 26 4 9 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relpages 23 4 10 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reltuples 700 4 11 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relallvisible 23 4 12 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reltoastrelid 26 4 13 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relhasindex 16 1 14 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relisshared 16 1 15 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relpersistence 18 1 16 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relkind 18 1 17 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relnatts 21 2 18 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relchecks 21 2 19 -1 -1 0 t s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relhasrules 16 1 20 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relhastriggers 16 1 21 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relhassubclass 16 1 22 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relrowsecurity 16 1 23 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relforcerowsecurity 16 1 24 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relispopulated 16 1 25 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relreplident 18 1 26 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relispartition 16 1 27 -1 -1 0 t c p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relrewrite 26 4 28 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relfrozenxid 28 4 29 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relminmxid 28 4 30 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relacl 1034 -1 31 -1 -1 1 f d x '' f f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 reloptions 1009 -1 32 -1 -1 1 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 relpartbound 194 -1 33 -1 -1 0 f i x '' f f f '' '' f t 0 950 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 ctid 27 6 -1 -1 -1 0 f s p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 xmin 28 4 -2 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 cmin 29 4 -3 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 xmax 28 4 -4 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 cmax 29 4 -5 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) insert ( 1259 tableoid 26 4 -6 -1 -1 0 t i p '' t f f '' '' f t 0 0 _null_ _null_ _null_ _null_ _null_ ) close pg_attribute create pg_class 1259 bootstrap rowtype_oid 83 ( oid = oid , relname = name , relnamespace = oid , reltype = oid , reloftype = oid , relowner = oid , relam = oid , relfilenode = oid , reltablespace = oid , relpages = int4 , reltuples = float4 , relallvisible = int4 , reltoastrelid = oid , relhasindex = bool , relisshared = bool , relpersistence = char , relkind = char , relnatts = int2 , relchecks = int2 , relhasrules = bool , relhastriggers = bool , relhassubclass = bool , relrowsecurity = bool , relforcerowsecurity = bool , relispopulated = bool , relreplident = char , relispartition = bool , relrewrite = oid , relfrozenxid = xid , relminmxid = xid , relacl = _aclitem , reloptions = _text , relpartbound = pg_node_tree ) insert ( 1247 pg_type 11 71 0 10 2 0 0 0 -1 0 0 f f p r 32 0 f f f f f t n f 0 3 1 _null_ _null_ _null_ ) insert ( 1249 pg_attribute 11 75 0 10 2 0 0 0 -1 0 0 f f p r 26 0 f f f f f t n f 0 3 1 _null_ _null_ _null_ ) insert ( 1255 pg_proc 11 81 0 10 2 0 0 0 -1 0 0 f f p r 30 0 f f f f f t n f 0 3 1 _null_ _null_ _null_ ) insert ( 1259 pg_class 11 83 0 10 2 0 0 0 -1 0 0 f f p r 33 0 f f f f f t n f 0 3 1 _null_ _null_ _null_ ) close pg_class create pg_attrdef 2604 ( oid = oid , adrelid = oid , adnum = int2 , adbin = pg_node_tree FORCE NOT NULL ) open pg_attrdef close pg_attrdef create pg_constraint 2606 ( oid = oid , conname = name , connamespace = oid , contype = char , condeferrable = bool , condeferred = bool , convalidated = bool , conrelid = oid , contypid = oid , conindid = oid , conparentid = oid , confrelid = oid , confupdtype = char , confdeltype = char , confmatchtype = char , conislocal = bool , coninhcount = int2 , connoinherit = bool , conkey = _int2 , confkey = _int2 , conpfeqop = _oid , conppeqop = _oid , conffeqop = _oid , confdelsetcols = _int2 , conexclop = _oid , conbin = pg_node_tree ) open pg_constraint close pg_constraint create pg_inherits 2611 ( inhrelid = oid , inhparent = oid , inhseqno = int4 , inhdetachpending = bool ) open pg_inherits close pg_inherits create pg_index 2610 ( indexrelid = oid , indrelid = oid , indnatts = int2 , indnkeyatts = int2 , indisunique = bool , indnullsnotdistinct = bool , indisprimary = bool , indisexclusion = bool , indimmediate = bool , indisclustered = bool , indisvalid = bool , indcheckxmin = bool , indisready = bool , indislive = bool , indisreplident = bool , indkey = int2vector FORCE NOT NULL , indcollation = oidvector FORCE NOT NULL , indclass = oidvector FORCE NOT NULL , indoption = int2vector FORCE NOT NULL , indexprs = pg_node_tree , indpred = pg_node_tree ) open pg_index close pg_index create pg_operator 2617 ( oid = oid , oprname = name , oprnamespace = oid , oprowner = oid , oprkind = char , oprcanmerge = bool , oprcanhash = bool , oprleft = oid , oprright = oid , oprresult = oid , oprcom = oid , oprnegate = oid , oprcode = regproc , oprrest = regproc , oprjoin = regproc ) open pg_operator insert ( 15 '=' 11 10 b t t 23 20 16 416 36 852 101 105 ) insert ( 36 '<>' 11 10 b f f 23 20 16 417 15 853 102 106 ) insert ( 37 '<' 11 10 b f f 23 20 16 419 82 854 103 107 ) insert ( 76 '>' 11 10 b f f 23 20 16 418 80 855 104 108 ) insert ( 80 '<=' 11 10 b f f 23 20 16 430 76 856 336 386 ) insert ( 82 '>=' 11 10 b f f 23 20 16 420 37 857 337 398 ) insert ( 58 '<' 11 10 b f f 16 16 16 59 1695 56 103 107 ) insert ( 59 '>' 11 10 b f f 16 16 16 58 1694 57 104 108 ) insert ( 85 '<>' 11 10 b f f 16 16 16 85 91 84 102 106 ) insert ( 91 '=' 11 10 b t t 16 16 16 91 85 60 101 105 ) insert ( 1694 '<=' 11 10 b f f 16 16 16 1695 59 1691 336 386 ) insert ( 1695 '>=' 11 10 b f f 16 16 16 1694 58 1692 337 398 ) insert ( 92 '=' 11 10 b t t 18 18 16 92 630 61 101 105 ) insert ( 93 '=' 11 10 b t t 19 19 16 93 643 62 101 105 ) insert ( 94 '=' 11 10 b t t 21 21 16 94 519 63 101 105 ) insert ( 95 '<' 11 10 b f f 21 21 16 520 524 64 103 107 ) insert ( 96 '=' 11 10 b t t 23 23 16 96 518 65 101 105 ) insert ( 97 '<' 11 10 b f f 23 23 16 521 525 66 103 107 ) insert ( 98 '=' 11 10 b t t 25 25 16 98 531 67 101 105 ) insert ( 3877 '^@' 11 10 b f f 25 25 16 0 0 3696 3437 3438 ) insert ( 254 '=' 11 10 b t t 19 25 16 260 259 240 101 105 ) insert ( 255 '<' 11 10 b f f 19 25 16 264 257 241 103 107 ) insert ( 256 '<=' 11 10 b f f 19 25 16 263 258 242 336 386 ) insert ( 257 '>=' 11 10 b f f 19 25 16 262 255 243 337 398 ) insert ( 258 '>' 11 10 b f f 19 25 16 261 256 244 104 108 ) insert ( 259 '<>' 11 10 b f f 19 25 16 265 254 245 102 106 ) insert ( 260 '=' 11 10 b t t 25 19 16 254 265 247 101 105 ) insert ( 261 '<' 11 10 b f f 25 19 16 258 263 248 103 107 ) insert ( 262 '<=' 11 10 b f f 25 19 16 257 264 249 336 386 ) insert ( 263 '>=' 11 10 b f f 25 19 16 256 261 250 337 398 ) insert ( 264 '>' 11 10 b f f 25 19 16 255 262 251 104 108 ) insert ( 265 '<>' 11 10 b f f 25 19 16 259 260 252 102 106 ) insert ( 349 '||' 11 10 b f f 5078 5077 5078 0 0 378 - - ) insert ( 374 '||' 11 10 b f f 5077 5078 5078 0 0 379 - - ) insert ( 375 '||' 11 10 b f f 5078 5078 5078 0 0 383 - - ) insert ( 352 '=' 11 10 b f t 28 28 16 352 3315 68 101 105 ) insert ( 353 '=' 11 10 b f f 28 23 16 0 3316 1319 101 105 ) insert ( 3315 '<>' 11 10 b f f 28 28 16 3315 352 3308 102 106 ) insert ( 3316 '<>' 11 10 b f f 28 23 16 0 353 3309 102 106 ) insert ( 5068 '=' 11 10 b t t 5069 5069 16 5068 5072 5084 101 105 ) insert ( 5072 '<>' 11 10 b f f 5069 5069 16 5072 5068 5085 102 106 ) insert ( 5073 '<' 11 10 b f f 5069 5069 16 5074 5076 5034 103 107 ) insert ( 5074 '>' 11 10 b f f 5069 5069 16 5073 5075 5035 104 108 ) insert ( 5075 '<=' 11 10 b f f 5069 5069 16 5076 5074 5036 336 386 ) insert ( 5076 '>=' 11 10 b f f 5069 5069 16 5075 5073 5037 337 398 ) insert ( 385 '=' 11 10 b f t 29 29 16 385 0 69 101 105 ) insert ( 387 '=' 11 10 b t t 27 27 16 387 402 1292 101 105 ) insert ( 402 '<>' 11 10 b f f 27 27 16 402 387 1265 102 106 ) insert ( 2799 '<' 11 10 b f f 27 27 16 2800 2802 2791 103 107 ) insert ( 2800 '>' 11 10 b f f 27 27 16 2799 2801 2790 104 108 ) insert ( 2801 '<=' 11 10 b f f 27 27 16 2802 2800 2793 336 386 ) insert ( 2802 '>=' 11 10 b f f 27 27 16 2801 2799 2792 337 398 ) insert ( 410 '=' 11 10 b t t 20 20 16 410 411 467 101 105 ) insert ( 411 '<>' 11 10 b f f 20 20 16 411 410 468 102 106 ) insert ( 412 '<' 11 10 b f f 20 20 16 413 415 469 103 107 ) insert ( 413 '>' 11 10 b f f 20 20 16 412 414 470 104 108 ) insert ( 414 '<=' 11 10 b f f 20 20 16 415 413 471 336 386 ) insert ( 415 '>=' 11 10 b f f 20 20 16 414 412 472 337 398 ) insert ( 416 '=' 11 10 b t t 20 23 16 15 417 474 101 105 ) insert ( 417 '<>' 11 10 b f f 20 23 16 36 416 475 102 106 ) insert ( 418 '<' 11 10 b f f 20 23 16 76 430 476 103 107 ) insert ( 419 '>' 11 10 b f f 20 23 16 37 420 477 104 108 ) insert ( 420 '<=' 11 10 b f f 20 23 16 82 419 478 336 386 ) insert ( 430 '>=' 11 10 b f f 20 23 16 80 418 479 337 398 ) insert ( 439 '%' 11 10 b f f 20 20 20 0 0 945 - - ) insert ( 473 '@' 11 10 l f f 0 20 20 0 0 1230 - - ) insert ( 484 - 11 10 l f f 0 20 20 0 0 462 - - ) insert ( 485 '<<' 11 10 b f f 604 604 16 0 0 341 1300 1301 ) insert ( 486 '&<' 11 10 b f f 604 604 16 0 0 342 1300 1301 ) insert ( 487 '&>' 11 10 b f f 604 604 16 0 0 343 1300 1301 ) insert ( 488 '>>' 11 10 b f f 604 604 16 0 0 344 1300 1301 ) insert ( 489 '<@' 11 10 b f f 604 604 16 490 0 345 1302 1303 ) insert ( 490 '@>' 11 10 b f f 604 604 16 489 0 340 1302 1303 ) insert ( 491 '~=' 11 10 b f f 604 604 16 491 0 339 101 105 ) insert ( 492 '&&' 11 10 b f f 604 604 16 492 0 346 139 140 ) insert ( 493 '<<' 11 10 b f f 603 603 16 0 0 188 1300 1301 ) insert ( 494 '&<' 11 10 b f f 603 603 16 0 0 189 1300 1301 ) insert ( 495 '&>' 11 10 b f f 603 603 16 0 0 190 1300 1301 ) insert ( 496 '>>' 11 10 b f f 603 603 16 0 0 191 1300 1301 ) insert ( 497 '<@' 11 10 b f f 603 603 16 498 0 192 1302 1303 ) insert ( 498 '@>' 11 10 b f f 603 603 16 497 0 187 1302 1303 ) insert ( 499 '~=' 11 10 b f f 603 603 16 499 0 186 101 105 ) insert ( 500 '&&' 11 10 b f f 603 603 16 500 0 125 139 140 ) insert ( 501 '>=' 11 10 b f f 603 603 16 505 504 126 139 140 ) insert ( 502 '>' 11 10 b f f 603 603 16 504 505 127 139 140 ) insert ( 503 '=' 11 10 b f f 603 603 16 503 0 128 101 105 ) insert ( 504 '<' 11 10 b f f 603 603 16 502 501 129 139 140 ) insert ( 505 '<=' 11 10 b f f 603 603 16 501 502 130 139 140 ) insert ( 506 '>^' 11 10 b f f 600 600 16 0 0 131 1300 1301 ) insert ( 507 '<<' 11 10 b f f 600 600 16 0 0 132 1300 1301 ) insert ( 508 '>>' 11 10 b f f 600 600 16 0 0 133 1300 1301 ) insert ( 509 '<^' 11 10 b f f 600 600 16 0 0 134 1300 1301 ) insert ( 510 '~=' 11 10 b f f 600 600 16 510 713 135 101 105 ) insert ( 511 '<@' 11 10 b f f 600 603 16 433 0 136 1302 1303 ) insert ( 433 '@>' 11 10 b f f 603 600 16 511 0 193 1302 1303 ) insert ( 512 '<@' 11 10 b f f 600 602 16 755 0 137 - - ) insert ( 513 '@@' 11 10 l f f 0 603 600 0 0 138 - - ) insert ( 514 '*' 11 10 b f f 23 23 23 514 0 141 - - ) insert ( 517 '<->' 11 10 b f f 600 600 701 517 0 991 - - ) insert ( 518 '<>' 11 10 b f f 23 23 16 518 96 144 102 106 ) insert ( 519 '<>' 11 10 b f f 21 21 16 519 94 145 102 106 ) insert ( 520 '>' 11 10 b f f 21 21 16 95 522 146 104 108 ) insert ( 521 '>' 11 10 b f f 23 23 16 97 523 147 104 108 ) insert ( 522 '<=' 11 10 b f f 21 21 16 524 520 148 336 386 ) insert ( 523 '<=' 11 10 b f f 23 23 16 525 521 149 336 386 ) insert ( 524 '>=' 11 10 b f f 21 21 16 522 95 151 337 398 ) insert ( 525 '>=' 11 10 b f f 23 23 16 523 97 150 337 398 ) insert ( 526 '*' 11 10 b f f 21 21 21 526 0 152 - - ) insert ( 527 '/' 11 10 b f f 21 21 21 0 0 153 - - ) insert ( 528 '/' 11 10 b f f 23 23 23 0 0 154 - - ) insert ( 529 '%' 11 10 b f f 21 21 21 0 0 155 - - ) insert ( 530 '%' 11 10 b f f 23 23 23 0 0 156 - - ) insert ( 531 '<>' 11 10 b f f 25 25 16 531 98 157 102 106 ) insert ( 532 '=' 11 10 b t t 21 23 16 533 538 158 101 105 ) insert ( 533 '=' 11 10 b t t 23 21 16 532 539 159 101 105 ) insert ( 534 '<' 11 10 b f f 21 23 16 537 542 160 103 107 ) insert ( 535 '<' 11 10 b f f 23 21 16 536 543 161 103 107 ) insert ( 536 '>' 11 10 b f f 21 23 16 535 540 162 104 108 ) insert ( 537 '>' 11 10 b f f 23 21 16 534 541 163 104 108 ) insert ( 538 '<>' 11 10 b f f 21 23 16 539 532 164 102 106 ) insert ( 539 '<>' 11 10 b f f 23 21 16 538 533 165 102 106 ) insert ( 540 '<=' 11 10 b f f 21 23 16 543 536 166 336 386 ) insert ( 541 '<=' 11 10 b f f 23 21 16 542 537 167 336 386 ) insert ( 542 '>=' 11 10 b f f 21 23 16 541 534 168 337 398 ) insert ( 543 '>=' 11 10 b f f 23 21 16 540 535 169 337 398 ) insert ( 544 '*' 11 10 b f f 21 23 23 545 0 170 - - ) insert ( 545 '*' 11 10 b f f 23 21 23 544 0 171 - - ) insert ( 546 '/' 11 10 b f f 21 23 23 0 0 172 - - ) insert ( 547 '/' 11 10 b f f 23 21 23 0 0 173 - - ) insert ( 550 '+' 11 10 b f f 21 21 21 550 0 176 - - ) insert ( 551 '+' 11 10 b f f 23 23 23 551 0 177 - - ) insert ( 552 '+' 11 10 b f f 21 23 23 553 0 178 - - ) insert ( 553 '+' 11 10 b f f 23 21 23 552 0 179 - - ) insert ( 554 - 11 10 b f f 21 21 21 0 0 180 - - ) insert ( 555 - 11 10 b f f 23 23 23 0 0 181 - - ) insert ( 556 - 11 10 b f f 21 23 23 0 0 182 - - ) insert ( 557 - 11 10 b f f 23 21 23 0 0 183 - - ) insert ( 558 - 11 10 l f f 0 23 23 0 0 212 - - ) insert ( 559 - 11 10 l f f 0 21 21 0 0 213 - - ) insert ( 584 - 11 10 l f f 0 700 700 0 0 206 - - ) insert ( 585 - 11 10 l f f 0 701 701 0 0 220 - - ) insert ( 586 '+' 11 10 b f f 700 700 700 586 0 204 - - ) insert ( 587 - 11 10 b f f 700 700 700 0 0 205 - - ) insert ( 588 '/' 11 10 b f f 700 700 700 0 0 203 - - ) insert ( 589 '*' 11 10 b f f 700 700 700 589 0 202 - - ) insert ( 590 '@' 11 10 l f f 0 700 700 0 0 207 - - ) insert ( 591 '+' 11 10 b f f 701 701 701 591 0 218 - - ) insert ( 592 - 11 10 b f f 701 701 701 0 0 219 - - ) insert ( 593 '/' 11 10 b f f 701 701 701 0 0 217 - - ) insert ( 594 '*' 11 10 b f f 701 701 701 594 0 216 - - ) insert ( 595 '@' 11 10 l f f 0 701 701 0 0 221 - - ) insert ( 596 '|/' 11 10 l f f 0 701 701 0 0 230 - - ) insert ( 597 '||/' 11 10 l f f 0 701 701 0 0 231 - - ) insert ( 607 '=' 11 10 b t t 26 26 16 607 608 184 101 105 ) insert ( 608 '<>' 11 10 b f f 26 26 16 608 607 185 102 106 ) insert ( 609 '<' 11 10 b f f 26 26 16 610 612 716 103 107 ) insert ( 610 '>' 11 10 b f f 26 26 16 609 611 1638 104 108 ) insert ( 611 '<=' 11 10 b f f 26 26 16 612 610 717 336 386 ) insert ( 612 '>=' 11 10 b f f 26 26 16 611 609 1639 337 398 ) insert ( 644 '<>' 11 10 b f f 30 30 16 644 649 619 102 106 ) insert ( 645 '<' 11 10 b f f 30 30 16 646 648 677 103 107 ) insert ( 646 '>' 11 10 b f f 30 30 16 645 647 681 104 108 ) insert ( 647 '<=' 11 10 b f f 30 30 16 648 646 678 336 386 ) insert ( 648 '>=' 11 10 b f f 30 30 16 647 645 680 337 398 ) insert ( 649 '=' 11 10 b t t 30 30 16 649 644 679 101 105 ) insert ( 613 '<->' 11 10 b f f 600 628 701 760 0 725 - - ) insert ( 760 '<->' 11 10 b f f 628 600 701 613 0 702 - - ) insert ( 614 '<->' 11 10 b f f 600 601 701 761 0 363 - - ) insert ( 761 '<->' 11 10 b f f 601 600 701 614 0 380 - - ) insert ( 615 '<->' 11 10 b f f 600 603 701 606 0 364 - - ) insert ( 606 '<->' 11 10 b f f 603 600 701 615 0 357 - - ) insert ( 616 '<->' 11 10 b f f 601 628 701 762 0 727 - - ) insert ( 762 '<->' 11 10 b f f 628 601 701 616 0 704 - - ) insert ( 617 '<->' 11 10 b f f 601 603 701 763 0 365 - - ) insert ( 763 '<->' 11 10 b f f 603 601 701 617 0 381 - - ) insert ( 618 '<->' 11 10 b f f 600 602 701 784 0 371 - - ) insert ( 784 '<->' 11 10 b f f 602 600 701 618 0 421 - - ) insert ( 620 '=' 11 10 b t t 700 700 16 620 621 287 101 105 ) insert ( 621 '<>' 11 10 b f f 700 700 16 621 620 288 102 106 ) insert ( 622 '<' 11 10 b f f 700 700 16 623 625 289 103 107 ) insert ( 623 '>' 11 10 b f f 700 700 16 622 624 291 104 108 ) insert ( 624 '<=' 11 10 b f f 700 700 16 625 623 290 336 386 ) insert ( 625 '>=' 11 10 b f f 700 700 16 624 622 292 337 398 ) insert ( 630 '<>' 11 10 b f f 18 18 16 630 92 70 102 106 ) insert ( 631 '<' 11 10 b f f 18 18 16 633 634 1246 103 107 ) insert ( 632 '<=' 11 10 b f f 18 18 16 634 633 72 336 386 ) insert ( 633 '>' 11 10 b f f 18 18 16 631 632 73 104 108 ) insert ( 634 '>=' 11 10 b f f 18 18 16 632 631 74 337 398 ) insert ( 639 '~' 11 10 b f f 19 25 16 0 640 79 1818 1824 ) insert ( 640 '!~' 11 10 b f f 19 25 16 0 639 1252 1821 1827 ) insert ( 641 '~' 11 10 b f f 25 25 16 0 642 1254 1818 1824 ) insert ( 642 '!~' 11 10 b f f 25 25 16 0 641 1256 1821 1827 ) insert ( 643 '<>' 11 10 b f f 19 19 16 643 93 659 102 106 ) insert ( 654 '||' 11 10 b f f 25 25 25 0 0 1258 - - ) insert ( 660 '<' 11 10 b f f 19 19 16 662 663 655 103 107 ) insert ( 661 '<=' 11 10 b f f 19 19 16 663 662 656 336 386 ) insert ( 662 '>' 11 10 b f f 19 19 16 660 661 657 104 108 ) insert ( 663 '>=' 11 10 b f f 19 19 16 661 660 658 337 398 ) insert ( 664 '<' 11 10 b f f 25 25 16 666 667 740 103 107 ) insert ( 665 '<=' 11 10 b f f 25 25 16 667 666 741 336 386 ) insert ( 666 '>' 11 10 b f f 25 25 16 664 665 742 104 108 ) insert ( 667 '>=' 11 10 b f f 25 25 16 665 664 743 337 398 ) insert ( 670 '=' 11 10 b t t 701 701 16 670 671 293 101 105 ) insert ( 671 '<>' 11 10 b f f 701 701 16 671 670 294 102 106 ) insert ( 672 '<' 11 10 b f f 701 701 16 674 675 295 103 107 ) insert ( 673 '<=' 11 10 b f f 701 701 16 675 674 296 336 386 ) insert ( 674 '>' 11 10 b f f 701 701 16 672 673 297 104 108 ) insert ( 675 '>=' 11 10 b f f 701 701 16 673 672 298 337 398 ) insert ( 682 '@' 11 10 l f f 0 21 21 0 0 1253 - - ) insert ( 684 '+' 11 10 b f f 20 20 20 684 0 463 - - ) insert ( 685 - 11 10 b f f 20 20 20 0 0 464 - - ) insert ( 686 '*' 11 10 b f f 20 20 20 686 0 465 - - ) insert ( 687 '/' 11 10 b f f 20 20 20 0 0 466 - - ) insert ( 688 '+' 11 10 b f f 20 23 20 692 0 1274 - - ) insert ( 689 - 11 10 b f f 20 23 20 0 0 1275 - - ) insert ( 690 '*' 11 10 b f f 20 23 20 694 0 1276 - - ) insert ( 691 '/' 11 10 b f f 20 23 20 0 0 1277 - - ) insert ( 692 '+' 11 10 b f f 23 20 20 688 0 1278 - - ) insert ( 693 - 11 10 b f f 23 20 20 0 0 1279 - - ) insert ( 694 '*' 11 10 b f f 23 20 20 690 0 1280 - - ) insert ( 695 '/' 11 10 b f f 23 20 20 0 0 1281 - - ) insert ( 818 '+' 11 10 b f f 20 21 20 822 0 837 - - ) insert ( 819 - 11 10 b f f 20 21 20 0 0 838 - - ) insert ( 820 '*' 11 10 b f f 20 21 20 824 0 839 - - ) insert ( 821 '/' 11 10 b f f 20 21 20 0 0 840 - - ) insert ( 822 '+' 11 10 b f f 21 20 20 818 0 841 - - ) insert ( 823 - 11 10 b f f 21 20 20 0 0 942 - - ) insert ( 824 '*' 11 10 b f f 21 20 20 820 0 943 - - ) insert ( 825 '/' 11 10 b f f 21 20 20 0 0 948 - - ) insert ( 706 '<->' 11 10 b f f 603 603 701 706 0 978 - - ) insert ( 707 '<->' 11 10 b f f 602 602 701 707 0 370 - - ) insert ( 708 '<->' 11 10 b f f 628 628 701 708 0 239 - - ) insert ( 709 '<->' 11 10 b f f 601 601 701 709 0 361 - - ) insert ( 712 '<->' 11 10 b f f 604 604 701 712 0 729 - - ) insert ( 713 '<>' 11 10 b f f 600 600 16 713 510 988 102 106 ) insert ( 731 '+' 11 10 b f f 600 600 600 731 0 1441 - - ) insert ( 732 - 11 10 b f f 600 600 600 0 0 1442 - - ) insert ( 733 '*' 11 10 b f f 600 600 600 733 0 1443 - - ) insert ( 734 '/' 11 10 b f f 600 600 600 0 0 1444 - - ) insert ( 735 '+' 11 10 b f f 602 602 602 735 0 1435 - - ) insert ( 736 '+' 11 10 b f f 602 600 602 0 0 1436 - - ) insert ( 737 - 11 10 b f f 602 600 602 0 0 1437 - - ) insert ( 738 '*' 11 10 b f f 602 600 602 0 0 1438 - - ) insert ( 739 '/' 11 10 b f f 602 600 602 0 0 1439 - - ) insert ( 755 '@>' 11 10 b f f 602 600 16 512 0 1426 - - ) insert ( 756 '<@' 11 10 b f f 600 604 16 757 0 1429 1302 1303 ) insert ( 757 '@>' 11 10 b f f 604 600 16 756 0 1428 1302 1303 ) insert ( 758 '<@' 11 10 b f f 600 718 16 759 0 1478 1302 1303 ) insert ( 759 '@>' 11 10 b f f 718 600 16 758 0 1477 1302 1303 ) insert ( 773 '@' 11 10 l f f 0 23 23 0 0 1251 - - ) insert ( 792 '=' 11 10 b f f 602 602 16 792 0 984 101 105 ) insert ( 793 '<' 11 10 b f f 602 602 16 794 0 982 - - ) insert ( 794 '>' 11 10 b f f 602 602 16 793 0 983 - - ) insert ( 795 '<=' 11 10 b f f 602 602 16 796 0 985 - - ) insert ( 796 '>=' 11 10 b f f 602 602 16 795 0 986 - - ) insert ( 797 '#' 11 10 l f f 0 602 23 0 0 1432 - - ) insert ( 798 '?#' 11 10 b f f 602 602 16 0 0 973 - - ) insert ( 799 '@-@' 11 10 l f f 0 602 701 0 0 987 - - ) insert ( 800 '>^' 11 10 b f f 603 603 16 0 0 115 1300 1301 ) insert ( 801 '<^' 11 10 b f f 603 603 16 0 0 116 1300 1301 ) insert ( 802 '?#' 11 10 b f f 603 603 16 0 0 125 139 140 ) insert ( 803 '#' 11 10 b f f 603 603 603 0 0 980 - - ) insert ( 804 '+' 11 10 b f f 603 600 603 0 0 1422 - - ) insert ( 805 - 11 10 b f f 603 600 603 0 0 1423 - - ) insert ( 806 '*' 11 10 b f f 603 600 603 0 0 1424 - - ) insert ( 807 '/' 11 10 b f f 603 600 603 0 0 1425 - - ) insert ( 808 '?-' 11 10 b f f 600 600 16 808 0 990 - - ) insert ( 809 '?|' 11 10 b f f 600 600 16 809 0 989 - - ) insert ( 843 '*' 11 10 b f f 790 700 790 845 0 846 - - ) insert ( 844 '/' 11 10 b f f 790 700 790 0 0 847 - - ) insert ( 845 '*' 11 10 b f f 700 790 790 843 0 848 - - ) insert ( 900 '=' 11 10 b t f 790 790 16 900 901 888 101 105 ) insert ( 901 '<>' 11 10 b f f 790 790 16 901 900 889 102 106 ) insert ( 902 '<' 11 10 b f f 790 790 16 903 905 890 103 107 ) insert ( 903 '>' 11 10 b f f 790 790 16 902 904 892 104 108 ) insert ( 904 '<=' 11 10 b f f 790 790 16 905 903 891 336 386 ) insert ( 905 '>=' 11 10 b f f 790 790 16 904 902 893 337 398 ) insert ( 906 '+' 11 10 b f f 790 790 790 906 0 894 - - ) insert ( 907 - 11 10 b f f 790 790 790 0 0 895 - - ) insert ( 908 '*' 11 10 b f f 790 701 790 916 0 896 - - ) insert ( 909 '/' 11 10 b f f 790 701 790 0 0 897 - - ) insert ( 3346 '*' 11 10 b f f 790 20 790 3349 0 3344 - - ) insert ( 3347 '/' 11 10 b f f 790 20 790 0 0 3345 - - ) insert ( 912 '*' 11 10 b f f 790 23 790 917 0 864 - - ) insert ( 913 '/' 11 10 b f f 790 23 790 0 0 865 - - ) insert ( 914 '*' 11 10 b f f 790 21 790 918 0 866 - - ) insert ( 915 '/' 11 10 b f f 790 21 790 0 0 867 - - ) insert ( 916 '*' 11 10 b f f 701 790 790 908 0 919 - - ) insert ( 3349 '*' 11 10 b f f 20 790 790 3346 0 3399 - - ) insert ( 917 '*' 11 10 b f f 23 790 790 912 0 862 - - ) insert ( 918 '*' 11 10 b f f 21 790 790 914 0 863 - - ) insert ( 3825 '/' 11 10 b f f 790 790 701 0 0 3822 - - ) insert ( 965 '^' 11 10 b f f 701 701 701 0 0 232 - - ) insert ( 966 '+' 11 10 b f f 1034 1033 1034 0 0 1035 - - ) insert ( 967 - 11 10 b f f 1034 1033 1034 0 0 1036 - - ) insert ( 968 '@>' 11 10 b f f 1034 1033 16 0 0 1037 - - ) insert ( 974 '=' 11 10 b f t 1033 1033 16 974 0 1062 101 105 ) insert ( 969 '@@' 11 10 l f f 0 601 600 0 0 225 - - ) insert ( 971 '@@' 11 10 l f f 0 604 600 0 0 227 - - ) insert ( 1054 '=' 11 10 b t t 1042 1042 16 1054 1057 1048 101 105 ) insert ( 1055 '~' 11 10 b f f 1042 25 16 0 1056 1658 1818 1824 ) insert ( 1056 '!~' 11 10 b f f 1042 25 16 0 1055 1659 1821 1827 ) insert ( 1057 '<>' 11 10 b f f 1042 1042 16 1057 1054 1053 102 106 ) insert ( 1058 '<' 11 10 b f f 1042 1042 16 1060 1061 1049 103 107 ) insert ( 1059 '<=' 11 10 b f f 1042 1042 16 1061 1060 1050 336 386 ) insert ( 1060 '>' 11 10 b f f 1042 1042 16 1058 1059 1051 104 108 ) insert ( 1061 '>=' 11 10 b f f 1042 1042 16 1059 1058 1052 337 398 ) insert ( 1070 '=' 11 10 b t t 2277 2277 16 1070 1071 744 101 105 ) insert ( 1071 '<>' 11 10 b f f 2277 2277 16 1071 1070 390 102 106 ) insert ( 1072 '<' 11 10 b f f 2277 2277 16 1073 1075 391 103 107 ) insert ( 1073 '>' 11 10 b f f 2277 2277 16 1072 1074 392 104 108 ) insert ( 1074 '<=' 11 10 b f f 2277 2277 16 1075 1073 393 336 386 ) insert ( 1075 '>=' 11 10 b f f 2277 2277 16 1074 1072 396 337 398 ) insert ( 1076 '+' 11 10 b f f 1082 1186 1114 2551 0 2071 - - ) insert ( 1077 - 11 10 b f f 1082 1186 1114 0 0 2072 - - ) insert ( 1093 '=' 11 10 b t t 1082 1082 16 1093 1094 1086 101 105 ) insert ( 1094 '<>' 11 10 b f f 1082 1082 16 1094 1093 1091 102 106 ) insert ( 1095 '<' 11 10 b f f 1082 1082 16 1097 1098 1087 103 107 ) insert ( 1096 '<=' 11 10 b f f 1082 1082 16 1098 1097 1088 336 386 ) insert ( 1097 '>' 11 10 b f f 1082 1082 16 1095 1096 1089 104 108 ) insert ( 1098 '>=' 11 10 b f f 1082 1082 16 1096 1095 1090 337 398 ) insert ( 1099 - 11 10 b f f 1082 1082 23 0 0 1140 - - ) insert ( 1100 '+' 11 10 b f f 1082 23 1082 2555 0 1141 - - ) insert ( 1101 - 11 10 b f f 1082 23 1082 0 0 1142 - - ) insert ( 1108 '=' 11 10 b t t 1083 1083 16 1108 1109 1145 101 105 ) insert ( 1109 '<>' 11 10 b f f 1083 1083 16 1109 1108 1106 102 106 ) insert ( 1110 '<' 11 10 b f f 1083 1083 16 1112 1113 1102 103 107 ) insert ( 1111 '<=' 11 10 b f f 1083 1083 16 1113 1112 1103 336 386 ) insert ( 1112 '>' 11 10 b f f 1083 1083 16 1110 1111 1104 104 108 ) insert ( 1113 '>=' 11 10 b f f 1083 1083 16 1111 1110 1105 337 398 ) insert ( 1550 '=' 11 10 b t t 1266 1266 16 1550 1551 1352 101 105 ) insert ( 1551 '<>' 11 10 b f f 1266 1266 16 1551 1550 1353 102 106 ) insert ( 1552 '<' 11 10 b f f 1266 1266 16 1554 1555 1354 103 107 ) insert ( 1553 '<=' 11 10 b f f 1266 1266 16 1555 1554 1355 336 386 ) insert ( 1554 '>' 11 10 b f f 1266 1266 16 1552 1553 1357 104 108 ) insert ( 1555 '>=' 11 10 b f f 1266 1266 16 1553 1552 1356 337 398 ) insert ( 1116 '+' 11 10 b f f 700 701 701 1126 0 281 - - ) insert ( 1117 - 11 10 b f f 700 701 701 0 0 282 - - ) insert ( 1118 '/' 11 10 b f f 700 701 701 0 0 280 - - ) insert ( 1119 '*' 11 10 b f f 700 701 701 1129 0 279 - - ) insert ( 1120 '=' 11 10 b t t 700 701 16 1130 1121 299 101 105 ) insert ( 1121 '<>' 11 10 b f f 700 701 16 1131 1120 300 102 106 ) insert ( 1122 '<' 11 10 b f f 700 701 16 1133 1125 301 103 107 ) insert ( 1123 '>' 11 10 b f f 700 701 16 1132 1124 303 104 108 ) insert ( 1124 '<=' 11 10 b f f 700 701 16 1135 1123 302 336 386 ) insert ( 1125 '>=' 11 10 b f f 700 701 16 1134 1122 304 337 398 ) insert ( 1126 '+' 11 10 b f f 701 700 701 1116 0 285 - - ) insert ( 1127 - 11 10 b f f 701 700 701 0 0 286 - - ) insert ( 1128 '/' 11 10 b f f 701 700 701 0 0 284 - - ) insert ( 1129 '*' 11 10 b f f 701 700 701 1119 0 283 - - ) insert ( 1130 '=' 11 10 b t t 701 700 16 1120 1131 305 101 105 ) insert ( 1131 '<>' 11 10 b f f 701 700 16 1121 1130 306 102 106 ) insert ( 1132 '<' 11 10 b f f 701 700 16 1123 1135 307 103 107 ) insert ( 1133 '>' 11 10 b f f 701 700 16 1122 1134 309 104 108 ) insert ( 1134 '<=' 11 10 b f f 701 700 16 1125 1133 308 336 386 ) insert ( 1135 '>=' 11 10 b f f 701 700 16 1124 1132 310 337 398 ) insert ( 1207 '~~' 11 10 b f f 19 25 16 0 1208 858 1819 1825 ) insert ( 1208 '!~~' 11 10 b f f 19 25 16 0 1207 859 1822 1828 ) insert ( 1209 '~~' 11 10 b f f 25 25 16 0 1210 850 1819 1825 ) insert ( 1210 '!~~' 11 10 b f f 25 25 16 0 1209 851 1822 1828 ) insert ( 1211 '~~' 11 10 b f f 1042 25 16 0 1212 1631 1819 1825 ) insert ( 1212 '!~~' 11 10 b f f 1042 25 16 0 1211 1632 1822 1828 ) insert ( 1226 '~*' 11 10 b f f 19 25 16 0 1227 1240 1820 1826 ) insert ( 1227 '!~*' 11 10 b f f 19 25 16 0 1226 1241 1823 1829 ) insert ( 1228 '~*' 11 10 b f f 25 25 16 0 1229 1238 1820 1826 ) insert ( 1229 '!~*' 11 10 b f f 25 25 16 0 1228 1239 1823 1829 ) insert ( 1234 '~*' 11 10 b f f 1042 25 16 0 1235 1656 1820 1826 ) insert ( 1235 '!~*' 11 10 b f f 1042 25 16 0 1234 1657 1823 1829 ) insert ( 1320 '=' 11 10 b t t 1184 1184 16 1320 1321 1152 101 105 ) insert ( 1321 '<>' 11 10 b f f 1184 1184 16 1321 1320 1153 102 106 ) insert ( 1322 '<' 11 10 b f f 1184 1184 16 1324 1325 1154 103 107 ) insert ( 1323 '<=' 11 10 b f f 1184 1184 16 1325 1324 1155 336 386 ) insert ( 1324 '>' 11 10 b f f 1184 1184 16 1322 1323 1157 104 108 ) insert ( 1325 '>=' 11 10 b f f 1184 1184 16 1323 1322 1156 337 398 ) insert ( 1327 '+' 11 10 b f f 1184 1186 1184 2554 0 1189 - - ) insert ( 1328 - 11 10 b f f 1184 1184 1186 0 0 1188 - - ) insert ( 1329 - 11 10 b f f 1184 1186 1184 0 0 1190 - - ) insert ( 1330 '=' 11 10 b t t 1186 1186 16 1330 1331 1162 101 105 ) insert ( 1331 '<>' 11 10 b f f 1186 1186 16 1331 1330 1163 102 106 ) insert ( 1332 '<' 11 10 b f f 1186 1186 16 1334 1335 1164 103 107 ) insert ( 1333 '<=' 11 10 b f f 1186 1186 16 1335 1334 1165 336 386 ) insert ( 1334 '>' 11 10 b f f 1186 1186 16 1332 1333 1167 104 108 ) insert ( 1335 '>=' 11 10 b f f 1186 1186 16 1333 1332 1166 337 398 ) insert ( 1336 - 11 10 l f f 0 1186 1186 0 0 1168 - - ) insert ( 1337 '+' 11 10 b f f 1186 1186 1186 1337 0 1169 - - ) insert ( 1338 - 11 10 b f f 1186 1186 1186 0 0 1170 - - ) insert ( 1360 '+' 11 10 b f f 1082 1083 1114 1363 0 1272 - - ) insert ( 1361 '+' 11 10 b f f 1082 1266 1184 1366 0 1297 - - ) insert ( 1363 '+' 11 10 b f f 1083 1082 1114 1360 0 1296 - - ) insert ( 1366 '+' 11 10 b f f 1266 1082 1184 1361 0 1298 - - ) insert ( 1399 - 11 10 b f f 1083 1083 1186 0 0 1690 - - ) insert ( 1420 '@@' 11 10 l f f 0 718 600 0 0 1472 - - ) insert ( 1500 '=' 11 10 b f f 718 718 16 1500 1501 1462 101 105 ) insert ( 1501 '<>' 11 10 b f f 718 718 16 1501 1500 1463 102 106 ) insert ( 1502 '<' 11 10 b f f 718 718 16 1503 1505 1464 139 140 ) insert ( 1503 '>' 11 10 b f f 718 718 16 1502 1504 1465 139 140 ) insert ( 1504 '<=' 11 10 b f f 718 718 16 1505 1503 1466 139 140 ) insert ( 1505 '>=' 11 10 b f f 718 718 16 1504 1502 1467 139 140 ) insert ( 1506 '<<' 11 10 b f f 718 718 16 0 0 1454 1300 1301 ) insert ( 1507 '&<' 11 10 b f f 718 718 16 0 0 1455 1300 1301 ) insert ( 1508 '&>' 11 10 b f f 718 718 16 0 0 1456 1300 1301 ) insert ( 1509 '>>' 11 10 b f f 718 718 16 0 0 1457 1300 1301 ) insert ( 1510 '<@' 11 10 b f f 718 718 16 1511 0 1458 1302 1303 ) insert ( 1511 '@>' 11 10 b f f 718 718 16 1510 0 1453 1302 1303 ) insert ( 1512 '~=' 11 10 b f f 718 718 16 1512 0 1452 101 105 ) insert ( 1513 '&&' 11 10 b f f 718 718 16 1513 0 1459 139 140 ) insert ( 1514 '|>>' 11 10 b f f 718 718 16 0 0 1461 1300 1301 ) insert ( 1515 '<<|' 11 10 b f f 718 718 16 0 0 1460 1300 1301 ) insert ( 1516 '+' 11 10 b f f 718 600 718 0 0 1146 - - ) insert ( 1517 - 11 10 b f f 718 600 718 0 0 1147 - - ) insert ( 1518 '*' 11 10 b f f 718 600 718 0 0 1148 - - ) insert ( 1519 '/' 11 10 b f f 718 600 718 0 0 1149 - - ) insert ( 1520 '<->' 11 10 b f f 718 718 701 1520 0 1471 - - ) insert ( 1521 '#' 11 10 l f f 0 604 23 0 0 1445 - - ) insert ( 1522 '<->' 11 10 b f f 600 718 701 3291 0 1476 - - ) insert ( 3291 '<->' 11 10 b f f 718 600 701 1522 0 3290 - - ) insert ( 3276 '<->' 11 10 b f f 600 604 701 3289 0 3275 - - ) insert ( 3289 '<->' 11 10 b f f 604 600 701 3276 0 3292 - - ) insert ( 1523 '<->' 11 10 b f f 718 604 701 1383 0 728 - - ) insert ( 1383 '<->' 11 10 b f f 604 718 701 1523 0 785 - - ) insert ( 1525 '?#' 11 10 b f f 601 601 16 1525 0 994 - - ) insert ( 1526 '?||' 11 10 b f f 601 601 16 1526 0 995 - - ) insert ( 1527 '?-|' 11 10 b f f 601 601 16 1527 0 996 - - ) insert ( 1528 '?-' 11 10 l f f 0 601 16 0 0 998 - - ) insert ( 1529 '?|' 11 10 l f f 0 601 16 0 0 997 - - ) insert ( 1535 '=' 11 10 b f f 601 601 16 1535 1586 999 101 105 ) insert ( 1536 '#' 11 10 b f f 601 601 600 1536 0 362 - - ) insert ( 1537 '?#' 11 10 b f f 601 628 16 0 0 277 - - ) insert ( 1538 '?#' 11 10 b f f 601 603 16 0 0 373 - - ) insert ( 1539 '?#' 11 10 b f f 628 603 16 0 0 278 - - ) insert ( 1546 '<@' 11 10 b f f 600 628 16 0 0 959 - - ) insert ( 1547 '<@' 11 10 b f f 600 601 16 0 0 369 - - ) insert ( 1548 '<@' 11 10 b f f 601 628 16 0 0 960 - - ) insert ( 1549 '<@' 11 10 b f f 601 603 16 0 0 372 - - ) insert ( 1557 '##' 11 10 b f f 600 628 600 0 0 961 - - ) insert ( 1558 '##' 11 10 b f f 600 601 600 0 0 366 - - ) insert ( 1559 '##' 11 10 b f f 600 603 600 0 0 367 - - ) insert ( 1567 '##' 11 10 b f f 601 603 600 0 0 368 - - ) insert ( 1577 '##' 11 10 b f f 628 601 600 0 0 1488 - - ) insert ( 1578 '##' 11 10 b f f 601 601 600 0 0 1489 - - ) insert ( 1583 '*' 11 10 b f f 1186 701 1186 1584 0 1618 - - ) insert ( 1584 '*' 11 10 b f f 701 1186 1186 1583 0 1624 - - ) insert ( 1585 '/' 11 10 b f f 1186 701 1186 0 0 1326 - - ) insert ( 1586 '<>' 11 10 b f f 601 601 16 1586 1535 1482 102 106 ) insert ( 1587 '<' 11 10 b f f 601 601 16 1589 1590 1483 - - ) insert ( 1588 '<=' 11 10 b f f 601 601 16 1590 1589 1484 - - ) insert ( 1589 '>' 11 10 b f f 601 601 16 1587 1588 1485 - - ) insert ( 1590 '>=' 11 10 b f f 601 601 16 1588 1587 1486 - - ) insert ( 1591 '@-@' 11 10 l f f 0 601 701 0 0 1487 - - ) insert ( 1611 '?#' 11 10 b f f 628 628 16 1611 0 1495 - - ) insert ( 1612 '?||' 11 10 b f f 628 628 16 1612 0 1496 - - ) insert ( 1613 '?-|' 11 10 b f f 628 628 16 1613 0 1497 - - ) insert ( 1614 '?-' 11 10 l f f 0 628 16 0 0 1499 - - ) insert ( 1615 '?|' 11 10 l f f 0 628 16 0 0 1498 - - ) insert ( 1616 '=' 11 10 b f f 628 628 16 1616 0 1492 101 105 ) insert ( 1617 '#' 11 10 b f f 628 628 600 1617 0 1494 - - ) insert ( 4161 '|>>' 11 10 b f f 600 600 16 0 0 131 1300 1301 ) insert ( 4162 '<<|' 11 10 b f f 600 600 16 0 0 134 1300 1301 ) insert ( 1220 '=' 11 10 b t t 829 829 16 1220 1221 830 101 105 ) insert ( 1221 '<>' 11 10 b f f 829 829 16 1221 1220 835 102 106 ) insert ( 1222 '<' 11 10 b f f 829 829 16 1224 1225 831 103 107 ) insert ( 1223 '<=' 11 10 b f f 829 829 16 1225 1224 832 336 386 ) insert ( 1224 '>' 11 10 b f f 829 829 16 1222 1223 833 104 108 ) insert ( 1225 '>=' 11 10 b f f 829 829 16 1223 1222 834 337 398 ) insert ( 3147 '~' 11 10 l f f 0 829 829 0 0 3144 - - ) insert ( 3148 '&' 11 10 b f f 829 829 829 0 0 3145 - - ) insert ( 3149 '|' 11 10 b f f 829 829 829 0 0 3146 - - ) insert ( 3362 '=' 11 10 b t t 774 774 16 3362 3363 4113 101 105 ) insert ( 3363 '<>' 11 10 b f f 774 774 16 3363 3362 4118 102 106 ) insert ( 3364 '<' 11 10 b f f 774 774 16 3366 3367 4114 103 107 ) insert ( 3365 '<=' 11 10 b f f 774 774 16 3367 3366 4115 336 386 ) insert ( 3366 '>' 11 10 b f f 774 774 16 3364 3365 4116 104 108 ) insert ( 3367 '>=' 11 10 b f f 774 774 16 3365 3364 4117 337 398 ) insert ( 3368 '~' 11 10 l f f 0 774 774 0 0 4120 - - ) insert ( 3369 '&' 11 10 b f f 774 774 774 0 0 4121 - - ) insert ( 3370 '|' 11 10 b f f 774 774 774 0 0 4122 - - ) insert ( 1201 '=' 11 10 b t t 869 869 16 1201 1202 920 101 105 ) insert ( 1202 '<>' 11 10 b f f 869 869 16 1202 1201 925 102 106 ) insert ( 1203 '<' 11 10 b f f 869 869 16 1205 1206 921 103 107 ) insert ( 1204 '<=' 11 10 b f f 869 869 16 1206 1205 922 336 386 ) insert ( 1205 '>' 11 10 b f f 869 869 16 1203 1204 923 104 108 ) insert ( 1206 '>=' 11 10 b f f 869 869 16 1204 1203 924 337 398 ) insert ( 931 '<<' 11 10 b f f 869 869 16 933 0 927 3560 3561 ) insert ( 932 '<<=' 11 10 b f f 869 869 16 934 0 928 3560 3561 ) insert ( 933 '>>' 11 10 b f f 869 869 16 931 0 929 3560 3561 ) insert ( 934 '>>=' 11 10 b f f 869 869 16 932 0 930 3560 3561 ) insert ( 3552 '&&' 11 10 b f f 869 869 16 3552 0 3551 3560 3561 ) insert ( 2634 '~' 11 10 l f f 0 869 869 0 0 2627 - - ) insert ( 2635 '&' 11 10 b f f 869 869 869 0 0 2628 - - ) insert ( 2636 '|' 11 10 b f f 869 869 869 0 0 2629 - - ) insert ( 2637 '+' 11 10 b f f 869 20 869 2638 0 2630 - - ) insert ( 2638 '+' 11 10 b f f 20 869 869 2637 0 2631 - - ) insert ( 2639 - 11 10 b f f 869 20 869 0 0 2632 - - ) insert ( 2640 - 11 10 b f f 869 869 20 0 0 2633 - - ) insert ( 1625 '~~*' 11 10 b f f 19 25 16 0 1626 1635 1814 1816 ) insert ( 1626 '!~~*' 11 10 b f f 19 25 16 0 1625 1636 1815 1817 ) insert ( 1627 '~~*' 11 10 b f f 25 25 16 0 1628 1633 1814 1816 ) insert ( 1628 '!~~*' 11 10 b f f 25 25 16 0 1627 1634 1815 1817 ) insert ( 1629 '~~*' 11 10 b f f 1042 25 16 0 1630 1660 1814 1816 ) insert ( 1630 '!~~*' 11 10 b f f 1042 25 16 0 1629 1661 1815 1817 ) insert ( 1751 - 11 10 l f f 0 1700 1700 0 0 1771 - - ) insert ( 1752 '=' 11 10 b t t 1700 1700 16 1752 1753 1718 101 105 ) insert ( 1753 '<>' 11 10 b f f 1700 1700 16 1753 1752 1719 102 106 ) insert ( 1754 '<' 11 10 b f f 1700 1700 16 1756 1757 1722 103 107 ) insert ( 1755 '<=' 11 10 b f f 1700 1700 16 1757 1756 1723 336 386 ) insert ( 1756 '>' 11 10 b f f 1700 1700 16 1754 1755 1720 104 108 ) insert ( 1757 '>=' 11 10 b f f 1700 1700 16 1755 1754 1721 337 398 ) insert ( 1758 '+' 11 10 b f f 1700 1700 1700 1758 0 1724 - - ) insert ( 1759 - 11 10 b f f 1700 1700 1700 0 0 1725 - - ) insert ( 1760 '*' 11 10 b f f 1700 1700 1700 1760 0 1726 - - ) insert ( 1761 '/' 11 10 b f f 1700 1700 1700 0 0 1727 - - ) insert ( 1762 '%' 11 10 b f f 1700 1700 1700 0 0 1729 - - ) insert ( 1038 '^' 11 10 b f f 1700 1700 1700 0 0 1739 - - ) insert ( 1763 '@' 11 10 l f f 0 1700 1700 0 0 1704 - - ) insert ( 1784 '=' 11 10 b t f 1560 1560 16 1784 1785 1581 101 105 ) insert ( 1785 '<>' 11 10 b f f 1560 1560 16 1785 1784 1582 102 106 ) insert ( 1786 '<' 11 10 b f f 1560 1560 16 1787 1789 1595 103 107 ) insert ( 1787 '>' 11 10 b f f 1560 1560 16 1786 1788 1593 104 108 ) insert ( 1788 '<=' 11 10 b f f 1560 1560 16 1789 1787 1594 336 386 ) insert ( 1789 '>=' 11 10 b f f 1560 1560 16 1788 1786 1592 337 398 ) insert ( 1791 '&' 11 10 b f f 1560 1560 1560 1791 0 1673 - - ) insert ( 1792 '|' 11 10 b f f 1560 1560 1560 1792 0 1674 - - ) insert ( 1793 '#' 11 10 b f f 1560 1560 1560 1793 0 1675 - - ) insert ( 1794 '~' 11 10 l f f 0 1560 1560 0 0 1676 - - ) insert ( 1795 '<<' 11 10 b f f 1560 23 1560 0 0 1677 - - ) insert ( 1796 '>>' 11 10 b f f 1560 23 1560 0 0 1678 - - ) insert ( 1797 '||' 11 10 b f f 1562 1562 1562 0 0 1679 - - ) insert ( 1800 '+' 11 10 b f f 1083 1186 1083 1849 0 1747 - - ) insert ( 1801 - 11 10 b f f 1083 1186 1083 0 0 1748 - - ) insert ( 1802 '+' 11 10 b f f 1266 1186 1266 2552 0 1749 - - ) insert ( 1803 - 11 10 b f f 1266 1186 1266 0 0 1750 - - ) insert ( 1804 '=' 11 10 b t f 1562 1562 16 1804 1805 1666 101 105 ) insert ( 1805 '<>' 11 10 b f f 1562 1562 16 1805 1804 1667 102 106 ) insert ( 1806 '<' 11 10 b f f 1562 1562 16 1807 1809 1671 103 107 ) insert ( 1807 '>' 11 10 b f f 1562 1562 16 1806 1808 1669 104 108 ) insert ( 1808 '<=' 11 10 b f f 1562 1562 16 1809 1807 1670 336 386 ) insert ( 1809 '>=' 11 10 b f f 1562 1562 16 1808 1806 1668 337 398 ) insert ( 1849 '+' 11 10 b f f 1186 1083 1083 1800 0 1848 - - ) insert ( 1862 '=' 11 10 b t t 21 20 16 1868 1863 1850 101 105 ) insert ( 1863 '<>' 11 10 b f f 21 20 16 1869 1862 1851 102 106 ) insert ( 1864 '<' 11 10 b f f 21 20 16 1871 1867 1852 103 107 ) insert ( 1865 '>' 11 10 b f f 21 20 16 1870 1866 1853 104 108 ) insert ( 1866 '<=' 11 10 b f f 21 20 16 1873 1865 1854 336 386 ) insert ( 1867 '>=' 11 10 b f f 21 20 16 1872 1864 1855 337 398 ) insert ( 1868 '=' 11 10 b t t 20 21 16 1862 1869 1856 101 105 ) insert ( 1869 '<>' 11 10 b f f 20 21 16 1863 1868 1857 102 106 ) insert ( 1870 '<' 11 10 b f f 20 21 16 1865 1873 1858 103 107 ) insert ( 1871 '>' 11 10 b f f 20 21 16 1864 1872 1859 104 108 ) insert ( 1872 '<=' 11 10 b f f 20 21 16 1867 1871 1860 336 386 ) insert ( 1873 '>=' 11 10 b f f 20 21 16 1866 1870 1861 337 398 ) insert ( 1874 '&' 11 10 b f f 21 21 21 1874 0 1892 - - ) insert ( 1875 '|' 11 10 b f f 21 21 21 1875 0 1893 - - ) insert ( 1876 '#' 11 10 b f f 21 21 21 1876 0 1894 - - ) insert ( 1877 '~' 11 10 l f f 0 21 21 0 0 1895 - - ) insert ( 1878 '<<' 11 10 b f f 21 23 21 0 0 1896 - - ) insert ( 1879 '>>' 11 10 b f f 21 23 21 0 0 1897 - - ) insert ( 1880 '&' 11 10 b f f 23 23 23 1880 0 1898 - - ) insert ( 1881 '|' 11 10 b f f 23 23 23 1881 0 1899 - - ) insert ( 1882 '#' 11 10 b f f 23 23 23 1882 0 1900 - - ) insert ( 1883 '~' 11 10 l f f 0 23 23 0 0 1901 - - ) insert ( 1884 '<<' 11 10 b f f 23 23 23 0 0 1902 - - ) insert ( 1885 '>>' 11 10 b f f 23 23 23 0 0 1903 - - ) insert ( 1886 '&' 11 10 b f f 20 20 20 1886 0 1904 - - ) insert ( 1887 '|' 11 10 b f f 20 20 20 1887 0 1905 - - ) insert ( 1888 '#' 11 10 b f f 20 20 20 1888 0 1906 - - ) insert ( 1889 '~' 11 10 l f f 0 20 20 0 0 1907 - - ) insert ( 1890 '<<' 11 10 b f f 20 23 20 0 0 1908 - - ) insert ( 1891 '>>' 11 10 b f f 20 23 20 0 0 1909 - - ) insert ( 1916 '+' 11 10 l f f 0 20 20 0 0 1910 - - ) insert ( 1917 '+' 11 10 l f f 0 21 21 0 0 1911 - - ) insert ( 1918 '+' 11 10 l f f 0 23 23 0 0 1912 - - ) insert ( 1919 '+' 11 10 l f f 0 700 700 0 0 1913 - - ) insert ( 1920 '+' 11 10 l f f 0 701 701 0 0 1914 - - ) insert ( 1921 '+' 11 10 l f f 0 1700 1700 0 0 1915 - - ) insert ( 1955 '=' 11 10 b t t 17 17 16 1955 1956 1948 101 105 ) insert ( 1956 '<>' 11 10 b f f 17 17 16 1956 1955 1953 102 106 ) insert ( 1957 '<' 11 10 b f f 17 17 16 1959 1960 1949 103 107 ) insert ( 1958 '<=' 11 10 b f f 17 17 16 1960 1959 1950 336 386 ) insert ( 1959 '>' 11 10 b f f 17 17 16 1957 1958 1951 104 108 ) insert ( 1960 '>=' 11 10 b f f 17 17 16 1958 1957 1952 337 398 ) insert ( 2016 '~~' 11 10 b f f 17 17 16 0 2017 2005 1819 1825 ) insert ( 2017 '!~~' 11 10 b f f 17 17 16 0 2016 2006 1822 1828 ) insert ( 2018 '||' 11 10 b f f 17 17 17 0 0 2011 - - ) insert ( 2060 '=' 11 10 b t t 1114 1114 16 2060 2061 2052 101 105 ) insert ( 2061 '<>' 11 10 b f f 1114 1114 16 2061 2060 2053 102 106 ) insert ( 2062 '<' 11 10 b f f 1114 1114 16 2064 2065 2054 103 107 ) insert ( 2063 '<=' 11 10 b f f 1114 1114 16 2065 2064 2055 336 386 ) insert ( 2064 '>' 11 10 b f f 1114 1114 16 2062 2063 2057 104 108 ) insert ( 2065 '>=' 11 10 b f f 1114 1114 16 2063 2062 2056 337 398 ) insert ( 2066 '+' 11 10 b f f 1114 1186 1114 2553 0 2032 - - ) insert ( 2067 - 11 10 b f f 1114 1114 1186 0 0 2031 - - ) insert ( 2068 - 11 10 b f f 1114 1186 1114 0 0 2033 - - ) insert ( 2314 '~<~' 11 10 b f f 25 25 16 2318 2317 2160 103 107 ) insert ( 2315 '~<=~' 11 10 b f f 25 25 16 2317 2318 2161 336 386 ) insert ( 2317 '~>=~' 11 10 b f f 25 25 16 2315 2314 2163 337 398 ) insert ( 2318 '~>~' 11 10 b f f 25 25 16 2314 2315 2164 104 108 ) insert ( 2326 '~<~' 11 10 b f f 1042 1042 16 2330 2329 2174 103 107 ) insert ( 2327 '~<=~' 11 10 b f f 1042 1042 16 2329 2330 2175 336 386 ) insert ( 2329 '~>=~' 11 10 b f f 1042 1042 16 2327 2326 2177 337 398 ) insert ( 2330 '~>~' 11 10 b f f 1042 1042 16 2326 2327 2178 104 108 ) insert ( 2345 '<' 11 10 b f f 1082 1114 16 2375 2348 2338 103 107 ) insert ( 2346 '<=' 11 10 b f f 1082 1114 16 2374 2349 2339 336 386 ) insert ( 2347 '=' 11 10 b t f 1082 1114 16 2373 2350 2340 101 105 ) insert ( 2348 '>=' 11 10 b f f 1082 1114 16 2372 2345 2342 337 398 ) insert ( 2349 '>' 11 10 b f f 1082 1114 16 2371 2346 2341 104 108 ) insert ( 2350 '<>' 11 10 b f f 1082 1114 16 2376 2347 2343 102 106 ) insert ( 2358 '<' 11 10 b f f 1082 1184 16 2388 2361 2351 103 107 ) insert ( 2359 '<=' 11 10 b f f 1082 1184 16 2387 2362 2352 336 386 ) insert ( 2360 '=' 11 10 b t f 1082 1184 16 2386 2363 2353 101 105 ) insert ( 2361 '>=' 11 10 b f f 1082 1184 16 2385 2358 2355 337 398 ) insert ( 2362 '>' 11 10 b f f 1082 1184 16 2384 2359 2354 104 108 ) insert ( 2363 '<>' 11 10 b f f 1082 1184 16 2389 2360 2356 102 106 ) insert ( 2371 '<' 11 10 b f f 1114 1082 16 2349 2374 2364 103 107 ) insert ( 2372 '<=' 11 10 b f f 1114 1082 16 2348 2375 2365 336 386 ) insert ( 2373 '=' 11 10 b t f 1114 1082 16 2347 2376 2366 101 105 ) insert ( 2374 '>=' 11 10 b f f 1114 1082 16 2346 2371 2368 337 398 ) insert ( 2375 '>' 11 10 b f f 1114 1082 16 2345 2372 2367 104 108 ) insert ( 2376 '<>' 11 10 b f f 1114 1082 16 2350 2373 2369 102 106 ) insert ( 2384 '<' 11 10 b f f 1184 1082 16 2362 2387 2377 103 107 ) insert ( 2385 '<=' 11 10 b f f 1184 1082 16 2361 2388 2378 336 386 ) insert ( 2386 '=' 11 10 b t f 1184 1082 16 2360 2389 2379 101 105 ) insert ( 2387 '>=' 11 10 b f f 1184 1082 16 2359 2384 2381 337 398 ) insert ( 2388 '>' 11 10 b f f 1184 1082 16 2358 2385 2380 104 108 ) insert ( 2389 '<>' 11 10 b f f 1184 1082 16 2363 2386 2382 102 106 ) insert ( 2534 '<' 11 10 b f f 1114 1184 16 2544 2537 2520 103 107 ) insert ( 2535 '<=' 11 10 b f f 1114 1184 16 2543 2538 2521 336 386 ) insert ( 2536 '=' 11 10 b t f 1114 1184 16 2542 2539 2522 101 105 ) insert ( 2537 '>=' 11 10 b f f 1114 1184 16 2541 2534 2524 337 398 ) insert ( 2538 '>' 11 10 b f f 1114 1184 16 2540 2535 2523 104 108 ) insert ( 2539 '<>' 11 10 b f f 1114 1184 16 2545 2536 2525 102 106 ) insert ( 2540 '<' 11 10 b f f 1184 1114 16 2538 2543 2527 103 107 ) insert ( 2541 '<=' 11 10 b f f 1184 1114 16 2537 2544 2528 336 386 ) insert ( 2542 '=' 11 10 b t f 1184 1114 16 2536 2545 2529 101 105 ) insert ( 2543 '>=' 11 10 b f f 1184 1114 16 2535 2540 2531 337 398 ) insert ( 2544 '>' 11 10 b f f 1184 1114 16 2534 2541 2530 104 108 ) insert ( 2545 '<>' 11 10 b f f 1184 1114 16 2539 2542 2532 102 106 ) insert ( 2551 '+' 11 10 b f f 1186 1082 1114 1076 0 2546 - - ) insert ( 2552 '+' 11 10 b f f 1186 1266 1266 1802 0 2547 - - ) insert ( 2553 '+' 11 10 b f f 1186 1114 1114 2066 0 2548 - - ) insert ( 2554 '+' 11 10 b f f 1186 1184 1184 1327 0 2549 - - ) insert ( 2555 '+' 11 10 b f f 23 1082 1082 1100 0 2550 - - ) insert ( 2570 '<<|' 11 10 b f f 603 603 16 0 0 2562 1300 1301 ) insert ( 2571 '&<|' 11 10 b f f 603 603 16 0 0 2563 1300 1301 ) insert ( 2572 '|&>' 11 10 b f f 603 603 16 0 0 2564 1300 1301 ) insert ( 2573 '|>>' 11 10 b f f 603 603 16 0 0 2565 1300 1301 ) insert ( 2574 '<<|' 11 10 b f f 604 604 16 0 0 2566 1300 1301 ) insert ( 2575 '&<|' 11 10 b f f 604 604 16 0 0 2567 1300 1301 ) insert ( 2576 '|&>' 11 10 b f f 604 604 16 0 0 2568 1300 1301 ) insert ( 2577 '|>>' 11 10 b f f 604 604 16 0 0 2569 1300 1301 ) insert ( 2589 '&<|' 11 10 b f f 718 718 16 0 0 2587 1300 1301 ) insert ( 2590 '|&>' 11 10 b f f 718 718 16 0 0 2588 1300 1301 ) insert ( 2750 '&&' 11 10 b f f 2277 2277 16 2750 0 2747 3817 3818 ) insert ( 2751 '@>' 11 10 b f f 2277 2277 16 2752 0 2748 3817 3818 ) insert ( 2752 '<@' 11 10 b f f 2277 2277 16 2751 0 2749 3817 3818 ) insert ( 2779 '||' 11 10 b f f 25 2776 25 0 0 2003 - - ) insert ( 2780 '||' 11 10 b f f 2776 25 25 0 0 2004 - - ) insert ( 2972 '=' 11 10 b t t 2950 2950 16 2972 2973 2956 101 105 ) insert ( 2973 '<>' 11 10 b f f 2950 2950 16 2973 2972 2959 102 106 ) insert ( 2974 '<' 11 10 b f f 2950 2950 16 2975 2977 2954 103 107 ) insert ( 2975 '>' 11 10 b f f 2950 2950 16 2974 2976 2958 104 108 ) insert ( 2976 '<=' 11 10 b f f 2950 2950 16 2977 2975 2955 336 386 ) insert ( 2977 '>=' 11 10 b f f 2950 2950 16 2976 2974 2957 337 398 ) insert ( 3222 '=' 11 10 b t t 3220 3220 16 3222 3223 3233 101 105 ) insert ( 3223 '<>' 11 10 b f f 3220 3220 16 3223 3222 3236 102 106 ) insert ( 3224 '<' 11 10 b f f 3220 3220 16 3225 3227 3231 103 107 ) insert ( 3225 '>' 11 10 b f f 3220 3220 16 3224 3226 3235 104 108 ) insert ( 3226 '<=' 11 10 b f f 3220 3220 16 3227 3225 3232 336 386 ) insert ( 3227 '>=' 11 10 b f f 3220 3220 16 3226 3224 3234 337 398 ) insert ( 3228 - 11 10 b f f 3220 3220 1700 0 0 3237 - - ) insert ( 5025 '+' 11 10 b f f 3220 1700 3220 5026 0 5022 - - ) insert ( 5026 '+' 11 10 b f f 1700 3220 3220 5025 0 5023 - - ) insert ( 5027 - 11 10 b f f 3220 1700 3220 0 0 5024 - - ) insert ( 3516 '=' 11 10 b t t 3500 3500 16 3516 3517 3508 101 105 ) insert ( 3517 '<>' 11 10 b f f 3500 3500 16 3517 3516 3509 102 106 ) insert ( 3518 '<' 11 10 b f f 3500 3500 16 3519 3521 3510 103 107 ) insert ( 3519 '>' 11 10 b f f 3500 3500 16 3518 3520 3511 104 108 ) insert ( 3520 '<=' 11 10 b f f 3500 3500 16 3521 3519 3512 336 386 ) insert ( 3521 '>=' 11 10 b f f 3500 3500 16 3520 3518 3513 337 398 ) insert ( 3627 '<' 11 10 b f f 3614 3614 16 3632 3631 3616 103 107 ) insert ( 3628 '<=' 11 10 b f f 3614 3614 16 3631 3632 3617 336 386 ) insert ( 3629 '=' 11 10 b t f 3614 3614 16 3629 3630 3618 101 105 ) insert ( 3630 '<>' 11 10 b f f 3614 3614 16 3630 3629 3619 102 106 ) insert ( 3631 '>=' 11 10 b f f 3614 3614 16 3628 3627 3620 337 398 ) insert ( 3632 '>' 11 10 b f f 3614 3614 16 3627 3628 3621 104 108 ) insert ( 3633 '||' 11 10 b f f 3614 3614 3614 0 0 3625 - - ) insert ( 3636 '@@' 11 10 b f f 3614 3615 16 3637 0 3634 3686 3687 ) insert ( 3637 '@@' 11 10 b f f 3615 3614 16 3636 0 3635 3686 3687 ) insert ( 3660 '@@@' 11 10 b f f 3614 3615 16 3661 0 3634 3686 3687 ) insert ( 3661 '@@@' 11 10 b f f 3615 3614 16 3660 0 3635 3686 3687 ) insert ( 3674 '<' 11 10 b f f 3615 3615 16 3679 3678 3662 103 107 ) insert ( 3675 '<=' 11 10 b f f 3615 3615 16 3678 3679 3663 336 386 ) insert ( 3676 '=' 11 10 b t f 3615 3615 16 3676 3677 3664 101 105 ) insert ( 3677 '<>' 11 10 b f f 3615 3615 16 3677 3676 3665 102 106 ) insert ( 3678 '>=' 11 10 b f f 3615 3615 16 3675 3674 3666 337 398 ) insert ( 3679 '>' 11 10 b f f 3615 3615 16 3674 3675 3667 104 108 ) insert ( 3680 '&&' 11 10 b f f 3615 3615 3615 0 0 3669 - - ) insert ( 3681 '||' 11 10 b f f 3615 3615 3615 0 0 3670 - - ) insert ( 5005 '<->' 11 10 b f f 3615 3615 3615 0 0 5003 - - ) insert ( 3682 '!!' 11 10 l f f 0 3615 3615 0 0 3671 - - ) insert ( 3693 '@>' 11 10 b f f 3615 3615 16 3694 0 3691 5040 5041 ) insert ( 3694 '<@' 11 10 b f f 3615 3615 16 3693 0 3692 5040 5041 ) insert ( 3762 '@@' 11 10 b f f 25 25 16 0 0 3760 5040 5041 ) insert ( 3763 '@@' 11 10 b f f 25 3615 16 0 0 3761 5040 5041 ) insert ( 2988 '=' 11 10 b t t 2249 2249 16 2988 2989 2981 101 105 ) insert ( 2989 '<>' 11 10 b f f 2249 2249 16 2989 2988 2982 102 106 ) insert ( 2990 '<' 11 10 b f f 2249 2249 16 2991 2993 2983 103 107 ) insert ( 2991 '>' 11 10 b f f 2249 2249 16 2990 2992 2984 104 108 ) insert ( 2992 '<=' 11 10 b f f 2249 2249 16 2993 2991 2985 336 386 ) insert ( 2993 '>=' 11 10 b f f 2249 2249 16 2992 2990 2986 337 398 ) insert ( 3188 '*=' 11 10 b t f 2249 2249 16 3188 3189 3181 101 105 ) insert ( 3189 '*<>' 11 10 b f f 2249 2249 16 3189 3188 3182 102 106 ) insert ( 3190 '*<' 11 10 b f f 2249 2249 16 3191 3193 3183 103 107 ) insert ( 3191 '*>' 11 10 b f f 2249 2249 16 3190 3192 3184 104 108 ) insert ( 3192 '*<=' 11 10 b f f 2249 2249 16 3193 3191 3185 336 386 ) insert ( 3193 '*>=' 11 10 b f f 2249 2249 16 3192 3190 3186 337 398 ) insert ( 3882 '=' 11 10 b t t 3831 3831 16 3882 3883 3855 101 105 ) insert ( 3883 '<>' 11 10 b f f 3831 3831 16 3883 3882 3856 102 106 ) insert ( 3884 '<' 11 10 b f f 3831 3831 16 3887 3886 3871 3169 107 ) insert ( 3885 '<=' 11 10 b f f 3831 3831 16 3886 3887 3872 3169 386 ) insert ( 3886 '>=' 11 10 b f f 3831 3831 16 3885 3884 3873 3169 398 ) insert ( 3887 '>' 11 10 b f f 3831 3831 16 3884 3885 3874 3169 108 ) insert ( 3888 '&&' 11 10 b f f 3831 3831 16 3888 0 3857 3169 140 ) insert ( 3889 '@>' 11 10 b f f 3831 2283 16 3891 0 3858 3169 1303 ) insert ( 3890 '@>' 11 10 b f f 3831 3831 16 3892 0 3859 3169 1303 ) insert ( 3891 '<@' 11 10 b f f 2283 3831 16 3889 0 3860 3169 1303 ) insert ( 3892 '<@' 11 10 b f f 3831 3831 16 3890 0 3861 3169 1303 ) insert ( 3893 '<<' 11 10 b f f 3831 3831 16 3894 0 3863 3169 107 ) insert ( 3894 '>>' 11 10 b f f 3831 3831 16 3893 0 3864 3169 108 ) insert ( 3895 '&<' 11 10 b f f 3831 3831 16 0 0 3865 3169 107 ) insert ( 3896 '&>' 11 10 b f f 3831 3831 16 0 0 3866 3169 108 ) insert ( 3897 '-|-' 11 10 b f f 3831 3831 16 3897 0 3862 5040 5041 ) insert ( 3898 '+' 11 10 b f f 3831 3831 3831 3898 0 3867 - - ) insert ( 3899 - 11 10 b f f 3831 3831 3831 0 0 3869 - - ) insert ( 3900 '*' 11 10 b f f 3831 3831 3831 3900 0 3868 - - ) insert ( 3962 '->' 11 10 b f f 114 25 114 0 0 3947 - - ) insert ( 3963 '->>' 11 10 b f f 114 25 25 0 0 3948 - - ) insert ( 3964 '->' 11 10 b f f 114 23 114 0 0 3949 - - ) insert ( 3965 '->>' 11 10 b f f 114 23 25 0 0 3950 - - ) insert ( 3966 '#>' 11 10 b f f 114 1009 114 0 0 3951 - - ) insert ( 3967 '#>>' 11 10 b f f 114 1009 25 0 0 3953 - - ) insert ( 3211 '->' 11 10 b f f 3802 25 3802 0 0 3478 - - ) insert ( 3477 '->>' 11 10 b f f 3802 25 25 0 0 3214 - - ) insert ( 3212 '->' 11 10 b f f 3802 23 3802 0 0 3215 - - ) insert ( 3481 '->>' 11 10 b f f 3802 23 25 0 0 3216 - - ) insert ( 3213 '#>' 11 10 b f f 3802 1009 3802 0 0 3217 - - ) insert ( 3206 '#>>' 11 10 b f f 3802 1009 25 0 0 3940 - - ) insert ( 3240 '=' 11 10 b t t 3802 3802 16 3240 3241 4043 101 105 ) insert ( 3241 '<>' 11 10 b f f 3802 3802 16 3241 3240 4038 102 106 ) insert ( 3242 '<' 11 10 b f f 3802 3802 16 3243 3245 4039 103 107 ) insert ( 3243 '>' 11 10 b f f 3802 3802 16 3242 3244 4040 104 108 ) insert ( 3244 '<=' 11 10 b f f 3802 3802 16 3245 3243 4041 336 386 ) insert ( 3245 '>=' 11 10 b f f 3802 3802 16 3244 3242 4042 337 398 ) insert ( 3246 '@>' 11 10 b f f 3802 3802 16 3250 0 4046 5040 5041 ) insert ( 3247 '?' 11 10 b f f 3802 25 16 0 0 4047 5040 5041 ) insert ( 3248 '?|' 11 10 b f f 3802 1009 16 0 0 4048 5040 5041 ) insert ( 3249 '?&' 11 10 b f f 3802 1009 16 0 0 4049 5040 5041 ) insert ( 3250 '<@' 11 10 b f f 3802 3802 16 3246 0 4050 5040 5041 ) insert ( 3284 '||' 11 10 b f f 3802 3802 3802 0 0 3301 - - ) insert ( 3285 - 11 10 b f f 3802 25 3802 0 0 3302 - - ) insert ( 3398 - 11 10 b f f 3802 1009 3802 0 0 3343 - - ) insert ( 3286 - 11 10 b f f 3802 23 3802 0 0 3303 - - ) insert ( 3287 '#-' 11 10 b f f 3802 1009 3802 0 0 3304 - - ) insert ( 4012 '@?' 11 10 b f f 3802 4072 16 0 0 4010 5040 5041 ) insert ( 4013 '@@' 11 10 b f f 3802 4072 16 0 0 4011 5040 5041 ) insert ( 2860 '=' 11 10 b t t 4537 4537 16 2860 2861 4244 101 105 ) insert ( 2861 '<>' 11 10 b f f 4537 4537 16 2861 2860 4245 102 106 ) insert ( 2862 '<' 11 10 b f f 4537 4537 16 2865 2864 4274 4243 107 ) insert ( 2863 '<=' 11 10 b f f 4537 4537 16 2864 2865 4275 4243 386 ) insert ( 2864 '>=' 11 10 b f f 4537 4537 16 2863 2862 4276 4243 398 ) insert ( 2865 '>' 11 10 b f f 4537 4537 16 2862 2863 4277 4243 108 ) insert ( 2866 '&&' 11 10 b f f 3831 4537 16 2867 0 4246 4243 140 ) insert ( 2867 '&&' 11 10 b f f 4537 3831 16 2866 0 4247 4243 140 ) insert ( 2868 '&&' 11 10 b f f 4537 4537 16 2868 0 4248 4243 140 ) insert ( 2869 '@>' 11 10 b f f 4537 2283 16 2872 0 4249 4243 1303 ) insert ( 2870 '@>' 11 10 b f f 4537 3831 16 2873 0 4250 4243 1303 ) insert ( 2871 '@>' 11 10 b f f 4537 4537 16 2874 0 4251 4243 1303 ) insert ( 2872 '<@' 11 10 b f f 2283 4537 16 2869 0 4252 4243 1303 ) insert ( 2873 '<@' 11 10 b f f 3831 4537 16 2870 0 4253 4243 1303 ) insert ( 2874 '<@' 11 10 b f f 4537 4537 16 2871 0 4254 4243 1303 ) insert ( 4539 '@>' 11 10 b f f 3831 4537 16 4540 0 4541 4243 1303 ) insert ( 4540 '<@' 11 10 b f f 4537 3831 16 4539 0 4542 4243 1303 ) insert ( 2875 '&<' 11 10 b f f 3831 4537 16 0 0 4264 4243 107 ) insert ( 2876 '&<' 11 10 b f f 4537 3831 16 0 0 4265 4243 107 ) insert ( 2877 '&<' 11 10 b f f 4537 4537 16 0 0 4266 4243 107 ) insert ( 3585 '&>' 11 10 b f f 3831 4537 16 0 0 4267 4243 108 ) insert ( 4035 '&>' 11 10 b f f 4537 3831 16 0 0 4268 4243 108 ) insert ( 4142 '&>' 11 10 b f f 4537 4537 16 0 0 4269 4243 108 ) insert ( 4179 '-|-' 11 10 b f f 3831 4537 16 4180 0 4255 5040 5041 ) insert ( 4180 '-|-' 11 10 b f f 4537 3831 16 4179 0 4257 5040 5041 ) insert ( 4198 '-|-' 11 10 b f f 4537 4537 16 4198 0 4256 5040 5041 ) insert ( 4392 '+' 11 10 b f f 4537 4537 4537 4392 0 4270 - - ) insert ( 4393 - 11 10 b f f 4537 4537 4537 0 0 4271 - - ) insert ( 4394 '*' 11 10 b f f 4537 4537 4537 4394 0 4272 - - ) insert ( 4395 '<<' 11 10 b f f 3831 4537 16 4399 0 4258 4243 107 ) insert ( 4396 '<<' 11 10 b f f 4537 3831 16 4398 0 4259 4243 107 ) insert ( 4397 '<<' 11 10 b f f 4537 4537 16 4400 0 4260 4243 107 ) insert ( 4398 '>>' 11 10 b f f 3831 4537 16 4396 0 4261 4243 108 ) insert ( 4399 '>>' 11 10 b f f 4537 3831 16 4395 0 4262 4243 108 ) insert ( 4400 '>>' 11 10 b f f 4537 4537 16 4397 0 4263 4243 108 ) close pg_operator create pg_opfamily 2753 ( oid = oid , opfmethod = oid , opfname = name , opfnamespace = oid , opfowner = oid ) open pg_opfamily insert ( 397 403 array_ops 11 10 ) insert ( 627 405 array_ops 11 10 ) insert ( 423 403 bit_ops 11 10 ) insert ( 424 403 bool_ops 11 10 ) insert ( 426 403 bpchar_ops 11 10 ) insert ( 427 405 bpchar_ops 11 10 ) insert ( 428 403 bytea_ops 11 10 ) insert ( 429 403 char_ops 11 10 ) insert ( 431 405 char_ops 11 10 ) insert ( 434 403 datetime_ops 11 10 ) insert ( 435 405 date_ops 11 10 ) insert ( 1970 403 float_ops 11 10 ) insert ( 1971 405 float_ops 11 10 ) insert ( 1974 403 network_ops 11 10 ) insert ( 1975 405 network_ops 11 10 ) insert ( 3550 783 network_ops 11 10 ) insert ( 3794 4000 network_ops 11 10 ) insert ( 1976 403 integer_ops 11 10 ) insert ( 1977 405 integer_ops 11 10 ) insert ( 1982 403 interval_ops 11 10 ) insert ( 1983 405 interval_ops 11 10 ) insert ( 1984 403 macaddr_ops 11 10 ) insert ( 1985 405 macaddr_ops 11 10 ) insert ( 3371 403 macaddr8_ops 11 10 ) insert ( 3372 405 macaddr8_ops 11 10 ) insert ( 1988 403 numeric_ops 11 10 ) insert ( 1998 405 numeric_ops 11 10 ) insert ( 1989 403 oid_ops 11 10 ) insert ( 1990 405 oid_ops 11 10 ) insert ( 1991 403 oidvector_ops 11 10 ) insert ( 1992 405 oidvector_ops 11 10 ) insert ( 2994 403 record_ops 11 10 ) insert ( 6194 405 record_ops 11 10 ) insert ( 3194 403 record_image_ops 11 10 ) insert ( 1994 403 text_ops 11 10 ) insert ( 1995 405 text_ops 11 10 ) insert ( 1996 403 time_ops 11 10 ) insert ( 1997 405 time_ops 11 10 ) insert ( 1999 405 timestamptz_ops 11 10 ) insert ( 2000 403 timetz_ops 11 10 ) insert ( 2001 405 timetz_ops 11 10 ) insert ( 2002 403 varbit_ops 11 10 ) insert ( 2040 405 timestamp_ops 11 10 ) insert ( 2095 403 text_pattern_ops 11 10 ) insert ( 2097 403 bpchar_pattern_ops 11 10 ) insert ( 2099 403 money_ops 11 10 ) insert ( 2222 405 bool_ops 11 10 ) insert ( 2223 405 bytea_ops 11 10 ) insert ( 2789 403 tid_ops 11 10 ) insert ( 2225 405 xid_ops 11 10 ) insert ( 5032 405 xid8_ops 11 10 ) insert ( 5067 403 xid8_ops 11 10 ) insert ( 2226 405 cid_ops 11 10 ) insert ( 2227 405 tid_ops 11 10 ) insert ( 2229 405 text_pattern_ops 11 10 ) insert ( 2231 405 bpchar_pattern_ops 11 10 ) insert ( 2235 405 aclitem_ops 11 10 ) insert ( 2593 783 box_ops 11 10 ) insert ( 2594 783 poly_ops 11 10 ) insert ( 2595 783 circle_ops 11 10 ) insert ( 1029 783 point_ops 11 10 ) insert ( 2745 2742 array_ops 11 10 ) insert ( 2968 403 uuid_ops 11 10 ) insert ( 2969 405 uuid_ops 11 10 ) insert ( 3253 403 pg_lsn_ops 11 10 ) insert ( 3254 405 pg_lsn_ops 11 10 ) insert ( 3522 403 enum_ops 11 10 ) insert ( 3523 405 enum_ops 11 10 ) insert ( 3626 403 tsvector_ops 11 10 ) insert ( 3655 783 tsvector_ops 11 10 ) insert ( 3659 2742 tsvector_ops 11 10 ) insert ( 3683 403 tsquery_ops 11 10 ) insert ( 3702 783 tsquery_ops 11 10 ) insert ( 3901 403 range_ops 11 10 ) insert ( 3903 405 range_ops 11 10 ) insert ( 3919 783 range_ops 11 10 ) insert ( 3474 4000 range_ops 11 10 ) insert ( 4015 4000 quad_point_ops 11 10 ) insert ( 4016 4000 kd_point_ops 11 10 ) insert ( 4017 4000 text_ops 11 10 ) insert ( 4033 403 jsonb_ops 11 10 ) insert ( 4034 405 jsonb_ops 11 10 ) insert ( 4036 2742 jsonb_ops 11 10 ) insert ( 4037 2742 jsonb_path_ops 11 10 ) insert ( 4054 3580 integer_minmax_ops 11 10 ) insert ( 4602 3580 integer_minmax_multi_ops 11 10 ) insert ( 4572 3580 integer_bloom_ops 11 10 ) insert ( 4055 3580 numeric_minmax_ops 11 10 ) insert ( 4603 3580 numeric_minmax_multi_ops 11 10 ) insert ( 4056 3580 text_minmax_ops 11 10 ) insert ( 4573 3580 text_bloom_ops 11 10 ) insert ( 4574 3580 numeric_bloom_ops 11 10 ) insert ( 4058 3580 timetz_minmax_ops 11 10 ) insert ( 4604 3580 timetz_minmax_multi_ops 11 10 ) insert ( 4575 3580 timetz_bloom_ops 11 10 ) insert ( 4059 3580 datetime_minmax_ops 11 10 ) insert ( 4605 3580 datetime_minmax_multi_ops 11 10 ) insert ( 4576 3580 datetime_bloom_ops 11 10 ) insert ( 4062 3580 char_minmax_ops 11 10 ) insert ( 4577 3580 char_bloom_ops 11 10 ) insert ( 4064 3580 bytea_minmax_ops 11 10 ) insert ( 4578 3580 bytea_bloom_ops 11 10 ) insert ( 4065 3580 name_minmax_ops 11 10 ) insert ( 4579 3580 name_bloom_ops 11 10 ) insert ( 4068 3580 oid_minmax_ops 11 10 ) insert ( 4606 3580 oid_minmax_multi_ops 11 10 ) insert ( 4580 3580 oid_bloom_ops 11 10 ) insert ( 4069 3580 tid_minmax_ops 11 10 ) insert ( 4581 3580 tid_bloom_ops 11 10 ) insert ( 4607 3580 tid_minmax_multi_ops 11 10 ) insert ( 4070 3580 float_minmax_ops 11 10 ) insert ( 4608 3580 float_minmax_multi_ops 11 10 ) insert ( 4582 3580 float_bloom_ops 11 10 ) insert ( 4074 3580 macaddr_minmax_ops 11 10 ) insert ( 4609 3580 macaddr_minmax_multi_ops 11 10 ) insert ( 4583 3580 macaddr_bloom_ops 11 10 ) insert ( 4109 3580 macaddr8_minmax_ops 11 10 ) insert ( 4610 3580 macaddr8_minmax_multi_ops 11 10 ) insert ( 4584 3580 macaddr8_bloom_ops 11 10 ) insert ( 4075 3580 network_minmax_ops 11 10 ) insert ( 4611 3580 network_minmax_multi_ops 11 10 ) insert ( 4102 3580 network_inclusion_ops 11 10 ) insert ( 4585 3580 network_bloom_ops 11 10 ) insert ( 4076 3580 bpchar_minmax_ops 11 10 ) insert ( 4586 3580 bpchar_bloom_ops 11 10 ) insert ( 4077 3580 time_minmax_ops 11 10 ) insert ( 4612 3580 time_minmax_multi_ops 11 10 ) insert ( 4587 3580 time_bloom_ops 11 10 ) insert ( 4078 3580 interval_minmax_ops 11 10 ) insert ( 4613 3580 interval_minmax_multi_ops 11 10 ) insert ( 4588 3580 interval_bloom_ops 11 10 ) insert ( 4079 3580 bit_minmax_ops 11 10 ) insert ( 4080 3580 varbit_minmax_ops 11 10 ) insert ( 4081 3580 uuid_minmax_ops 11 10 ) insert ( 4614 3580 uuid_minmax_multi_ops 11 10 ) insert ( 4589 3580 uuid_bloom_ops 11 10 ) insert ( 4103 3580 range_inclusion_ops 11 10 ) insert ( 4082 3580 pg_lsn_minmax_ops 11 10 ) insert ( 4615 3580 pg_lsn_minmax_multi_ops 11 10 ) insert ( 4590 3580 pg_lsn_bloom_ops 11 10 ) insert ( 4104 3580 box_inclusion_ops 11 10 ) insert ( 5000 4000 box_ops 11 10 ) insert ( 5008 4000 poly_ops 11 10 ) insert ( 4199 403 multirange_ops 11 10 ) insert ( 4225 405 multirange_ops 11 10 ) insert ( 6158 783 multirange_ops 11 10 ) close pg_opfamily create pg_opclass 2616 ( oid = oid , opcmethod = oid , opcname = name , opcnamespace = oid , opcowner = oid , opcfamily = oid , opcintype = oid , opcdefault = bool , opckeytype = oid ) open pg_opclass insert ( 10000 403 array_ops 11 10 397 2277 t 0 ) insert ( 10001 405 array_ops 11 10 627 2277 t 0 ) insert ( 10002 403 bit_ops 11 10 423 1560 t 0 ) insert ( 10003 403 bool_ops 11 10 424 16 t 0 ) insert ( 10004 403 bpchar_ops 11 10 426 1042 t 0 ) insert ( 10005 405 bpchar_ops 11 10 427 1042 t 0 ) insert ( 10006 403 bytea_ops 11 10 428 17 t 0 ) insert ( 10007 403 char_ops 11 10 429 18 t 0 ) insert ( 10008 405 char_ops 11 10 431 18 t 0 ) insert ( 10009 403 cidr_ops 11 10 1974 869 f 0 ) insert ( 10010 405 cidr_ops 11 10 1975 869 f 0 ) insert ( 3122 403 date_ops 11 10 434 1082 t 0 ) insert ( 10011 405 date_ops 11 10 435 1082 t 0 ) insert ( 10012 403 float4_ops 11 10 1970 700 t 0 ) insert ( 10013 405 float4_ops 11 10 1971 700 t 0 ) insert ( 3123 403 float8_ops 11 10 1970 701 t 0 ) insert ( 10014 405 float8_ops 11 10 1971 701 t 0 ) insert ( 10015 403 inet_ops 11 10 1974 869 t 0 ) insert ( 10016 405 inet_ops 11 10 1975 869 t 0 ) insert ( 10017 783 inet_ops 11 10 3550 869 f 0 ) insert ( 10018 4000 inet_ops 11 10 3794 869 t 0 ) insert ( 1979 403 int2_ops 11 10 1976 21 t 0 ) insert ( 10019 405 int2_ops 11 10 1977 21 t 0 ) insert ( 1978 403 int4_ops 11 10 1976 23 t 0 ) insert ( 10020 405 int4_ops 11 10 1977 23 t 0 ) insert ( 3124 403 int8_ops 11 10 1976 20 t 0 ) insert ( 10021 405 int8_ops 11 10 1977 20 t 0 ) insert ( 10022 403 interval_ops 11 10 1982 1186 t 0 ) insert ( 10023 405 interval_ops 11 10 1983 1186 t 0 ) insert ( 10024 403 macaddr_ops 11 10 1984 829 t 0 ) insert ( 10025 405 macaddr_ops 11 10 1985 829 t 0 ) insert ( 10026 403 macaddr8_ops 11 10 3371 774 t 0 ) insert ( 10027 405 macaddr8_ops 11 10 3372 774 t 0 ) insert ( 10028 403 name_ops 11 10 1994 19 t 2275 ) insert ( 10029 405 name_ops 11 10 1995 19 t 0 ) insert ( 3125 403 numeric_ops 11 10 1988 1700 t 0 ) insert ( 10030 405 numeric_ops 11 10 1998 1700 t 0 ) insert ( 1981 403 oid_ops 11 10 1989 26 t 0 ) insert ( 10031 405 oid_ops 11 10 1990 26 t 0 ) insert ( 10032 403 oidvector_ops 11 10 1991 30 t 0 ) insert ( 10033 405 oidvector_ops 11 10 1992 30 t 0 ) insert ( 10034 403 record_ops 11 10 2994 2249 t 0 ) insert ( 10035 405 record_ops 11 10 6194 2249 t 0 ) insert ( 10036 403 record_image_ops 11 10 3194 2249 f 0 ) insert ( 3126 403 text_ops 11 10 1994 25 t 0 ) insert ( 10037 405 text_ops 11 10 1995 25 t 0 ) insert ( 10038 403 time_ops 11 10 1996 1083 t 0 ) insert ( 10039 405 time_ops 11 10 1997 1083 t 0 ) insert ( 3127 403 timestamptz_ops 11 10 434 1184 t 0 ) insert ( 10040 405 timestamptz_ops 11 10 1999 1184 t 0 ) insert ( 10041 403 timetz_ops 11 10 2000 1266 t 0 ) insert ( 10042 405 timetz_ops 11 10 2001 1266 t 0 ) insert ( 10043 403 varbit_ops 11 10 2002 1562 t 0 ) insert ( 10044 403 varchar_ops 11 10 1994 25 f 0 ) insert ( 10045 405 varchar_ops 11 10 1995 25 f 0 ) insert ( 3128 403 timestamp_ops 11 10 434 1114 t 0 ) insert ( 10046 405 timestamp_ops 11 10 2040 1114 t 0 ) insert ( 4217 403 text_pattern_ops 11 10 2095 25 f 0 ) insert ( 4218 403 varchar_pattern_ops 11 10 2095 25 f 0 ) insert ( 4219 403 bpchar_pattern_ops 11 10 2097 1042 f 0 ) insert ( 10047 403 money_ops 11 10 2099 790 t 0 ) insert ( 10048 405 bool_ops 11 10 2222 16 t 0 ) insert ( 10049 405 bytea_ops 11 10 2223 17 t 0 ) insert ( 10050 403 tid_ops 11 10 2789 27 t 0 ) insert ( 10051 405 xid_ops 11 10 2225 28 t 0 ) insert ( 10052 405 xid8_ops 11 10 5032 5069 t 0 ) insert ( 10053 403 xid8_ops 11 10 5067 5069 t 0 ) insert ( 10054 405 cid_ops 11 10 2226 29 t 0 ) insert ( 10055 405 tid_ops 11 10 2227 27 t 0 ) insert ( 10056 405 text_pattern_ops 11 10 2229 25 f 0 ) insert ( 10057 405 varchar_pattern_ops 11 10 2229 25 f 0 ) insert ( 10058 405 bpchar_pattern_ops 11 10 2231 1042 f 0 ) insert ( 10059 405 aclitem_ops 11 10 2235 1033 t 0 ) insert ( 10060 783 box_ops 11 10 2593 603 t 0 ) insert ( 10061 783 point_ops 11 10 1029 600 t 603 ) insert ( 10062 783 poly_ops 11 10 2594 604 t 603 ) insert ( 10063 783 circle_ops 11 10 2595 718 t 603 ) insert ( 10064 2742 array_ops 11 10 2745 2277 t 2283 ) insert ( 10065 403 uuid_ops 11 10 2968 2950 t 0 ) insert ( 10066 405 uuid_ops 11 10 2969 2950 t 0 ) insert ( 10067 403 pg_lsn_ops 11 10 3253 3220 t 0 ) insert ( 10068 405 pg_lsn_ops 11 10 3254 3220 t 0 ) insert ( 10069 403 enum_ops 11 10 3522 3500 t 0 ) insert ( 10070 405 enum_ops 11 10 3523 3500 t 0 ) insert ( 10071 403 tsvector_ops 11 10 3626 3614 t 0 ) insert ( 10072 783 tsvector_ops 11 10 3655 3614 t 3642 ) insert ( 10073 2742 tsvector_ops 11 10 3659 3614 t 25 ) insert ( 10074 403 tsquery_ops 11 10 3683 3615 t 0 ) insert ( 10075 783 tsquery_ops 11 10 3702 3615 t 20 ) insert ( 10076 403 range_ops 11 10 3901 3831 t 0 ) insert ( 10077 405 range_ops 11 10 3903 3831 t 0 ) insert ( 10078 783 range_ops 11 10 3919 3831 t 0 ) insert ( 10079 4000 range_ops 11 10 3474 3831 t 0 ) insert ( 10080 403 multirange_ops 11 10 4199 4537 t 0 ) insert ( 10081 405 multirange_ops 11 10 4225 4537 t 0 ) insert ( 10082 783 multirange_ops 11 10 6158 4537 t 3831 ) insert ( 10083 4000 box_ops 11 10 5000 603 t 0 ) insert ( 10084 4000 quad_point_ops 11 10 4015 600 t 0 ) insert ( 10085 4000 kd_point_ops 11 10 4016 600 f 0 ) insert ( 10086 4000 text_ops 11 10 4017 25 t 0 ) insert ( 10087 4000 poly_ops 11 10 5008 604 t 603 ) insert ( 10088 403 jsonb_ops 11 10 4033 3802 t 0 ) insert ( 10089 405 jsonb_ops 11 10 4034 3802 t 0 ) insert ( 10090 2742 jsonb_ops 11 10 4036 3802 t 25 ) insert ( 10091 2742 jsonb_path_ops 11 10 4037 3802 f 23 ) insert ( 10092 3580 bytea_minmax_ops 11 10 4064 17 t 17 ) insert ( 10093 3580 bytea_bloom_ops 11 10 4578 17 f 17 ) insert ( 10094 3580 char_minmax_ops 11 10 4062 18 t 18 ) insert ( 10095 3580 char_bloom_ops 11 10 4577 18 f 18 ) insert ( 10096 3580 name_minmax_ops 11 10 4065 19 t 19 ) insert ( 10097 3580 name_bloom_ops 11 10 4579 19 f 19 ) insert ( 10098 3580 int8_minmax_ops 11 10 4054 20 t 20 ) insert ( 10099 3580 int8_minmax_multi_ops 11 10 4602 20 f 20 ) insert ( 10100 3580 int8_bloom_ops 11 10 4572 20 f 20 ) insert ( 10101 3580 int2_minmax_ops 11 10 4054 21 t 21 ) insert ( 10102 3580 int2_minmax_multi_ops 11 10 4602 21 f 21 ) insert ( 10103 3580 int2_bloom_ops 11 10 4572 21 f 21 ) insert ( 10104 3580 int4_minmax_ops 11 10 4054 23 t 23 ) insert ( 10105 3580 int4_minmax_multi_ops 11 10 4602 23 f 23 ) insert ( 10106 3580 int4_bloom_ops 11 10 4572 23 f 23 ) insert ( 10107 3580 text_minmax_ops 11 10 4056 25 t 25 ) insert ( 10108 3580 text_bloom_ops 11 10 4573 25 f 25 ) insert ( 10109 3580 oid_minmax_ops 11 10 4068 26 t 26 ) insert ( 10110 3580 oid_minmax_multi_ops 11 10 4606 26 f 26 ) insert ( 10111 3580 oid_bloom_ops 11 10 4580 26 f 26 ) insert ( 10112 3580 tid_minmax_ops 11 10 4069 27 t 27 ) insert ( 10113 3580 tid_bloom_ops 11 10 4581 27 f 27 ) insert ( 10114 3580 tid_minmax_multi_ops 11 10 4607 27 f 27 ) insert ( 10115 3580 float4_minmax_ops 11 10 4070 700 t 700 ) insert ( 10116 3580 float4_minmax_multi_ops 11 10 4608 700 f 700 ) insert ( 10117 3580 float4_bloom_ops 11 10 4582 700 f 700 ) insert ( 10118 3580 float8_minmax_ops 11 10 4070 701 t 701 ) insert ( 10119 3580 float8_minmax_multi_ops 11 10 4608 701 f 701 ) insert ( 10120 3580 float8_bloom_ops 11 10 4582 701 f 701 ) insert ( 10121 3580 macaddr_minmax_ops 11 10 4074 829 t 829 ) insert ( 10122 3580 macaddr_minmax_multi_ops 11 10 4609 829 f 829 ) insert ( 10123 3580 macaddr_bloom_ops 11 10 4583 829 f 829 ) insert ( 10124 3580 macaddr8_minmax_ops 11 10 4109 774 t 774 ) insert ( 10125 3580 macaddr8_minmax_multi_ops 11 10 4610 774 f 774 ) insert ( 10126 3580 macaddr8_bloom_ops 11 10 4584 774 f 774 ) insert ( 10127 3580 inet_minmax_ops 11 10 4075 869 f 869 ) insert ( 10128 3580 inet_minmax_multi_ops 11 10 4611 869 f 869 ) insert ( 10129 3580 inet_bloom_ops 11 10 4585 869 f 869 ) insert ( 10130 3580 inet_inclusion_ops 11 10 4102 869 t 869 ) insert ( 10131 3580 bpchar_minmax_ops 11 10 4076 1042 t 1042 ) insert ( 10132 3580 bpchar_bloom_ops 11 10 4586 1042 f 1042 ) insert ( 10133 3580 time_minmax_ops 11 10 4077 1083 t 1083 ) insert ( 10134 3580 time_minmax_multi_ops 11 10 4612 1083 f 1083 ) insert ( 10135 3580 time_bloom_ops 11 10 4587 1083 f 1083 ) insert ( 10136 3580 date_minmax_ops 11 10 4059 1082 t 1082 ) insert ( 10137 3580 date_minmax_multi_ops 11 10 4605 1082 f 1082 ) insert ( 10138 3580 date_bloom_ops 11 10 4576 1082 f 1082 ) insert ( 10139 3580 timestamp_minmax_ops 11 10 4059 1114 t 1114 ) insert ( 10140 3580 timestamp_minmax_multi_ops 11 10 4605 1114 f 1114 ) insert ( 10141 3580 timestamp_bloom_ops 11 10 4576 1114 f 1114 ) insert ( 10142 3580 timestamptz_minmax_ops 11 10 4059 1184 t 1184 ) insert ( 10143 3580 timestamptz_minmax_multi_ops 11 10 4605 1184 f 1184 ) insert ( 10144 3580 timestamptz_bloom_ops 11 10 4576 1184 f 1184 ) insert ( 10145 3580 interval_minmax_ops 11 10 4078 1186 t 1186 ) insert ( 10146 3580 interval_minmax_multi_ops 11 10 4613 1186 f 1186 ) insert ( 10147 3580 interval_bloom_ops 11 10 4588 1186 f 1186 ) insert ( 10148 3580 timetz_minmax_ops 11 10 4058 1266 t 1266 ) insert ( 10149 3580 timetz_minmax_multi_ops 11 10 4604 1266 f 1266 ) insert ( 10150 3580 timetz_bloom_ops 11 10 4575 1266 f 1266 ) insert ( 10151 3580 bit_minmax_ops 11 10 4079 1560 t 1560 ) insert ( 10152 3580 varbit_minmax_ops 11 10 4080 1562 t 1562 ) insert ( 10153 3580 numeric_minmax_ops 11 10 4055 1700 t 1700 ) insert ( 10154 3580 numeric_minmax_multi_ops 11 10 4603 1700 f 1700 ) insert ( 10155 3580 numeric_bloom_ops 11 10 4574 1700 f 1700 ) insert ( 10156 3580 uuid_minmax_ops 11 10 4081 2950 t 2950 ) insert ( 10157 3580 uuid_minmax_multi_ops 11 10 4614 2950 f 2950 ) insert ( 10158 3580 uuid_bloom_ops 11 10 4589 2950 f 2950 ) insert ( 10159 3580 range_inclusion_ops 11 10 4103 3831 t 3831 ) insert ( 10160 3580 pg_lsn_minmax_ops 11 10 4082 3220 t 3220 ) insert ( 10161 3580 pg_lsn_minmax_multi_ops 11 10 4615 3220 f 3220 ) insert ( 10162 3580 pg_lsn_bloom_ops 11 10 4590 3220 f 3220 ) insert ( 10163 3580 box_inclusion_ops 11 10 4104 603 t 603 ) close pg_opclass create pg_am 2601 ( oid = oid , amname = name , amhandler = regproc , amtype = char ) open pg_am insert ( 2 heap 3 t ) insert ( 403 btree 330 i ) insert ( 405 hash 331 i ) insert ( 783 gist 332 i ) insert ( 2742 gin 333 i ) insert ( 4000 spgist 334 i ) insert ( 3580 brin 335 i ) close pg_am create pg_amop 2602 ( oid = oid , amopfamily = oid , amoplefttype = oid , amoprighttype = oid , amopstrategy = int2 , amoppurpose = char , amopopr = oid , amopmethod = oid , amopsortfamily = oid ) open pg_amop insert ( 10000 1976 21 21 1 s 95 403 0 ) insert ( 10001 1976 21 21 2 s 522 403 0 ) insert ( 10002 1976 21 21 3 s 94 403 0 ) insert ( 10003 1976 21 21 4 s 524 403 0 ) insert ( 10004 1976 21 21 5 s 520 403 0 ) insert ( 10005 1976 21 23 1 s 534 403 0 ) insert ( 10006 1976 21 23 2 s 540 403 0 ) insert ( 10007 1976 21 23 3 s 532 403 0 ) insert ( 10008 1976 21 23 4 s 542 403 0 ) insert ( 10009 1976 21 23 5 s 536 403 0 ) insert ( 10010 1976 21 20 1 s 1864 403 0 ) insert ( 10011 1976 21 20 2 s 1866 403 0 ) insert ( 10012 1976 21 20 3 s 1862 403 0 ) insert ( 10013 1976 21 20 4 s 1867 403 0 ) insert ( 10014 1976 21 20 5 s 1865 403 0 ) insert ( 10015 1976 23 23 1 s 97 403 0 ) insert ( 10016 1976 23 23 2 s 523 403 0 ) insert ( 10017 1976 23 23 3 s 96 403 0 ) insert ( 10018 1976 23 23 4 s 525 403 0 ) insert ( 10019 1976 23 23 5 s 521 403 0 ) insert ( 10020 1976 23 21 1 s 535 403 0 ) insert ( 10021 1976 23 21 2 s 541 403 0 ) insert ( 10022 1976 23 21 3 s 533 403 0 ) insert ( 10023 1976 23 21 4 s 543 403 0 ) insert ( 10024 1976 23 21 5 s 537 403 0 ) insert ( 10025 1976 23 20 1 s 37 403 0 ) insert ( 10026 1976 23 20 2 s 80 403 0 ) insert ( 10027 1976 23 20 3 s 15 403 0 ) insert ( 10028 1976 23 20 4 s 82 403 0 ) insert ( 10029 1976 23 20 5 s 76 403 0 ) insert ( 10030 1976 20 20 1 s 412 403 0 ) insert ( 10031 1976 20 20 2 s 414 403 0 ) insert ( 10032 1976 20 20 3 s 410 403 0 ) insert ( 10033 1976 20 20 4 s 415 403 0 ) insert ( 10034 1976 20 20 5 s 413 403 0 ) insert ( 10035 1976 20 21 1 s 1870 403 0 ) insert ( 10036 1976 20 21 2 s 1872 403 0 ) insert ( 10037 1976 20 21 3 s 1868 403 0 ) insert ( 10038 1976 20 21 4 s 1873 403 0 ) insert ( 10039 1976 20 21 5 s 1871 403 0 ) insert ( 10040 1976 20 23 1 s 418 403 0 ) insert ( 10041 1976 20 23 2 s 420 403 0 ) insert ( 10042 1976 20 23 3 s 416 403 0 ) insert ( 10043 1976 20 23 4 s 430 403 0 ) insert ( 10044 1976 20 23 5 s 419 403 0 ) insert ( 10045 1989 26 26 1 s 609 403 0 ) insert ( 10046 1989 26 26 2 s 611 403 0 ) insert ( 10047 1989 26 26 3 s 607 403 0 ) insert ( 10048 1989 26 26 4 s 612 403 0 ) insert ( 10049 1989 26 26 5 s 610 403 0 ) insert ( 10050 5067 5069 5069 1 s 5073 403 0 ) insert ( 10051 5067 5069 5069 2 s 5075 403 0 ) insert ( 10052 5067 5069 5069 3 s 5068 403 0 ) insert ( 10053 5067 5069 5069 4 s 5076 403 0 ) insert ( 10054 5067 5069 5069 5 s 5074 403 0 ) insert ( 10055 2789 27 27 1 s 2799 403 0 ) insert ( 10056 2789 27 27 2 s 2801 403 0 ) insert ( 10057 2789 27 27 3 s 387 403 0 ) insert ( 10058 2789 27 27 4 s 2802 403 0 ) insert ( 10059 2789 27 27 5 s 2800 403 0 ) insert ( 10060 1991 30 30 1 s 645 403 0 ) insert ( 10061 1991 30 30 2 s 647 403 0 ) insert ( 10062 1991 30 30 3 s 649 403 0 ) insert ( 10063 1991 30 30 4 s 648 403 0 ) insert ( 10064 1991 30 30 5 s 646 403 0 ) insert ( 10065 1970 700 700 1 s 622 403 0 ) insert ( 10066 1970 700 700 2 s 624 403 0 ) insert ( 10067 1970 700 700 3 s 620 403 0 ) insert ( 10068 1970 700 700 4 s 625 403 0 ) insert ( 10069 1970 700 700 5 s 623 403 0 ) insert ( 10070 1970 700 701 1 s 1122 403 0 ) insert ( 10071 1970 700 701 2 s 1124 403 0 ) insert ( 10072 1970 700 701 3 s 1120 403 0 ) insert ( 10073 1970 700 701 4 s 1125 403 0 ) insert ( 10074 1970 700 701 5 s 1123 403 0 ) insert ( 10075 1970 701 701 1 s 672 403 0 ) insert ( 10076 1970 701 701 2 s 673 403 0 ) insert ( 10077 1970 701 701 3 s 670 403 0 ) insert ( 10078 1970 701 701 4 s 675 403 0 ) insert ( 10079 1970 701 701 5 s 674 403 0 ) insert ( 10080 1970 701 700 1 s 1132 403 0 ) insert ( 10081 1970 701 700 2 s 1134 403 0 ) insert ( 10082 1970 701 700 3 s 1130 403 0 ) insert ( 10083 1970 701 700 4 s 1135 403 0 ) insert ( 10084 1970 701 700 5 s 1133 403 0 ) insert ( 10085 429 18 18 1 s 631 403 0 ) insert ( 10086 429 18 18 2 s 632 403 0 ) insert ( 10087 429 18 18 3 s 92 403 0 ) insert ( 10088 429 18 18 4 s 634 403 0 ) insert ( 10089 429 18 18 5 s 633 403 0 ) insert ( 10090 1994 25 25 1 s 664 403 0 ) insert ( 10091 1994 25 25 2 s 665 403 0 ) insert ( 10092 1994 25 25 3 s 98 403 0 ) insert ( 10093 1994 25 25 4 s 667 403 0 ) insert ( 10094 1994 25 25 5 s 666 403 0 ) insert ( 10095 1994 19 19 1 s 660 403 0 ) insert ( 10096 1994 19 19 2 s 661 403 0 ) insert ( 10097 1994 19 19 3 s 93 403 0 ) insert ( 10098 1994 19 19 4 s 663 403 0 ) insert ( 10099 1994 19 19 5 s 662 403 0 ) insert ( 10100 1994 19 25 1 s 255 403 0 ) insert ( 10101 1994 19 25 2 s 256 403 0 ) insert ( 10102 1994 19 25 3 s 254 403 0 ) insert ( 10103 1994 19 25 4 s 257 403 0 ) insert ( 10104 1994 19 25 5 s 258 403 0 ) insert ( 10105 1994 25 19 1 s 261 403 0 ) insert ( 10106 1994 25 19 2 s 262 403 0 ) insert ( 10107 1994 25 19 3 s 260 403 0 ) insert ( 10108 1994 25 19 4 s 263 403 0 ) insert ( 10109 1994 25 19 5 s 264 403 0 ) insert ( 10110 426 1042 1042 1 s 1058 403 0 ) insert ( 10111 426 1042 1042 2 s 1059 403 0 ) insert ( 10112 426 1042 1042 3 s 1054 403 0 ) insert ( 10113 426 1042 1042 4 s 1061 403 0 ) insert ( 10114 426 1042 1042 5 s 1060 403 0 ) insert ( 10115 428 17 17 1 s 1957 403 0 ) insert ( 10116 428 17 17 2 s 1958 403 0 ) insert ( 10117 428 17 17 3 s 1955 403 0 ) insert ( 10118 428 17 17 4 s 1960 403 0 ) insert ( 10119 428 17 17 5 s 1959 403 0 ) insert ( 10120 434 1082 1082 1 s 1095 403 0 ) insert ( 10121 434 1082 1082 2 s 1096 403 0 ) insert ( 10122 434 1082 1082 3 s 1093 403 0 ) insert ( 10123 434 1082 1082 4 s 1098 403 0 ) insert ( 10124 434 1082 1082 5 s 1097 403 0 ) insert ( 10125 434 1082 1114 1 s 2345 403 0 ) insert ( 10126 434 1082 1114 2 s 2346 403 0 ) insert ( 10127 434 1082 1114 3 s 2347 403 0 ) insert ( 10128 434 1082 1114 4 s 2348 403 0 ) insert ( 10129 434 1082 1114 5 s 2349 403 0 ) insert ( 10130 434 1082 1184 1 s 2358 403 0 ) insert ( 10131 434 1082 1184 2 s 2359 403 0 ) insert ( 10132 434 1082 1184 3 s 2360 403 0 ) insert ( 10133 434 1082 1184 4 s 2361 403 0 ) insert ( 10134 434 1082 1184 5 s 2362 403 0 ) insert ( 10135 434 1114 1114 1 s 2062 403 0 ) insert ( 10136 434 1114 1114 2 s 2063 403 0 ) insert ( 10137 434 1114 1114 3 s 2060 403 0 ) insert ( 10138 434 1114 1114 4 s 2065 403 0 ) insert ( 10139 434 1114 1114 5 s 2064 403 0 ) insert ( 10140 434 1114 1082 1 s 2371 403 0 ) insert ( 10141 434 1114 1082 2 s 2372 403 0 ) insert ( 10142 434 1114 1082 3 s 2373 403 0 ) insert ( 10143 434 1114 1082 4 s 2374 403 0 ) insert ( 10144 434 1114 1082 5 s 2375 403 0 ) insert ( 10145 434 1114 1184 1 s 2534 403 0 ) insert ( 10146 434 1114 1184 2 s 2535 403 0 ) insert ( 10147 434 1114 1184 3 s 2536 403 0 ) insert ( 10148 434 1114 1184 4 s 2537 403 0 ) insert ( 10149 434 1114 1184 5 s 2538 403 0 ) insert ( 10150 434 1184 1184 1 s 1322 403 0 ) insert ( 10151 434 1184 1184 2 s 1323 403 0 ) insert ( 10152 434 1184 1184 3 s 1320 403 0 ) insert ( 10153 434 1184 1184 4 s 1325 403 0 ) insert ( 10154 434 1184 1184 5 s 1324 403 0 ) insert ( 10155 434 1184 1082 1 s 2384 403 0 ) insert ( 10156 434 1184 1082 2 s 2385 403 0 ) insert ( 10157 434 1184 1082 3 s 2386 403 0 ) insert ( 10158 434 1184 1082 4 s 2387 403 0 ) insert ( 10159 434 1184 1082 5 s 2388 403 0 ) insert ( 10160 434 1184 1114 1 s 2540 403 0 ) insert ( 10161 434 1184 1114 2 s 2541 403 0 ) insert ( 10162 434 1184 1114 3 s 2542 403 0 ) insert ( 10163 434 1184 1114 4 s 2543 403 0 ) insert ( 10164 434 1184 1114 5 s 2544 403 0 ) insert ( 10165 1996 1083 1083 1 s 1110 403 0 ) insert ( 10166 1996 1083 1083 2 s 1111 403 0 ) insert ( 10167 1996 1083 1083 3 s 1108 403 0 ) insert ( 10168 1996 1083 1083 4 s 1113 403 0 ) insert ( 10169 1996 1083 1083 5 s 1112 403 0 ) insert ( 10170 2000 1266 1266 1 s 1552 403 0 ) insert ( 10171 2000 1266 1266 2 s 1553 403 0 ) insert ( 10172 2000 1266 1266 3 s 1550 403 0 ) insert ( 10173 2000 1266 1266 4 s 1555 403 0 ) insert ( 10174 2000 1266 1266 5 s 1554 403 0 ) insert ( 10175 1982 1186 1186 1 s 1332 403 0 ) insert ( 10176 1982 1186 1186 2 s 1333 403 0 ) insert ( 10177 1982 1186 1186 3 s 1330 403 0 ) insert ( 10178 1982 1186 1186 4 s 1335 403 0 ) insert ( 10179 1982 1186 1186 5 s 1334 403 0 ) insert ( 10180 1984 829 829 1 s 1222 403 0 ) insert ( 10181 1984 829 829 2 s 1223 403 0 ) insert ( 10182 1984 829 829 3 s 1220 403 0 ) insert ( 10183 1984 829 829 4 s 1225 403 0 ) insert ( 10184 1984 829 829 5 s 1224 403 0 ) insert ( 10185 3371 774 774 1 s 3364 403 0 ) insert ( 10186 3371 774 774 2 s 3365 403 0 ) insert ( 10187 3371 774 774 3 s 3362 403 0 ) insert ( 10188 3371 774 774 4 s 3367 403 0 ) insert ( 10189 3371 774 774 5 s 3366 403 0 ) insert ( 10190 1974 869 869 1 s 1203 403 0 ) insert ( 10191 1974 869 869 2 s 1204 403 0 ) insert ( 10192 1974 869 869 3 s 1201 403 0 ) insert ( 10193 1974 869 869 4 s 1206 403 0 ) insert ( 10194 1974 869 869 5 s 1205 403 0 ) insert ( 10195 1988 1700 1700 1 s 1754 403 0 ) insert ( 10196 1988 1700 1700 2 s 1755 403 0 ) insert ( 10197 1988 1700 1700 3 s 1752 403 0 ) insert ( 10198 1988 1700 1700 4 s 1757 403 0 ) insert ( 10199 1988 1700 1700 5 s 1756 403 0 ) insert ( 10200 424 16 16 1 s 58 403 0 ) insert ( 10201 424 16 16 2 s 1694 403 0 ) insert ( 10202 424 16 16 3 s 91 403 0 ) insert ( 10203 424 16 16 4 s 1695 403 0 ) insert ( 10204 424 16 16 5 s 59 403 0 ) insert ( 10205 423 1560 1560 1 s 1786 403 0 ) insert ( 10206 423 1560 1560 2 s 1788 403 0 ) insert ( 10207 423 1560 1560 3 s 1784 403 0 ) insert ( 10208 423 1560 1560 4 s 1789 403 0 ) insert ( 10209 423 1560 1560 5 s 1787 403 0 ) insert ( 10210 2002 1562 1562 1 s 1806 403 0 ) insert ( 10211 2002 1562 1562 2 s 1808 403 0 ) insert ( 10212 2002 1562 1562 3 s 1804 403 0 ) insert ( 10213 2002 1562 1562 4 s 1809 403 0 ) insert ( 10214 2002 1562 1562 5 s 1807 403 0 ) insert ( 10215 2095 25 25 1 s 2314 403 0 ) insert ( 10216 2095 25 25 2 s 2315 403 0 ) insert ( 10217 2095 25 25 3 s 98 403 0 ) insert ( 10218 2095 25 25 4 s 2317 403 0 ) insert ( 10219 2095 25 25 5 s 2318 403 0 ) insert ( 10220 2097 1042 1042 1 s 2326 403 0 ) insert ( 10221 2097 1042 1042 2 s 2327 403 0 ) insert ( 10222 2097 1042 1042 3 s 1054 403 0 ) insert ( 10223 2097 1042 1042 4 s 2329 403 0 ) insert ( 10224 2097 1042 1042 5 s 2330 403 0 ) insert ( 10225 2099 790 790 1 s 902 403 0 ) insert ( 10226 2099 790 790 2 s 904 403 0 ) insert ( 10227 2099 790 790 3 s 900 403 0 ) insert ( 10228 2099 790 790 4 s 905 403 0 ) insert ( 10229 2099 790 790 5 s 903 403 0 ) insert ( 10230 397 2277 2277 1 s 1072 403 0 ) insert ( 10231 397 2277 2277 2 s 1074 403 0 ) insert ( 10232 397 2277 2277 3 s 1070 403 0 ) insert ( 10233 397 2277 2277 4 s 1075 403 0 ) insert ( 10234 397 2277 2277 5 s 1073 403 0 ) insert ( 10235 2994 2249 2249 1 s 2990 403 0 ) insert ( 10236 2994 2249 2249 2 s 2992 403 0 ) insert ( 10237 2994 2249 2249 3 s 2988 403 0 ) insert ( 10238 2994 2249 2249 4 s 2993 403 0 ) insert ( 10239 2994 2249 2249 5 s 2991 403 0 ) insert ( 10240 3194 2249 2249 1 s 3190 403 0 ) insert ( 10241 3194 2249 2249 2 s 3192 403 0 ) insert ( 10242 3194 2249 2249 3 s 3188 403 0 ) insert ( 10243 3194 2249 2249 4 s 3193 403 0 ) insert ( 10244 3194 2249 2249 5 s 3191 403 0 ) insert ( 10245 2968 2950 2950 1 s 2974 403 0 ) insert ( 10246 2968 2950 2950 2 s 2976 403 0 ) insert ( 10247 2968 2950 2950 3 s 2972 403 0 ) insert ( 10248 2968 2950 2950 4 s 2977 403 0 ) insert ( 10249 2968 2950 2950 5 s 2975 403 0 ) insert ( 10250 3253 3220 3220 1 s 3224 403 0 ) insert ( 10251 3253 3220 3220 2 s 3226 403 0 ) insert ( 10252 3253 3220 3220 3 s 3222 403 0 ) insert ( 10253 3253 3220 3220 4 s 3227 403 0 ) insert ( 10254 3253 3220 3220 5 s 3225 403 0 ) insert ( 10255 427 1042 1042 1 s 1054 405 0 ) insert ( 10256 431 18 18 1 s 92 405 0 ) insert ( 10257 435 1082 1082 1 s 1093 405 0 ) insert ( 10258 1971 700 700 1 s 620 405 0 ) insert ( 10259 1971 701 701 1 s 670 405 0 ) insert ( 10260 1971 700 701 1 s 1120 405 0 ) insert ( 10261 1971 701 700 1 s 1130 405 0 ) insert ( 10262 1975 869 869 1 s 1201 405 0 ) insert ( 10263 1977 21 21 1 s 94 405 0 ) insert ( 10264 1977 23 23 1 s 96 405 0 ) insert ( 10265 1977 20 20 1 s 410 405 0 ) insert ( 10266 1977 21 23 1 s 532 405 0 ) insert ( 10267 1977 21 20 1 s 1862 405 0 ) insert ( 10268 1977 23 21 1 s 533 405 0 ) insert ( 10269 1977 23 20 1 s 15 405 0 ) insert ( 10270 1977 20 21 1 s 1868 405 0 ) insert ( 10271 1977 20 23 1 s 416 405 0 ) insert ( 10272 1983 1186 1186 1 s 1330 405 0 ) insert ( 10273 1985 829 829 1 s 1220 405 0 ) insert ( 10274 3372 774 774 1 s 3362 405 0 ) insert ( 10275 1990 26 26 1 s 607 405 0 ) insert ( 10276 1992 30 30 1 s 649 405 0 ) insert ( 10277 6194 2249 2249 1 s 2988 405 0 ) insert ( 10278 1995 25 25 1 s 98 405 0 ) insert ( 10279 1995 19 19 1 s 93 405 0 ) insert ( 10280 1995 19 25 1 s 254 405 0 ) insert ( 10281 1995 25 19 1 s 260 405 0 ) insert ( 10282 1997 1083 1083 1 s 1108 405 0 ) insert ( 10283 1999 1184 1184 1 s 1320 405 0 ) insert ( 10284 2001 1266 1266 1 s 1550 405 0 ) insert ( 10285 2040 1114 1114 1 s 2060 405 0 ) insert ( 10286 2222 16 16 1 s 91 405 0 ) insert ( 10287 2223 17 17 1 s 1955 405 0 ) insert ( 10288 2225 28 28 1 s 352 405 0 ) insert ( 10289 5032 5069 5069 1 s 5068 405 0 ) insert ( 10290 2226 29 29 1 s 385 405 0 ) insert ( 10291 2227 27 27 1 s 387 405 0 ) insert ( 10292 2229 25 25 1 s 98 405 0 ) insert ( 10293 2231 1042 1042 1 s 1054 405 0 ) insert ( 10294 2235 1033 1033 1 s 974 405 0 ) insert ( 10295 2969 2950 2950 1 s 2972 405 0 ) insert ( 10296 3254 3220 3220 1 s 3222 405 0 ) insert ( 10297 1998 1700 1700 1 s 1752 405 0 ) insert ( 10298 627 2277 2277 1 s 1070 405 0 ) insert ( 10299 2593 603 603 1 s 493 783 0 ) insert ( 10300 2593 603 603 2 s 494 783 0 ) insert ( 10301 2593 603 603 3 s 500 783 0 ) insert ( 10302 2593 603 603 4 s 495 783 0 ) insert ( 10303 2593 603 603 5 s 496 783 0 ) insert ( 10304 2593 603 603 6 s 499 783 0 ) insert ( 10305 2593 603 603 7 s 498 783 0 ) insert ( 10306 2593 603 603 8 s 497 783 0 ) insert ( 10307 2593 603 603 9 s 2571 783 0 ) insert ( 10308 2593 603 603 10 s 2570 783 0 ) insert ( 10309 2593 603 603 11 s 2573 783 0 ) insert ( 10310 2593 603 603 12 s 2572 783 0 ) insert ( 10311 2593 603 600 15 o 606 783 1970 ) insert ( 10312 1029 600 600 11 s 4161 783 0 ) insert ( 10313 1029 600 600 30 s 506 783 0 ) insert ( 10314 1029 600 600 1 s 507 783 0 ) insert ( 10315 1029 600 600 5 s 508 783 0 ) insert ( 10316 1029 600 600 10 s 4162 783 0 ) insert ( 10317 1029 600 600 29 s 509 783 0 ) insert ( 10318 1029 600 600 6 s 510 783 0 ) insert ( 10319 1029 600 600 15 o 517 783 1970 ) insert ( 10320 1029 600 603 28 s 511 783 0 ) insert ( 10321 1029 600 604 48 s 756 783 0 ) insert ( 10322 1029 600 718 68 s 758 783 0 ) insert ( 10323 2594 604 604 1 s 485 783 0 ) insert ( 10324 2594 604 604 2 s 486 783 0 ) insert ( 10325 2594 604 604 3 s 492 783 0 ) insert ( 10326 2594 604 604 4 s 487 783 0 ) insert ( 10327 2594 604 604 5 s 488 783 0 ) insert ( 10328 2594 604 604 6 s 491 783 0 ) insert ( 10329 2594 604 604 7 s 490 783 0 ) insert ( 10330 2594 604 604 8 s 489 783 0 ) insert ( 10331 2594 604 604 9 s 2575 783 0 ) insert ( 10332 2594 604 604 10 s 2574 783 0 ) insert ( 10333 2594 604 604 11 s 2577 783 0 ) insert ( 10334 2594 604 604 12 s 2576 783 0 ) insert ( 10335 2594 604 600 15 o 3289 783 1970 ) insert ( 10336 2595 718 718 1 s 1506 783 0 ) insert ( 10337 2595 718 718 2 s 1507 783 0 ) insert ( 10338 2595 718 718 3 s 1513 783 0 ) insert ( 10339 2595 718 718 4 s 1508 783 0 ) insert ( 10340 2595 718 718 5 s 1509 783 0 ) insert ( 10341 2595 718 718 6 s 1512 783 0 ) insert ( 10342 2595 718 718 7 s 1511 783 0 ) insert ( 10343 2595 718 718 8 s 1510 783 0 ) insert ( 10344 2595 718 718 9 s 2589 783 0 ) insert ( 10345 2595 718 718 10 s 1515 783 0 ) insert ( 10346 2595 718 718 11 s 1514 783 0 ) insert ( 10347 2595 718 718 12 s 2590 783 0 ) insert ( 10348 2595 718 600 15 o 3291 783 1970 ) insert ( 10349 2745 2277 2277 1 s 2750 2742 0 ) insert ( 10350 2745 2277 2277 2 s 2751 2742 0 ) insert ( 10351 2745 2277 2277 3 s 2752 2742 0 ) insert ( 10352 2745 2277 2277 4 s 1070 2742 0 ) insert ( 10353 3522 3500 3500 1 s 3518 403 0 ) insert ( 10354 3522 3500 3500 2 s 3520 403 0 ) insert ( 10355 3522 3500 3500 3 s 3516 403 0 ) insert ( 10356 3522 3500 3500 4 s 3521 403 0 ) insert ( 10357 3522 3500 3500 5 s 3519 403 0 ) insert ( 10358 3523 3500 3500 1 s 3516 405 0 ) insert ( 10359 3626 3614 3614 1 s 3627 403 0 ) insert ( 10360 3626 3614 3614 2 s 3628 403 0 ) insert ( 10361 3626 3614 3614 3 s 3629 403 0 ) insert ( 10362 3626 3614 3614 4 s 3631 403 0 ) insert ( 10363 3626 3614 3614 5 s 3632 403 0 ) insert ( 10364 3655 3614 3615 1 s 3636 783 0 ) insert ( 10365 3659 3614 3615 1 s 3636 2742 0 ) insert ( 10366 3659 3614 3615 2 s 3660 2742 0 ) insert ( 10367 3683 3615 3615 1 s 3674 403 0 ) insert ( 10368 3683 3615 3615 2 s 3675 403 0 ) insert ( 10369 3683 3615 3615 3 s 3676 403 0 ) insert ( 10370 3683 3615 3615 4 s 3678 403 0 ) insert ( 10371 3683 3615 3615 5 s 3679 403 0 ) insert ( 10372 3702 3615 3615 7 s 3693 783 0 ) insert ( 10373 3702 3615 3615 8 s 3694 783 0 ) insert ( 10374 3901 3831 3831 1 s 3884 403 0 ) insert ( 10375 3901 3831 3831 2 s 3885 403 0 ) insert ( 10376 3901 3831 3831 3 s 3882 403 0 ) insert ( 10377 3901 3831 3831 4 s 3886 403 0 ) insert ( 10378 3901 3831 3831 5 s 3887 403 0 ) insert ( 10379 3903 3831 3831 1 s 3882 405 0 ) insert ( 10380 3919 3831 3831 1 s 3893 783 0 ) insert ( 10381 3919 3831 4537 1 s 4395 783 0 ) insert ( 10382 3919 3831 3831 2 s 3895 783 0 ) insert ( 10383 3919 3831 4537 2 s 2875 783 0 ) insert ( 10384 3919 3831 3831 3 s 3888 783 0 ) insert ( 10385 3919 3831 4537 3 s 2866 783 0 ) insert ( 10386 3919 3831 3831 4 s 3896 783 0 ) insert ( 10387 3919 3831 4537 4 s 3585 783 0 ) insert ( 10388 3919 3831 3831 5 s 3894 783 0 ) insert ( 10389 3919 3831 4537 5 s 4398 783 0 ) insert ( 10390 3919 3831 3831 6 s 3897 783 0 ) insert ( 10391 3919 3831 4537 6 s 4179 783 0 ) insert ( 10392 3919 3831 3831 7 s 3890 783 0 ) insert ( 10393 3919 3831 4537 7 s 4539 783 0 ) insert ( 10394 3919 3831 3831 8 s 3892 783 0 ) insert ( 10395 3919 3831 4537 8 s 2873 783 0 ) insert ( 10396 3919 3831 2283 16 s 3889 783 0 ) insert ( 10397 3919 3831 3831 18 s 3882 783 0 ) insert ( 10398 6158 4537 4537 1 s 4397 783 0 ) insert ( 10399 6158 4537 3831 1 s 4396 783 0 ) insert ( 10400 6158 4537 4537 2 s 2877 783 0 ) insert ( 10401 6158 4537 3831 2 s 2876 783 0 ) insert ( 10402 6158 4537 4537 3 s 2868 783 0 ) insert ( 10403 6158 4537 3831 3 s 2867 783 0 ) insert ( 10404 6158 4537 4537 4 s 4142 783 0 ) insert ( 10405 6158 4537 3831 4 s 4035 783 0 ) insert ( 10406 6158 4537 4537 5 s 4400 783 0 ) insert ( 10407 6158 4537 3831 5 s 4399 783 0 ) insert ( 10408 6158 4537 4537 6 s 4198 783 0 ) insert ( 10409 6158 4537 3831 6 s 4180 783 0 ) insert ( 10410 6158 4537 4537 7 s 2871 783 0 ) insert ( 10411 6158 4537 3831 7 s 2870 783 0 ) insert ( 10412 6158 4537 4537 8 s 2874 783 0 ) insert ( 10413 6158 4537 3831 8 s 4540 783 0 ) insert ( 10414 6158 4537 2283 16 s 2869 783 0 ) insert ( 10415 6158 4537 4537 18 s 2860 783 0 ) insert ( 10416 4199 4537 4537 1 s 2862 403 0 ) insert ( 10417 4199 4537 4537 2 s 2863 403 0 ) insert ( 10418 4199 4537 4537 3 s 2860 403 0 ) insert ( 10419 4199 4537 4537 4 s 2864 403 0 ) insert ( 10420 4199 4537 4537 5 s 2865 403 0 ) insert ( 10421 4225 4537 4537 1 s 2860 405 0 ) insert ( 10422 4015 600 600 11 s 4161 4000 0 ) insert ( 10423 4015 600 600 30 s 506 4000 0 ) insert ( 10424 4015 600 600 1 s 507 4000 0 ) insert ( 10425 4015 600 600 5 s 508 4000 0 ) insert ( 10426 4015 600 600 10 s 4162 4000 0 ) insert ( 10427 4015 600 600 29 s 509 4000 0 ) insert ( 10428 4015 600 600 6 s 510 4000 0 ) insert ( 10429 4015 600 603 8 s 511 4000 0 ) insert ( 10430 4015 600 600 15 o 517 4000 1970 ) insert ( 10431 4016 600 600 11 s 4161 4000 0 ) insert ( 10432 4016 600 600 30 s 506 4000 0 ) insert ( 10433 4016 600 600 1 s 507 4000 0 ) insert ( 10434 4016 600 600 5 s 508 4000 0 ) insert ( 10435 4016 600 600 10 s 4162 4000 0 ) insert ( 10436 4016 600 600 29 s 509 4000 0 ) insert ( 10437 4016 600 600 6 s 510 4000 0 ) insert ( 10438 4016 600 603 8 s 511 4000 0 ) insert ( 10439 4016 600 600 15 o 517 4000 1970 ) insert ( 10440 4017 25 25 1 s 2314 4000 0 ) insert ( 10441 4017 25 25 2 s 2315 4000 0 ) insert ( 10442 4017 25 25 3 s 98 4000 0 ) insert ( 10443 4017 25 25 4 s 2317 4000 0 ) insert ( 10444 4017 25 25 5 s 2318 4000 0 ) insert ( 10445 4017 25 25 11 s 664 4000 0 ) insert ( 10446 4017 25 25 12 s 665 4000 0 ) insert ( 10447 4017 25 25 14 s 667 4000 0 ) insert ( 10448 4017 25 25 15 s 666 4000 0 ) insert ( 10449 4017 25 25 28 s 3877 4000 0 ) insert ( 10450 4033 3802 3802 1 s 3242 403 0 ) insert ( 10451 4033 3802 3802 2 s 3244 403 0 ) insert ( 10452 4033 3802 3802 3 s 3240 403 0 ) insert ( 10453 4033 3802 3802 4 s 3245 403 0 ) insert ( 10454 4033 3802 3802 5 s 3243 403 0 ) insert ( 10455 4034 3802 3802 1 s 3240 405 0 ) insert ( 10456 4036 3802 3802 7 s 3246 2742 0 ) insert ( 10457 4036 3802 25 9 s 3247 2742 0 ) insert ( 10458 4036 3802 1009 10 s 3248 2742 0 ) insert ( 10459 4036 3802 1009 11 s 3249 2742 0 ) insert ( 10460 4036 3802 4072 15 s 4012 2742 0 ) insert ( 10461 4036 3802 4072 16 s 4013 2742 0 ) insert ( 10462 4037 3802 3802 7 s 3246 2742 0 ) insert ( 10463 4037 3802 4072 15 s 4012 2742 0 ) insert ( 10464 4037 3802 4072 16 s 4013 2742 0 ) insert ( 10465 3474 3831 3831 1 s 3893 4000 0 ) insert ( 10466 3474 3831 3831 2 s 3895 4000 0 ) insert ( 10467 3474 3831 3831 3 s 3888 4000 0 ) insert ( 10468 3474 3831 3831 4 s 3896 4000 0 ) insert ( 10469 3474 3831 3831 5 s 3894 4000 0 ) insert ( 10470 3474 3831 3831 6 s 3897 4000 0 ) insert ( 10471 3474 3831 3831 7 s 3890 4000 0 ) insert ( 10472 3474 3831 3831 8 s 3892 4000 0 ) insert ( 10473 3474 3831 2283 16 s 3889 4000 0 ) insert ( 10474 3474 3831 3831 18 s 3882 4000 0 ) insert ( 10475 5000 603 603 1 s 493 4000 0 ) insert ( 10476 5000 603 603 2 s 494 4000 0 ) insert ( 10477 5000 603 603 3 s 500 4000 0 ) insert ( 10478 5000 603 603 4 s 495 4000 0 ) insert ( 10479 5000 603 603 5 s 496 4000 0 ) insert ( 10480 5000 603 603 6 s 499 4000 0 ) insert ( 10481 5000 603 603 7 s 498 4000 0 ) insert ( 10482 5000 603 603 8 s 497 4000 0 ) insert ( 10483 5000 603 603 9 s 2571 4000 0 ) insert ( 10484 5000 603 603 10 s 2570 4000 0 ) insert ( 10485 5000 603 603 11 s 2573 4000 0 ) insert ( 10486 5000 603 603 12 s 2572 4000 0 ) insert ( 10487 5000 603 600 15 o 606 4000 1970 ) insert ( 10488 5008 604 604 1 s 485 4000 0 ) insert ( 10489 5008 604 604 2 s 486 4000 0 ) insert ( 10490 5008 604 604 3 s 492 4000 0 ) insert ( 10491 5008 604 604 4 s 487 4000 0 ) insert ( 10492 5008 604 604 5 s 488 4000 0 ) insert ( 10493 5008 604 604 6 s 491 4000 0 ) insert ( 10494 5008 604 604 7 s 490 4000 0 ) insert ( 10495 5008 604 604 8 s 489 4000 0 ) insert ( 10496 5008 604 604 9 s 2575 4000 0 ) insert ( 10497 5008 604 604 10 s 2574 4000 0 ) insert ( 10498 5008 604 604 11 s 2577 4000 0 ) insert ( 10499 5008 604 604 12 s 2576 4000 0 ) insert ( 10500 5008 604 600 15 o 3289 4000 1970 ) insert ( 10501 3550 869 869 3 s 3552 783 0 ) insert ( 10502 3550 869 869 18 s 1201 783 0 ) insert ( 10503 3550 869 869 19 s 1202 783 0 ) insert ( 10504 3550 869 869 20 s 1203 783 0 ) insert ( 10505 3550 869 869 21 s 1204 783 0 ) insert ( 10506 3550 869 869 22 s 1205 783 0 ) insert ( 10507 3550 869 869 23 s 1206 783 0 ) insert ( 10508 3550 869 869 24 s 931 783 0 ) insert ( 10509 3550 869 869 25 s 932 783 0 ) insert ( 10510 3550 869 869 26 s 933 783 0 ) insert ( 10511 3550 869 869 27 s 934 783 0 ) insert ( 10512 3794 869 869 3 s 3552 4000 0 ) insert ( 10513 3794 869 869 18 s 1201 4000 0 ) insert ( 10514 3794 869 869 19 s 1202 4000 0 ) insert ( 10515 3794 869 869 20 s 1203 4000 0 ) insert ( 10516 3794 869 869 21 s 1204 4000 0 ) insert ( 10517 3794 869 869 22 s 1205 4000 0 ) insert ( 10518 3794 869 869 23 s 1206 4000 0 ) insert ( 10519 3794 869 869 24 s 931 4000 0 ) insert ( 10520 3794 869 869 25 s 932 4000 0 ) insert ( 10521 3794 869 869 26 s 933 4000 0 ) insert ( 10522 3794 869 869 27 s 934 4000 0 ) insert ( 10523 4064 17 17 1 s 1957 3580 0 ) insert ( 10524 4064 17 17 2 s 1958 3580 0 ) insert ( 10525 4064 17 17 3 s 1955 3580 0 ) insert ( 10526 4064 17 17 4 s 1960 3580 0 ) insert ( 10527 4064 17 17 5 s 1959 3580 0 ) insert ( 10528 4578 17 17 1 s 1955 3580 0 ) insert ( 10529 4062 18 18 1 s 631 3580 0 ) insert ( 10530 4062 18 18 2 s 632 3580 0 ) insert ( 10531 4062 18 18 3 s 92 3580 0 ) insert ( 10532 4062 18 18 4 s 634 3580 0 ) insert ( 10533 4062 18 18 5 s 633 3580 0 ) insert ( 10534 4577 18 18 1 s 92 3580 0 ) insert ( 10535 4065 19 19 1 s 660 3580 0 ) insert ( 10536 4065 19 19 2 s 661 3580 0 ) insert ( 10537 4065 19 19 3 s 93 3580 0 ) insert ( 10538 4065 19 19 4 s 663 3580 0 ) insert ( 10539 4065 19 19 5 s 662 3580 0 ) insert ( 10540 4579 19 19 1 s 93 3580 0 ) insert ( 10541 4054 20 20 1 s 412 3580 0 ) insert ( 10542 4054 20 20 2 s 414 3580 0 ) insert ( 10543 4054 20 20 3 s 410 3580 0 ) insert ( 10544 4054 20 20 4 s 415 3580 0 ) insert ( 10545 4054 20 20 5 s 413 3580 0 ) insert ( 10546 4054 20 21 1 s 1870 3580 0 ) insert ( 10547 4054 20 21 2 s 1872 3580 0 ) insert ( 10548 4054 20 21 3 s 1868 3580 0 ) insert ( 10549 4054 20 21 4 s 1873 3580 0 ) insert ( 10550 4054 20 21 5 s 1871 3580 0 ) insert ( 10551 4054 20 23 1 s 418 3580 0 ) insert ( 10552 4054 20 23 2 s 420 3580 0 ) insert ( 10553 4054 20 23 3 s 416 3580 0 ) insert ( 10554 4054 20 23 4 s 430 3580 0 ) insert ( 10555 4054 20 23 5 s 419 3580 0 ) insert ( 10556 4054 21 21 1 s 95 3580 0 ) insert ( 10557 4054 21 21 2 s 522 3580 0 ) insert ( 10558 4054 21 21 3 s 94 3580 0 ) insert ( 10559 4054 21 21 4 s 524 3580 0 ) insert ( 10560 4054 21 21 5 s 520 3580 0 ) insert ( 10561 4054 21 20 1 s 1864 3580 0 ) insert ( 10562 4054 21 20 2 s 1866 3580 0 ) insert ( 10563 4054 21 20 3 s 1862 3580 0 ) insert ( 10564 4054 21 20 4 s 1867 3580 0 ) insert ( 10565 4054 21 20 5 s 1865 3580 0 ) insert ( 10566 4054 21 23 1 s 534 3580 0 ) insert ( 10567 4054 21 23 2 s 540 3580 0 ) insert ( 10568 4054 21 23 3 s 532 3580 0 ) insert ( 10569 4054 21 23 4 s 542 3580 0 ) insert ( 10570 4054 21 23 5 s 536 3580 0 ) insert ( 10571 4054 23 23 1 s 97 3580 0 ) insert ( 10572 4054 23 23 2 s 523 3580 0 ) insert ( 10573 4054 23 23 3 s 96 3580 0 ) insert ( 10574 4054 23 23 4 s 525 3580 0 ) insert ( 10575 4054 23 23 5 s 521 3580 0 ) insert ( 10576 4054 23 21 1 s 535 3580 0 ) insert ( 10577 4054 23 21 2 s 541 3580 0 ) insert ( 10578 4054 23 21 3 s 533 3580 0 ) insert ( 10579 4054 23 21 4 s 543 3580 0 ) insert ( 10580 4054 23 21 5 s 537 3580 0 ) insert ( 10581 4054 23 20 1 s 37 3580 0 ) insert ( 10582 4054 23 20 2 s 80 3580 0 ) insert ( 10583 4054 23 20 3 s 15 3580 0 ) insert ( 10584 4054 23 20 4 s 82 3580 0 ) insert ( 10585 4054 23 20 5 s 76 3580 0 ) insert ( 10586 4602 20 20 1 s 412 3580 0 ) insert ( 10587 4602 20 20 2 s 414 3580 0 ) insert ( 10588 4602 20 20 3 s 410 3580 0 ) insert ( 10589 4602 20 20 4 s 415 3580 0 ) insert ( 10590 4602 20 20 5 s 413 3580 0 ) insert ( 10591 4602 20 21 1 s 1870 3580 0 ) insert ( 10592 4602 20 21 2 s 1872 3580 0 ) insert ( 10593 4602 20 21 3 s 1868 3580 0 ) insert ( 10594 4602 20 21 4 s 1873 3580 0 ) insert ( 10595 4602 20 21 5 s 1871 3580 0 ) insert ( 10596 4602 20 23 1 s 418 3580 0 ) insert ( 10597 4602 20 23 2 s 420 3580 0 ) insert ( 10598 4602 20 23 3 s 416 3580 0 ) insert ( 10599 4602 20 23 4 s 430 3580 0 ) insert ( 10600 4602 20 23 5 s 419 3580 0 ) insert ( 10601 4602 21 21 1 s 95 3580 0 ) insert ( 10602 4602 21 21 2 s 522 3580 0 ) insert ( 10603 4602 21 21 3 s 94 3580 0 ) insert ( 10604 4602 21 21 4 s 524 3580 0 ) insert ( 10605 4602 21 21 5 s 520 3580 0 ) insert ( 10606 4602 21 20 1 s 1864 3580 0 ) insert ( 10607 4602 21 20 2 s 1866 3580 0 ) insert ( 10608 4602 21 20 3 s 1862 3580 0 ) insert ( 10609 4602 21 20 4 s 1867 3580 0 ) insert ( 10610 4602 21 20 5 s 1865 3580 0 ) insert ( 10611 4602 21 23 1 s 534 3580 0 ) insert ( 10612 4602 21 23 2 s 540 3580 0 ) insert ( 10613 4602 21 23 3 s 532 3580 0 ) insert ( 10614 4602 21 23 4 s 542 3580 0 ) insert ( 10615 4602 21 23 5 s 536 3580 0 ) insert ( 10616 4602 23 23 1 s 97 3580 0 ) insert ( 10617 4602 23 23 2 s 523 3580 0 ) insert ( 10618 4602 23 23 3 s 96 3580 0 ) insert ( 10619 4602 23 23 4 s 525 3580 0 ) insert ( 10620 4602 23 23 5 s 521 3580 0 ) insert ( 10621 4602 23 21 1 s 535 3580 0 ) insert ( 10622 4602 23 21 2 s 541 3580 0 ) insert ( 10623 4602 23 21 3 s 533 3580 0 ) insert ( 10624 4602 23 21 4 s 543 3580 0 ) insert ( 10625 4602 23 21 5 s 537 3580 0 ) insert ( 10626 4602 23 20 1 s 37 3580 0 ) insert ( 10627 4602 23 20 2 s 80 3580 0 ) insert ( 10628 4602 23 20 3 s 15 3580 0 ) insert ( 10629 4602 23 20 4 s 82 3580 0 ) insert ( 10630 4602 23 20 5 s 76 3580 0 ) insert ( 10631 4572 20 20 1 s 410 3580 0 ) insert ( 10632 4572 21 21 1 s 94 3580 0 ) insert ( 10633 4572 23 23 1 s 96 3580 0 ) insert ( 10634 4056 25 25 1 s 664 3580 0 ) insert ( 10635 4056 25 25 2 s 665 3580 0 ) insert ( 10636 4056 25 25 3 s 98 3580 0 ) insert ( 10637 4056 25 25 4 s 667 3580 0 ) insert ( 10638 4056 25 25 5 s 666 3580 0 ) insert ( 10639 4573 25 25 1 s 98 3580 0 ) insert ( 10640 4068 26 26 1 s 609 3580 0 ) insert ( 10641 4068 26 26 2 s 611 3580 0 ) insert ( 10642 4068 26 26 3 s 607 3580 0 ) insert ( 10643 4068 26 26 4 s 612 3580 0 ) insert ( 10644 4068 26 26 5 s 610 3580 0 ) insert ( 10645 4606 26 26 1 s 609 3580 0 ) insert ( 10646 4606 26 26 2 s 611 3580 0 ) insert ( 10647 4606 26 26 3 s 607 3580 0 ) insert ( 10648 4606 26 26 4 s 612 3580 0 ) insert ( 10649 4606 26 26 5 s 610 3580 0 ) insert ( 10650 4580 26 26 1 s 607 3580 0 ) insert ( 10651 4069 27 27 1 s 2799 3580 0 ) insert ( 10652 4069 27 27 2 s 2801 3580 0 ) insert ( 10653 4069 27 27 3 s 387 3580 0 ) insert ( 10654 4069 27 27 4 s 2802 3580 0 ) insert ( 10655 4069 27 27 5 s 2800 3580 0 ) insert ( 10656 4581 27 27 1 s 387 3580 0 ) insert ( 10657 4607 27 27 1 s 2799 3580 0 ) insert ( 10658 4607 27 27 2 s 2801 3580 0 ) insert ( 10659 4607 27 27 3 s 387 3580 0 ) insert ( 10660 4607 27 27 4 s 2802 3580 0 ) insert ( 10661 4607 27 27 5 s 2800 3580 0 ) insert ( 10662 4070 700 700 1 s 622 3580 0 ) insert ( 10663 4070 700 700 2 s 624 3580 0 ) insert ( 10664 4070 700 700 3 s 620 3580 0 ) insert ( 10665 4070 700 700 4 s 625 3580 0 ) insert ( 10666 4070 700 700 5 s 623 3580 0 ) insert ( 10667 4070 700 701 1 s 1122 3580 0 ) insert ( 10668 4070 700 701 2 s 1124 3580 0 ) insert ( 10669 4070 700 701 3 s 1120 3580 0 ) insert ( 10670 4070 700 701 4 s 1125 3580 0 ) insert ( 10671 4070 700 701 5 s 1123 3580 0 ) insert ( 10672 4070 701 700 1 s 1132 3580 0 ) insert ( 10673 4070 701 700 2 s 1134 3580 0 ) insert ( 10674 4070 701 700 3 s 1130 3580 0 ) insert ( 10675 4070 701 700 4 s 1135 3580 0 ) insert ( 10676 4070 701 700 5 s 1133 3580 0 ) insert ( 10677 4070 701 701 1 s 672 3580 0 ) insert ( 10678 4070 701 701 2 s 673 3580 0 ) insert ( 10679 4070 701 701 3 s 670 3580 0 ) insert ( 10680 4070 701 701 4 s 675 3580 0 ) insert ( 10681 4070 701 701 5 s 674 3580 0 ) insert ( 10682 4608 700 700 1 s 622 3580 0 ) insert ( 10683 4608 700 700 2 s 624 3580 0 ) insert ( 10684 4608 700 700 3 s 620 3580 0 ) insert ( 10685 4608 700 700 4 s 625 3580 0 ) insert ( 10686 4608 700 700 5 s 623 3580 0 ) insert ( 10687 4608 700 701 1 s 1122 3580 0 ) insert ( 10688 4608 700 701 2 s 1124 3580 0 ) insert ( 10689 4608 700 701 3 s 1120 3580 0 ) insert ( 10690 4608 700 701 4 s 1125 3580 0 ) insert ( 10691 4608 700 701 5 s 1123 3580 0 ) insert ( 10692 4608 701 700 1 s 1132 3580 0 ) insert ( 10693 4608 701 700 2 s 1134 3580 0 ) insert ( 10694 4608 701 700 3 s 1130 3580 0 ) insert ( 10695 4608 701 700 4 s 1135 3580 0 ) insert ( 10696 4608 701 700 5 s 1133 3580 0 ) insert ( 10697 4608 701 701 1 s 672 3580 0 ) insert ( 10698 4608 701 701 2 s 673 3580 0 ) insert ( 10699 4608 701 701 3 s 670 3580 0 ) insert ( 10700 4608 701 701 4 s 675 3580 0 ) insert ( 10701 4608 701 701 5 s 674 3580 0 ) insert ( 10702 4582 700 700 1 s 620 3580 0 ) insert ( 10703 4582 701 701 1 s 670 3580 0 ) insert ( 10704 4074 829 829 1 s 1222 3580 0 ) insert ( 10705 4074 829 829 2 s 1223 3580 0 ) insert ( 10706 4074 829 829 3 s 1220 3580 0 ) insert ( 10707 4074 829 829 4 s 1225 3580 0 ) insert ( 10708 4074 829 829 5 s 1224 3580 0 ) insert ( 10709 4609 829 829 1 s 1222 3580 0 ) insert ( 10710 4609 829 829 2 s 1223 3580 0 ) insert ( 10711 4609 829 829 3 s 1220 3580 0 ) insert ( 10712 4609 829 829 4 s 1225 3580 0 ) insert ( 10713 4609 829 829 5 s 1224 3580 0 ) insert ( 10714 4583 829 829 1 s 1220 3580 0 ) insert ( 10715 4109 774 774 1 s 3364 3580 0 ) insert ( 10716 4109 774 774 2 s 3365 3580 0 ) insert ( 10717 4109 774 774 3 s 3362 3580 0 ) insert ( 10718 4109 774 774 4 s 3367 3580 0 ) insert ( 10719 4109 774 774 5 s 3366 3580 0 ) insert ( 10720 4610 774 774 1 s 3364 3580 0 ) insert ( 10721 4610 774 774 2 s 3365 3580 0 ) insert ( 10722 4610 774 774 3 s 3362 3580 0 ) insert ( 10723 4610 774 774 4 s 3367 3580 0 ) insert ( 10724 4610 774 774 5 s 3366 3580 0 ) insert ( 10725 4584 774 774 1 s 3362 3580 0 ) insert ( 10726 4075 869 869 1 s 1203 3580 0 ) insert ( 10727 4075 869 869 2 s 1204 3580 0 ) insert ( 10728 4075 869 869 3 s 1201 3580 0 ) insert ( 10729 4075 869 869 4 s 1206 3580 0 ) insert ( 10730 4075 869 869 5 s 1205 3580 0 ) insert ( 10731 4611 869 869 1 s 1203 3580 0 ) insert ( 10732 4611 869 869 2 s 1204 3580 0 ) insert ( 10733 4611 869 869 3 s 1201 3580 0 ) insert ( 10734 4611 869 869 4 s 1206 3580 0 ) insert ( 10735 4611 869 869 5 s 1205 3580 0 ) insert ( 10736 4585 869 869 1 s 1201 3580 0 ) insert ( 10737 4102 869 869 3 s 3552 3580 0 ) insert ( 10738 4102 869 869 7 s 934 3580 0 ) insert ( 10739 4102 869 869 8 s 932 3580 0 ) insert ( 10740 4102 869 869 18 s 1201 3580 0 ) insert ( 10741 4102 869 869 24 s 933 3580 0 ) insert ( 10742 4102 869 869 26 s 931 3580 0 ) insert ( 10743 4076 1042 1042 1 s 1058 3580 0 ) insert ( 10744 4076 1042 1042 2 s 1059 3580 0 ) insert ( 10745 4076 1042 1042 3 s 1054 3580 0 ) insert ( 10746 4076 1042 1042 4 s 1061 3580 0 ) insert ( 10747 4076 1042 1042 5 s 1060 3580 0 ) insert ( 10748 4586 1042 1042 1 s 1054 3580 0 ) insert ( 10749 4077 1083 1083 1 s 1110 3580 0 ) insert ( 10750 4077 1083 1083 2 s 1111 3580 0 ) insert ( 10751 4077 1083 1083 3 s 1108 3580 0 ) insert ( 10752 4077 1083 1083 4 s 1113 3580 0 ) insert ( 10753 4077 1083 1083 5 s 1112 3580 0 ) insert ( 10754 4612 1083 1083 1 s 1110 3580 0 ) insert ( 10755 4612 1083 1083 2 s 1111 3580 0 ) insert ( 10756 4612 1083 1083 3 s 1108 3580 0 ) insert ( 10757 4612 1083 1083 4 s 1113 3580 0 ) insert ( 10758 4612 1083 1083 5 s 1112 3580 0 ) insert ( 10759 4587 1083 1083 1 s 1108 3580 0 ) insert ( 10760 4059 1114 1114 1 s 2062 3580 0 ) insert ( 10761 4059 1114 1114 2 s 2063 3580 0 ) insert ( 10762 4059 1114 1114 3 s 2060 3580 0 ) insert ( 10763 4059 1114 1114 4 s 2065 3580 0 ) insert ( 10764 4059 1114 1114 5 s 2064 3580 0 ) insert ( 10765 4059 1114 1082 1 s 2371 3580 0 ) insert ( 10766 4059 1114 1082 2 s 2372 3580 0 ) insert ( 10767 4059 1114 1082 3 s 2373 3580 0 ) insert ( 10768 4059 1114 1082 4 s 2374 3580 0 ) insert ( 10769 4059 1114 1082 5 s 2375 3580 0 ) insert ( 10770 4059 1114 1184 1 s 2534 3580 0 ) insert ( 10771 4059 1114 1184 2 s 2535 3580 0 ) insert ( 10772 4059 1114 1184 3 s 2536 3580 0 ) insert ( 10773 4059 1114 1184 4 s 2537 3580 0 ) insert ( 10774 4059 1114 1184 5 s 2538 3580 0 ) insert ( 10775 4059 1082 1082 1 s 1095 3580 0 ) insert ( 10776 4059 1082 1082 2 s 1096 3580 0 ) insert ( 10777 4059 1082 1082 3 s 1093 3580 0 ) insert ( 10778 4059 1082 1082 4 s 1098 3580 0 ) insert ( 10779 4059 1082 1082 5 s 1097 3580 0 ) insert ( 10780 4059 1082 1114 1 s 2345 3580 0 ) insert ( 10781 4059 1082 1114 2 s 2346 3580 0 ) insert ( 10782 4059 1082 1114 3 s 2347 3580 0 ) insert ( 10783 4059 1082 1114 4 s 2348 3580 0 ) insert ( 10784 4059 1082 1114 5 s 2349 3580 0 ) insert ( 10785 4059 1082 1184 1 s 2358 3580 0 ) insert ( 10786 4059 1082 1184 2 s 2359 3580 0 ) insert ( 10787 4059 1082 1184 3 s 2360 3580 0 ) insert ( 10788 4059 1082 1184 4 s 2361 3580 0 ) insert ( 10789 4059 1082 1184 5 s 2362 3580 0 ) insert ( 10790 4059 1184 1082 1 s 2384 3580 0 ) insert ( 10791 4059 1184 1082 2 s 2385 3580 0 ) insert ( 10792 4059 1184 1082 3 s 2386 3580 0 ) insert ( 10793 4059 1184 1082 4 s 2387 3580 0 ) insert ( 10794 4059 1184 1082 5 s 2388 3580 0 ) insert ( 10795 4059 1184 1114 1 s 2540 3580 0 ) insert ( 10796 4059 1184 1114 2 s 2541 3580 0 ) insert ( 10797 4059 1184 1114 3 s 2542 3580 0 ) insert ( 10798 4059 1184 1114 4 s 2543 3580 0 ) insert ( 10799 4059 1184 1114 5 s 2544 3580 0 ) insert ( 10800 4059 1184 1184 1 s 1322 3580 0 ) insert ( 10801 4059 1184 1184 2 s 1323 3580 0 ) insert ( 10802 4059 1184 1184 3 s 1320 3580 0 ) insert ( 10803 4059 1184 1184 4 s 1325 3580 0 ) insert ( 10804 4059 1184 1184 5 s 1324 3580 0 ) insert ( 10805 4605 1114 1114 1 s 2062 3580 0 ) insert ( 10806 4605 1114 1114 2 s 2063 3580 0 ) insert ( 10807 4605 1114 1114 3 s 2060 3580 0 ) insert ( 10808 4605 1114 1114 4 s 2065 3580 0 ) insert ( 10809 4605 1114 1114 5 s 2064 3580 0 ) insert ( 10810 4605 1114 1082 1 s 2371 3580 0 ) insert ( 10811 4605 1114 1082 2 s 2372 3580 0 ) insert ( 10812 4605 1114 1082 3 s 2373 3580 0 ) insert ( 10813 4605 1114 1082 4 s 2374 3580 0 ) insert ( 10814 4605 1114 1082 5 s 2375 3580 0 ) insert ( 10815 4605 1114 1184 1 s 2534 3580 0 ) insert ( 10816 4605 1114 1184 2 s 2535 3580 0 ) insert ( 10817 4605 1114 1184 3 s 2536 3580 0 ) insert ( 10818 4605 1114 1184 4 s 2537 3580 0 ) insert ( 10819 4605 1114 1184 5 s 2538 3580 0 ) insert ( 10820 4605 1082 1082 1 s 1095 3580 0 ) insert ( 10821 4605 1082 1082 2 s 1096 3580 0 ) insert ( 10822 4605 1082 1082 3 s 1093 3580 0 ) insert ( 10823 4605 1082 1082 4 s 1098 3580 0 ) insert ( 10824 4605 1082 1082 5 s 1097 3580 0 ) insert ( 10825 4605 1082 1114 1 s 2345 3580 0 ) insert ( 10826 4605 1082 1114 2 s 2346 3580 0 ) insert ( 10827 4605 1082 1114 3 s 2347 3580 0 ) insert ( 10828 4605 1082 1114 4 s 2348 3580 0 ) insert ( 10829 4605 1082 1114 5 s 2349 3580 0 ) insert ( 10830 4605 1082 1184 1 s 2358 3580 0 ) insert ( 10831 4605 1082 1184 2 s 2359 3580 0 ) insert ( 10832 4605 1082 1184 3 s 2360 3580 0 ) insert ( 10833 4605 1082 1184 4 s 2361 3580 0 ) insert ( 10834 4605 1082 1184 5 s 2362 3580 0 ) insert ( 10835 4605 1184 1082 1 s 2384 3580 0 ) insert ( 10836 4605 1184 1082 2 s 2385 3580 0 ) insert ( 10837 4605 1184 1082 3 s 2386 3580 0 ) insert ( 10838 4605 1184 1082 4 s 2387 3580 0 ) insert ( 10839 4605 1184 1082 5 s 2388 3580 0 ) insert ( 10840 4605 1184 1114 1 s 2540 3580 0 ) insert ( 10841 4605 1184 1114 2 s 2541 3580 0 ) insert ( 10842 4605 1184 1114 3 s 2542 3580 0 ) insert ( 10843 4605 1184 1114 4 s 2543 3580 0 ) insert ( 10844 4605 1184 1114 5 s 2544 3580 0 ) insert ( 10845 4605 1184 1184 1 s 1322 3580 0 ) insert ( 10846 4605 1184 1184 2 s 1323 3580 0 ) insert ( 10847 4605 1184 1184 3 s 1320 3580 0 ) insert ( 10848 4605 1184 1184 4 s 1325 3580 0 ) insert ( 10849 4605 1184 1184 5 s 1324 3580 0 ) insert ( 10850 4576 1114 1114 1 s 2060 3580 0 ) insert ( 10851 4576 1082 1082 1 s 1093 3580 0 ) insert ( 10852 4576 1184 1184 1 s 1320 3580 0 ) insert ( 10853 4078 1186 1186 1 s 1332 3580 0 ) insert ( 10854 4078 1186 1186 2 s 1333 3580 0 ) insert ( 10855 4078 1186 1186 3 s 1330 3580 0 ) insert ( 10856 4078 1186 1186 4 s 1335 3580 0 ) insert ( 10857 4078 1186 1186 5 s 1334 3580 0 ) insert ( 10858 4613 1186 1186 1 s 1332 3580 0 ) insert ( 10859 4613 1186 1186 2 s 1333 3580 0 ) insert ( 10860 4613 1186 1186 3 s 1330 3580 0 ) insert ( 10861 4613 1186 1186 4 s 1335 3580 0 ) insert ( 10862 4613 1186 1186 5 s 1334 3580 0 ) insert ( 10863 4588 1186 1186 1 s 1330 3580 0 ) insert ( 10864 4058 1266 1266 1 s 1552 3580 0 ) insert ( 10865 4058 1266 1266 2 s 1553 3580 0 ) insert ( 10866 4058 1266 1266 3 s 1550 3580 0 ) insert ( 10867 4058 1266 1266 4 s 1555 3580 0 ) insert ( 10868 4058 1266 1266 5 s 1554 3580 0 ) insert ( 10869 4604 1266 1266 1 s 1552 3580 0 ) insert ( 10870 4604 1266 1266 2 s 1553 3580 0 ) insert ( 10871 4604 1266 1266 3 s 1550 3580 0 ) insert ( 10872 4604 1266 1266 4 s 1555 3580 0 ) insert ( 10873 4604 1266 1266 5 s 1554 3580 0 ) insert ( 10874 4575 1266 1266 1 s 1550 3580 0 ) insert ( 10875 4079 1560 1560 1 s 1786 3580 0 ) insert ( 10876 4079 1560 1560 2 s 1788 3580 0 ) insert ( 10877 4079 1560 1560 3 s 1784 3580 0 ) insert ( 10878 4079 1560 1560 4 s 1789 3580 0 ) insert ( 10879 4079 1560 1560 5 s 1787 3580 0 ) insert ( 10880 4080 1562 1562 1 s 1806 3580 0 ) insert ( 10881 4080 1562 1562 2 s 1808 3580 0 ) insert ( 10882 4080 1562 1562 3 s 1804 3580 0 ) insert ( 10883 4080 1562 1562 4 s 1809 3580 0 ) insert ( 10884 4080 1562 1562 5 s 1807 3580 0 ) insert ( 10885 4055 1700 1700 1 s 1754 3580 0 ) insert ( 10886 4055 1700 1700 2 s 1755 3580 0 ) insert ( 10887 4055 1700 1700 3 s 1752 3580 0 ) insert ( 10888 4055 1700 1700 4 s 1757 3580 0 ) insert ( 10889 4055 1700 1700 5 s 1756 3580 0 ) insert ( 10890 4603 1700 1700 1 s 1754 3580 0 ) insert ( 10891 4603 1700 1700 2 s 1755 3580 0 ) insert ( 10892 4603 1700 1700 3 s 1752 3580 0 ) insert ( 10893 4603 1700 1700 4 s 1757 3580 0 ) insert ( 10894 4603 1700 1700 5 s 1756 3580 0 ) insert ( 10895 4574 1700 1700 1 s 1752 3580 0 ) insert ( 10896 4081 2950 2950 1 s 2974 3580 0 ) insert ( 10897 4081 2950 2950 2 s 2976 3580 0 ) insert ( 10898 4081 2950 2950 3 s 2972 3580 0 ) insert ( 10899 4081 2950 2950 4 s 2977 3580 0 ) insert ( 10900 4081 2950 2950 5 s 2975 3580 0 ) insert ( 10901 4614 2950 2950 1 s 2974 3580 0 ) insert ( 10902 4614 2950 2950 2 s 2976 3580 0 ) insert ( 10903 4614 2950 2950 3 s 2972 3580 0 ) insert ( 10904 4614 2950 2950 4 s 2977 3580 0 ) insert ( 10905 4614 2950 2950 5 s 2975 3580 0 ) insert ( 10906 4589 2950 2950 1 s 2972 3580 0 ) insert ( 10907 4103 3831 3831 1 s 3893 3580 0 ) insert ( 10908 4103 3831 3831 2 s 3895 3580 0 ) insert ( 10909 4103 3831 3831 3 s 3888 3580 0 ) insert ( 10910 4103 3831 3831 4 s 3896 3580 0 ) insert ( 10911 4103 3831 3831 5 s 3894 3580 0 ) insert ( 10912 4103 3831 3831 7 s 3890 3580 0 ) insert ( 10913 4103 3831 3831 8 s 3892 3580 0 ) insert ( 10914 4103 3831 2283 16 s 3889 3580 0 ) insert ( 10915 4103 3831 3831 17 s 3897 3580 0 ) insert ( 10916 4103 3831 3831 18 s 3882 3580 0 ) insert ( 10917 4103 3831 3831 20 s 3884 3580 0 ) insert ( 10918 4103 3831 3831 21 s 3885 3580 0 ) insert ( 10919 4103 3831 3831 22 s 3887 3580 0 ) insert ( 10920 4103 3831 3831 23 s 3886 3580 0 ) insert ( 10921 4082 3220 3220 1 s 3224 3580 0 ) insert ( 10922 4082 3220 3220 2 s 3226 3580 0 ) insert ( 10923 4082 3220 3220 3 s 3222 3580 0 ) insert ( 10924 4082 3220 3220 4 s 3227 3580 0 ) insert ( 10925 4082 3220 3220 5 s 3225 3580 0 ) insert ( 10926 4615 3220 3220 1 s 3224 3580 0 ) insert ( 10927 4615 3220 3220 2 s 3226 3580 0 ) insert ( 10928 4615 3220 3220 3 s 3222 3580 0 ) insert ( 10929 4615 3220 3220 4 s 3227 3580 0 ) insert ( 10930 4615 3220 3220 5 s 3225 3580 0 ) insert ( 10931 4590 3220 3220 1 s 3222 3580 0 ) insert ( 10932 4104 603 603 1 s 493 3580 0 ) insert ( 10933 4104 603 603 2 s 494 3580 0 ) insert ( 10934 4104 603 603 3 s 500 3580 0 ) insert ( 10935 4104 603 603 4 s 495 3580 0 ) insert ( 10936 4104 603 603 5 s 496 3580 0 ) insert ( 10937 4104 603 603 6 s 499 3580 0 ) insert ( 10938 4104 603 603 7 s 498 3580 0 ) insert ( 10939 4104 603 603 8 s 497 3580 0 ) insert ( 10940 4104 603 603 9 s 2571 3580 0 ) insert ( 10941 4104 603 603 10 s 2570 3580 0 ) insert ( 10942 4104 603 603 11 s 2573 3580 0 ) insert ( 10943 4104 603 603 12 s 2572 3580 0 ) insert ( 10944 4104 603 600 7 s 433 3580 0 ) close pg_amop create pg_amproc 2603 ( oid = oid , amprocfamily = oid , amproclefttype = oid , amprocrighttype = oid , amprocnum = int2 , amproc = regproc ) open pg_amproc insert ( 10000 397 2277 2277 1 382 ) insert ( 10001 423 1560 1560 1 1596 ) insert ( 10002 423 1560 1560 4 5051 ) insert ( 10003 424 16 16 1 1693 ) insert ( 10004 424 16 16 4 5051 ) insert ( 10005 426 1042 1042 1 1078 ) insert ( 10006 426 1042 1042 2 3328 ) insert ( 10007 426 1042 1042 4 5050 ) insert ( 10008 428 17 17 1 1954 ) insert ( 10009 428 17 17 2 3331 ) insert ( 10010 428 17 17 4 5051 ) insert ( 10011 429 18 18 1 358 ) insert ( 10012 429 18 18 4 5051 ) insert ( 10013 434 1082 1082 1 1092 ) insert ( 10014 434 1082 1082 2 3136 ) insert ( 10015 434 1082 1082 4 5051 ) insert ( 10016 434 1082 1114 1 2344 ) insert ( 10017 434 1082 1184 1 2357 ) insert ( 10018 434 1114 1114 1 2045 ) insert ( 10019 434 1114 1114 2 3137 ) insert ( 10020 434 1114 1114 4 5051 ) insert ( 10021 434 1114 1082 1 2370 ) insert ( 10022 434 1114 1184 1 2526 ) insert ( 10023 434 1184 1184 1 1314 ) insert ( 10024 434 1184 1184 2 3137 ) insert ( 10025 434 1184 1184 4 5051 ) insert ( 10026 434 1184 1082 1 2383 ) insert ( 10027 434 1184 1114 1 2533 ) insert ( 10028 434 1082 1186 3 4133 ) insert ( 10029 434 1114 1186 3 4134 ) insert ( 10030 434 1184 1186 3 4135 ) insert ( 10031 1970 700 700 1 354 ) insert ( 10032 1970 700 700 2 3132 ) insert ( 10033 1970 700 701 1 2194 ) insert ( 10034 1970 701 701 1 355 ) insert ( 10035 1970 701 701 2 3133 ) insert ( 10036 1970 701 700 1 2195 ) insert ( 10037 1970 701 701 3 4139 ) insert ( 10038 1970 700 701 3 4140 ) insert ( 10039 1974 869 869 1 926 ) insert ( 10040 1974 869 869 2 5033 ) insert ( 10041 1974 869 869 4 5051 ) insert ( 10042 1976 21 21 1 350 ) insert ( 10043 1976 21 21 2 3129 ) insert ( 10044 1976 21 21 4 5051 ) insert ( 10045 1976 21 23 1 2190 ) insert ( 10046 1976 21 20 1 2192 ) insert ( 10047 1976 21 20 3 4130 ) insert ( 10048 1976 21 23 3 4131 ) insert ( 10049 1976 21 21 3 4132 ) insert ( 10050 1976 23 23 1 351 ) insert ( 10051 1976 23 23 2 3130 ) insert ( 10052 1976 23 23 4 5051 ) insert ( 10053 1976 23 20 1 2188 ) insert ( 10054 1976 23 21 1 2191 ) insert ( 10055 1976 23 20 3 4127 ) insert ( 10056 1976 23 23 3 4128 ) insert ( 10057 1976 23 21 3 4129 ) insert ( 10058 1976 20 20 1 842 ) insert ( 10059 1976 20 20 2 3131 ) insert ( 10060 1976 20 20 4 5051 ) insert ( 10061 1976 20 23 1 2189 ) insert ( 10062 1976 20 21 1 2193 ) insert ( 10063 1976 20 20 3 4126 ) insert ( 10064 1982 1186 1186 1 1315 ) insert ( 10065 1982 1186 1186 3 4136 ) insert ( 10066 1984 829 829 1 836 ) insert ( 10067 1984 829 829 2 3359 ) insert ( 10068 1984 829 829 4 5051 ) insert ( 10069 1988 1700 1700 1 1769 ) insert ( 10070 1988 1700 1700 2 3283 ) insert ( 10071 1988 1700 1700 3 4141 ) insert ( 10072 1989 26 26 1 356 ) insert ( 10073 1989 26 26 2 3134 ) insert ( 10074 1989 26 26 4 5051 ) insert ( 10075 1991 30 30 1 404 ) insert ( 10076 1991 30 30 4 5051 ) insert ( 10077 1994 25 25 1 360 ) insert ( 10078 1994 25 25 2 3255 ) insert ( 10079 1994 25 25 4 5050 ) insert ( 10080 1994 19 19 1 359 ) insert ( 10081 1994 19 19 2 3135 ) insert ( 10082 1994 19 19 4 5050 ) insert ( 10083 1994 19 25 1 246 ) insert ( 10084 1994 25 19 1 253 ) insert ( 10085 1996 1083 1083 1 1107 ) insert ( 10086 1996 1083 1083 4 5051 ) insert ( 10087 1996 1083 1186 3 4137 ) insert ( 10088 2000 1266 1266 1 1358 ) insert ( 10089 2000 1266 1266 4 5051 ) insert ( 10090 2000 1266 1186 3 4138 ) insert ( 10091 2002 1562 1562 1 1672 ) insert ( 10092 2002 1562 1562 4 5051 ) insert ( 10093 2095 25 25 1 2166 ) insert ( 10094 2095 25 25 2 3332 ) insert ( 10095 2095 25 25 4 5051 ) insert ( 10096 2097 1042 1042 1 2180 ) insert ( 10097 2097 1042 1042 2 3333 ) insert ( 10098 2097 1042 1042 4 5051 ) insert ( 10099 2099 790 790 1 377 ) insert ( 10100 2099 790 790 4 5051 ) insert ( 10101 2789 27 27 1 2794 ) insert ( 10102 2789 27 27 4 5051 ) insert ( 10103 2968 2950 2950 1 2960 ) insert ( 10104 2968 2950 2950 2 3300 ) insert ( 10105 2968 2950 2950 4 5051 ) insert ( 10106 2994 2249 2249 1 2987 ) insert ( 10107 3194 2249 2249 1 3187 ) insert ( 10108 3253 3220 3220 1 3251 ) insert ( 10109 3253 3220 3220 4 5051 ) insert ( 10110 3371 774 774 1 4119 ) insert ( 10111 3371 774 774 4 5051 ) insert ( 10112 3522 3500 3500 1 3514 ) insert ( 10113 3522 3500 3500 4 5051 ) insert ( 10114 3626 3614 3614 1 3622 ) insert ( 10115 3683 3615 3615 1 3668 ) insert ( 10116 3901 3831 3831 1 3870 ) insert ( 10117 4199 4537 4537 1 4273 ) insert ( 10118 4033 3802 3802 1 4044 ) insert ( 10119 5067 5069 5069 1 5096 ) insert ( 10120 5067 5069 5069 4 5051 ) insert ( 10121 427 1042 1042 1 1080 ) insert ( 10122 427 1042 1042 2 972 ) insert ( 10123 431 18 18 1 454 ) insert ( 10124 431 18 18 2 446 ) insert ( 10125 435 1082 1082 1 450 ) insert ( 10126 435 1082 1082 2 425 ) insert ( 10127 627 2277 2277 1 626 ) insert ( 10128 627 2277 2277 2 782 ) insert ( 10129 1971 700 700 1 451 ) insert ( 10130 1971 700 700 2 443 ) insert ( 10131 1971 701 701 1 452 ) insert ( 10132 1971 701 701 2 444 ) insert ( 10133 1975 869 869 1 422 ) insert ( 10134 1975 869 869 2 779 ) insert ( 10135 1977 21 21 1 449 ) insert ( 10136 1977 21 21 2 441 ) insert ( 10137 1977 23 23 1 450 ) insert ( 10138 1977 23 23 2 425 ) insert ( 10139 1977 20 20 1 949 ) insert ( 10140 1977 20 20 2 442 ) insert ( 10141 1983 1186 1186 1 1697 ) insert ( 10142 1983 1186 1186 2 3418 ) insert ( 10143 1985 829 829 1 399 ) insert ( 10144 1985 829 829 2 778 ) insert ( 10145 1990 26 26 1 453 ) insert ( 10146 1990 26 26 2 445 ) insert ( 10147 1992 30 30 1 457 ) insert ( 10148 1992 30 30 2 776 ) insert ( 10149 1995 25 25 1 400 ) insert ( 10150 1995 25 25 2 448 ) insert ( 10151 1995 19 19 1 455 ) insert ( 10152 1995 19 19 2 447 ) insert ( 10153 1997 1083 1083 1 1688 ) insert ( 10154 1997 1083 1083 2 3409 ) insert ( 10155 1998 1700 1700 1 432 ) insert ( 10156 1998 1700 1700 2 780 ) insert ( 10157 1999 1184 1184 1 2039 ) insert ( 10158 1999 1184 1184 2 3411 ) insert ( 10159 2001 1266 1266 1 1696 ) insert ( 10160 2001 1266 1266 2 3410 ) insert ( 10161 2040 1114 1114 1 2039 ) insert ( 10162 2040 1114 1114 2 3411 ) insert ( 10163 2222 16 16 1 454 ) insert ( 10164 2222 16 16 2 446 ) insert ( 10165 2223 17 17 1 456 ) insert ( 10166 2223 17 17 2 772 ) insert ( 10167 2225 28 28 1 450 ) insert ( 10168 2225 28 28 2 425 ) insert ( 10169 5032 5069 5069 1 949 ) insert ( 10170 5032 5069 5069 2 442 ) insert ( 10171 2226 29 29 1 450 ) insert ( 10172 2226 29 29 2 425 ) insert ( 10173 2227 27 27 1 2233 ) insert ( 10174 2227 27 27 2 2234 ) insert ( 10175 2229 25 25 1 400 ) insert ( 10176 2229 25 25 2 448 ) insert ( 10177 2231 1042 1042 1 1080 ) insert ( 10178 2231 1042 1042 2 972 ) insert ( 10179 2235 1033 1033 1 329 ) insert ( 10180 2235 1033 1033 2 777 ) insert ( 10181 2969 2950 2950 1 2963 ) insert ( 10182 2969 2950 2950 2 3412 ) insert ( 10183 6194 2249 2249 1 6192 ) insert ( 10184 6194 2249 2249 2 6193 ) insert ( 10185 3254 3220 3220 1 3252 ) insert ( 10186 3254 3220 3220 2 3413 ) insert ( 10187 3372 774 774 1 328 ) insert ( 10188 3372 774 774 2 781 ) insert ( 10189 3523 3500 3500 1 3515 ) insert ( 10190 3523 3500 3500 2 3414 ) insert ( 10191 3903 3831 3831 1 3902 ) insert ( 10192 3903 3831 3831 2 3417 ) insert ( 10193 4225 4537 4537 1 4278 ) insert ( 10194 4225 4537 4537 2 4279 ) insert ( 10195 4034 3802 3802 1 4045 ) insert ( 10196 4034 3802 3802 2 3416 ) insert ( 10197 1029 600 600 1 2179 ) insert ( 10198 1029 600 600 2 2583 ) insert ( 10199 1029 600 600 3 1030 ) insert ( 10200 1029 600 600 5 2581 ) insert ( 10201 1029 600 600 6 2582 ) insert ( 10202 1029 600 600 7 2584 ) insert ( 10203 1029 600 600 8 3064 ) insert ( 10204 1029 600 600 9 3282 ) insert ( 10205 1029 600 600 11 3435 ) insert ( 10206 2593 603 603 1 2578 ) insert ( 10207 2593 603 603 2 2583 ) insert ( 10208 2593 603 603 5 2581 ) insert ( 10209 2593 603 603 6 2582 ) insert ( 10210 2593 603 603 7 2584 ) insert ( 10211 2593 603 603 8 3998 ) insert ( 10212 2594 604 604 1 2585 ) insert ( 10213 2594 604 604 2 2583 ) insert ( 10214 2594 604 604 3 2586 ) insert ( 10215 2594 604 604 5 2581 ) insert ( 10216 2594 604 604 6 2582 ) insert ( 10217 2594 604 604 7 2584 ) insert ( 10218 2594 604 604 8 3288 ) insert ( 10219 2595 718 718 1 2591 ) insert ( 10220 2595 718 718 2 2583 ) insert ( 10221 2595 718 718 3 2592 ) insert ( 10222 2595 718 718 5 2581 ) insert ( 10223 2595 718 718 6 2582 ) insert ( 10224 2595 718 718 7 2584 ) insert ( 10225 2595 718 718 8 3280 ) insert ( 10226 3655 3614 3614 1 3654 ) insert ( 10227 3655 3614 3614 2 3651 ) insert ( 10228 3655 3614 3614 3 3648 ) insert ( 10229 3655 3614 3614 4 3649 ) insert ( 10230 3655 3614 3614 5 3653 ) insert ( 10231 3655 3614 3614 6 3650 ) insert ( 10232 3655 3614 3614 7 3652 ) insert ( 10233 3655 3614 3614 10 3434 ) insert ( 10234 3702 3615 3615 1 3701 ) insert ( 10235 3702 3615 3615 2 3698 ) insert ( 10236 3702 3615 3615 3 3695 ) insert ( 10237 3702 3615 3615 5 3700 ) insert ( 10238 3702 3615 3615 6 3697 ) insert ( 10239 3702 3615 3615 7 3699 ) insert ( 10240 3919 3831 3831 1 3875 ) insert ( 10241 3919 3831 3831 2 3876 ) insert ( 10242 3919 3831 3831 5 3879 ) insert ( 10243 3919 3831 3831 6 3880 ) insert ( 10244 3919 3831 3831 7 3881 ) insert ( 10245 3550 869 869 1 3553 ) insert ( 10246 3550 869 869 2 3554 ) insert ( 10247 3550 869 869 3 3555 ) insert ( 10248 3550 869 869 5 3557 ) insert ( 10249 3550 869 869 6 3558 ) insert ( 10250 3550 869 869 7 3559 ) insert ( 10251 3550 869 869 9 3573 ) insert ( 10252 6158 4537 4537 1 6154 ) insert ( 10253 6158 4537 4537 2 3876 ) insert ( 10254 6158 4537 4537 3 6156 ) insert ( 10255 6158 4537 4537 5 3879 ) insert ( 10256 6158 4537 4537 6 3880 ) insert ( 10257 6158 4537 4537 7 3881 ) insert ( 10258 2745 2277 2277 2 2743 ) insert ( 10259 2745 2277 2277 3 2774 ) insert ( 10260 2745 2277 2277 4 2744 ) insert ( 10261 2745 2277 2277 6 3920 ) insert ( 10262 3659 3614 3614 1 3724 ) insert ( 10263 3659 3614 3614 2 3656 ) insert ( 10264 3659 3614 3614 3 3657 ) insert ( 10265 3659 3614 3614 4 3658 ) insert ( 10266 3659 3614 3614 5 2700 ) insert ( 10267 3659 3614 3614 6 3921 ) insert ( 10268 4036 3802 3802 1 3480 ) insert ( 10269 4036 3802 3802 2 3482 ) insert ( 10270 4036 3802 3802 3 3483 ) insert ( 10271 4036 3802 3802 4 3484 ) insert ( 10272 4036 3802 3802 6 3488 ) insert ( 10273 4037 3802 3802 1 351 ) insert ( 10274 4037 3802 3802 2 3485 ) insert ( 10275 4037 3802 3802 3 3486 ) insert ( 10276 4037 3802 3802 4 3487 ) insert ( 10277 4037 3802 3802 6 3489 ) insert ( 10278 3474 3831 3831 1 3469 ) insert ( 10279 3474 3831 3831 2 3470 ) insert ( 10280 3474 3831 3831 3 3471 ) insert ( 10281 3474 3831 3831 4 3472 ) insert ( 10282 3474 3831 3831 5 3473 ) insert ( 10283 3794 869 869 1 3795 ) insert ( 10284 3794 869 869 2 3796 ) insert ( 10285 3794 869 869 3 3797 ) insert ( 10286 3794 869 869 4 3798 ) insert ( 10287 3794 869 869 5 3799 ) insert ( 10288 4015 600 600 1 4018 ) insert ( 10289 4015 600 600 2 4019 ) insert ( 10290 4015 600 600 3 4020 ) insert ( 10291 4015 600 600 4 4021 ) insert ( 10292 4015 600 600 5 4022 ) insert ( 10293 4016 600 600 1 4023 ) insert ( 10294 4016 600 600 2 4024 ) insert ( 10295 4016 600 600 3 4025 ) insert ( 10296 4016 600 600 4 4026 ) insert ( 10297 4016 600 600 5 4022 ) insert ( 10298 4017 25 25 1 4027 ) insert ( 10299 4017 25 25 2 4028 ) insert ( 10300 4017 25 25 3 4029 ) insert ( 10301 4017 25 25 4 4030 ) insert ( 10302 4017 25 25 5 4031 ) insert ( 10303 5000 603 603 1 5012 ) insert ( 10304 5000 603 603 2 5013 ) insert ( 10305 5000 603 603 3 5014 ) insert ( 10306 5000 603 603 4 5015 ) insert ( 10307 5000 603 603 5 5016 ) insert ( 10308 5008 604 604 1 5010 ) insert ( 10309 5008 604 604 2 5013 ) insert ( 10310 5008 604 604 3 5014 ) insert ( 10311 5008 604 604 4 5015 ) insert ( 10312 5008 604 604 5 5016 ) insert ( 10313 5008 604 604 6 5011 ) insert ( 10314 4064 17 17 1 3383 ) insert ( 10315 4064 17 17 2 3384 ) insert ( 10316 4064 17 17 3 3385 ) insert ( 10317 4064 17 17 4 3386 ) insert ( 10318 4578 17 17 1 4591 ) insert ( 10319 4578 17 17 2 4592 ) insert ( 10320 4578 17 17 3 4593 ) insert ( 10321 4578 17 17 4 4594 ) insert ( 10322 4578 17 17 5 4595 ) insert ( 10323 4578 17 17 11 456 ) insert ( 10324 4062 18 18 1 3383 ) insert ( 10325 4062 18 18 2 3384 ) insert ( 10326 4062 18 18 3 3385 ) insert ( 10327 4062 18 18 4 3386 ) insert ( 10328 4577 18 18 1 4591 ) insert ( 10329 4577 18 18 2 4592 ) insert ( 10330 4577 18 18 3 4593 ) insert ( 10331 4577 18 18 4 4594 ) insert ( 10332 4577 18 18 5 4595 ) insert ( 10333 4577 18 18 11 454 ) insert ( 10334 4065 19 19 1 3383 ) insert ( 10335 4065 19 19 2 3384 ) insert ( 10336 4065 19 19 3 3385 ) insert ( 10337 4065 19 19 4 3386 ) insert ( 10338 4579 19 19 1 4591 ) insert ( 10339 4579 19 19 2 4592 ) insert ( 10340 4579 19 19 3 4593 ) insert ( 10341 4579 19 19 4 4594 ) insert ( 10342 4579 19 19 5 4595 ) insert ( 10343 4579 19 19 11 455 ) insert ( 10344 4054 20 20 1 3383 ) insert ( 10345 4054 20 20 2 3384 ) insert ( 10346 4054 20 20 3 3385 ) insert ( 10347 4054 20 20 4 3386 ) insert ( 10348 4054 21 21 1 3383 ) insert ( 10349 4054 21 21 2 3384 ) insert ( 10350 4054 21 21 3 3385 ) insert ( 10351 4054 21 21 4 3386 ) insert ( 10352 4054 23 23 1 3383 ) insert ( 10353 4054 23 23 2 3384 ) insert ( 10354 4054 23 23 3 3385 ) insert ( 10355 4054 23 23 4 3386 ) insert ( 10356 4602 21 21 1 4616 ) insert ( 10357 4602 21 21 2 4617 ) insert ( 10358 4602 21 21 3 4618 ) insert ( 10359 4602 21 21 4 4619 ) insert ( 10360 4602 21 21 5 4620 ) insert ( 10361 4602 21 21 11 4621 ) insert ( 10362 4602 23 23 1 4616 ) insert ( 10363 4602 23 23 2 4617 ) insert ( 10364 4602 23 23 3 4618 ) insert ( 10365 4602 23 23 4 4619 ) insert ( 10366 4602 23 23 5 4620 ) insert ( 10367 4602 23 23 11 4622 ) insert ( 10368 4602 20 20 1 4616 ) insert ( 10369 4602 20 20 2 4617 ) insert ( 10370 4602 20 20 3 4618 ) insert ( 10371 4602 20 20 4 4619 ) insert ( 10372 4602 20 20 5 4620 ) insert ( 10373 4602 20 20 11 4623 ) insert ( 10374 4572 20 20 1 4591 ) insert ( 10375 4572 20 20 2 4592 ) insert ( 10376 4572 20 20 3 4593 ) insert ( 10377 4572 20 20 4 4594 ) insert ( 10378 4572 20 20 5 4595 ) insert ( 10379 4572 20 20 11 949 ) insert ( 10380 4572 21 21 1 4591 ) insert ( 10381 4572 21 21 2 4592 ) insert ( 10382 4572 21 21 3 4593 ) insert ( 10383 4572 21 21 4 4594 ) insert ( 10384 4572 21 21 5 4595 ) insert ( 10385 4572 21 21 11 449 ) insert ( 10386 4572 23 23 1 4591 ) insert ( 10387 4572 23 23 2 4592 ) insert ( 10388 4572 23 23 3 4593 ) insert ( 10389 4572 23 23 4 4594 ) insert ( 10390 4572 23 23 5 4595 ) insert ( 10391 4572 23 23 11 450 ) insert ( 10392 4056 25 25 1 3383 ) insert ( 10393 4056 25 25 2 3384 ) insert ( 10394 4056 25 25 3 3385 ) insert ( 10395 4056 25 25 4 3386 ) insert ( 10396 4573 25 25 1 4591 ) insert ( 10397 4573 25 25 2 4592 ) insert ( 10398 4573 25 25 3 4593 ) insert ( 10399 4573 25 25 4 4594 ) insert ( 10400 4573 25 25 5 4595 ) insert ( 10401 4573 25 25 11 400 ) insert ( 10402 4068 26 26 1 3383 ) insert ( 10403 4068 26 26 2 3384 ) insert ( 10404 4068 26 26 3 3385 ) insert ( 10405 4068 26 26 4 3386 ) insert ( 10406 4606 26 26 1 4616 ) insert ( 10407 4606 26 26 2 4617 ) insert ( 10408 4606 26 26 3 4618 ) insert ( 10409 4606 26 26 4 4619 ) insert ( 10410 4606 26 26 5 4620 ) insert ( 10411 4606 26 26 11 4622 ) insert ( 10412 4580 26 26 1 4591 ) insert ( 10413 4580 26 26 2 4592 ) insert ( 10414 4580 26 26 3 4593 ) insert ( 10415 4580 26 26 4 4594 ) insert ( 10416 4580 26 26 5 4595 ) insert ( 10417 4580 26 26 11 453 ) insert ( 10418 4069 27 27 1 3383 ) insert ( 10419 4069 27 27 2 3384 ) insert ( 10420 4069 27 27 3 3385 ) insert ( 10421 4069 27 27 4 3386 ) insert ( 10422 4581 27 27 1 4591 ) insert ( 10423 4581 27 27 2 4592 ) insert ( 10424 4581 27 27 3 4593 ) insert ( 10425 4581 27 27 4 4594 ) insert ( 10426 4581 27 27 5 4595 ) insert ( 10427 4581 27 27 11 2233 ) insert ( 10428 4607 27 27 1 4616 ) insert ( 10429 4607 27 27 2 4617 ) insert ( 10430 4607 27 27 3 4618 ) insert ( 10431 4607 27 27 4 4619 ) insert ( 10432 4607 27 27 5 4620 ) insert ( 10433 4607 27 27 11 4627 ) insert ( 10434 4070 700 700 1 3383 ) insert ( 10435 4070 700 700 2 3384 ) insert ( 10436 4070 700 700 3 3385 ) insert ( 10437 4070 700 700 4 3386 ) insert ( 10438 4070 701 701 1 3383 ) insert ( 10439 4070 701 701 2 3384 ) insert ( 10440 4070 701 701 3 3385 ) insert ( 10441 4070 701 701 4 3386 ) insert ( 10442 4608 700 700 1 4616 ) insert ( 10443 4608 700 700 2 4617 ) insert ( 10444 4608 700 700 3 4618 ) insert ( 10445 4608 700 700 4 4619 ) insert ( 10446 4608 700 700 5 4620 ) insert ( 10447 4608 700 700 11 4624 ) insert ( 10448 4608 701 701 1 4616 ) insert ( 10449 4608 701 701 2 4617 ) insert ( 10450 4608 701 701 3 4618 ) insert ( 10451 4608 701 701 4 4619 ) insert ( 10452 4608 701 701 5 4620 ) insert ( 10453 4608 701 701 11 4625 ) insert ( 10454 4582 700 700 1 4591 ) insert ( 10455 4582 700 700 2 4592 ) insert ( 10456 4582 700 700 3 4593 ) insert ( 10457 4582 700 700 4 4594 ) insert ( 10458 4582 700 700 5 4595 ) insert ( 10459 4582 700 700 11 451 ) insert ( 10460 4582 701 701 1 4591 ) insert ( 10461 4582 701 701 2 4592 ) insert ( 10462 4582 701 701 3 4593 ) insert ( 10463 4582 701 701 4 4594 ) insert ( 10464 4582 701 701 5 4595 ) insert ( 10465 4582 701 701 11 452 ) insert ( 10466 4074 829 829 1 3383 ) insert ( 10467 4074 829 829 2 3384 ) insert ( 10468 4074 829 829 3 3385 ) insert ( 10469 4074 829 829 4 3386 ) insert ( 10470 4609 829 829 1 4616 ) insert ( 10471 4609 829 829 2 4617 ) insert ( 10472 4609 829 829 3 4618 ) insert ( 10473 4609 829 829 4 4619 ) insert ( 10474 4609 829 829 5 4620 ) insert ( 10475 4609 829 829 11 4634 ) insert ( 10476 4583 829 829 1 4591 ) insert ( 10477 4583 829 829 2 4592 ) insert ( 10478 4583 829 829 3 4593 ) insert ( 10479 4583 829 829 4 4594 ) insert ( 10480 4583 829 829 5 4595 ) insert ( 10481 4583 829 829 11 399 ) insert ( 10482 4109 774 774 1 3383 ) insert ( 10483 4109 774 774 2 3384 ) insert ( 10484 4109 774 774 3 3385 ) insert ( 10485 4109 774 774 4 3386 ) insert ( 10486 4610 774 774 1 4616 ) insert ( 10487 4610 774 774 2 4617 ) insert ( 10488 4610 774 774 3 4618 ) insert ( 10489 4610 774 774 4 4619 ) insert ( 10490 4610 774 774 5 4620 ) insert ( 10491 4610 774 774 11 4635 ) insert ( 10492 4584 774 774 1 4591 ) insert ( 10493 4584 774 774 2 4592 ) insert ( 10494 4584 774 774 3 4593 ) insert ( 10495 4584 774 774 4 4594 ) insert ( 10496 4584 774 774 5 4595 ) insert ( 10497 4584 774 774 11 328 ) insert ( 10498 4075 869 869 1 3383 ) insert ( 10499 4075 869 869 2 3384 ) insert ( 10500 4075 869 869 3 3385 ) insert ( 10501 4075 869 869 4 3386 ) insert ( 10502 4611 869 869 1 4616 ) insert ( 10503 4611 869 869 2 4617 ) insert ( 10504 4611 869 869 3 4618 ) insert ( 10505 4611 869 869 4 4619 ) insert ( 10506 4611 869 869 5 4620 ) insert ( 10507 4611 869 869 11 4636 ) insert ( 10508 4585 869 869 1 4591 ) insert ( 10509 4585 869 869 2 4592 ) insert ( 10510 4585 869 869 3 4593 ) insert ( 10511 4585 869 869 4 4594 ) insert ( 10512 4585 869 869 5 4595 ) insert ( 10513 4585 869 869 11 422 ) insert ( 10514 4102 869 869 1 4105 ) insert ( 10515 4102 869 869 2 4106 ) insert ( 10516 4102 869 869 3 4107 ) insert ( 10517 4102 869 869 4 4108 ) insert ( 10518 4102 869 869 11 4063 ) insert ( 10519 4102 869 869 12 4071 ) insert ( 10520 4102 869 869 13 930 ) insert ( 10521 4076 1042 1042 1 3383 ) insert ( 10522 4076 1042 1042 2 3384 ) insert ( 10523 4076 1042 1042 3 3385 ) insert ( 10524 4076 1042 1042 4 3386 ) insert ( 10525 4586 1042 1042 1 4591 ) insert ( 10526 4586 1042 1042 2 4592 ) insert ( 10527 4586 1042 1042 3 4593 ) insert ( 10528 4586 1042 1042 4 4594 ) insert ( 10529 4586 1042 1042 5 4595 ) insert ( 10530 4586 1042 1042 11 1080 ) insert ( 10531 4077 1083 1083 1 3383 ) insert ( 10532 4077 1083 1083 2 3384 ) insert ( 10533 4077 1083 1083 3 3385 ) insert ( 10534 4077 1083 1083 4 3386 ) insert ( 10535 4612 1083 1083 1 4616 ) insert ( 10536 4612 1083 1083 2 4617 ) insert ( 10537 4612 1083 1083 3 4618 ) insert ( 10538 4612 1083 1083 4 4619 ) insert ( 10539 4612 1083 1083 5 4620 ) insert ( 10540 4612 1083 1083 11 4630 ) insert ( 10541 4587 1083 1083 1 4591 ) insert ( 10542 4587 1083 1083 2 4592 ) insert ( 10543 4587 1083 1083 3 4593 ) insert ( 10544 4587 1083 1083 4 4594 ) insert ( 10545 4587 1083 1083 5 4595 ) insert ( 10546 4587 1083 1083 11 1688 ) insert ( 10547 4059 1114 1114 1 3383 ) insert ( 10548 4059 1114 1114 2 3384 ) insert ( 10549 4059 1114 1114 3 3385 ) insert ( 10550 4059 1114 1114 4 3386 ) insert ( 10551 4059 1184 1184 1 3383 ) insert ( 10552 4059 1184 1184 2 3384 ) insert ( 10553 4059 1184 1184 3 3385 ) insert ( 10554 4059 1184 1184 4 3386 ) insert ( 10555 4059 1082 1082 1 3383 ) insert ( 10556 4059 1082 1082 2 3384 ) insert ( 10557 4059 1082 1082 3 3385 ) insert ( 10558 4059 1082 1082 4 3386 ) insert ( 10559 4605 1114 1114 1 4616 ) insert ( 10560 4605 1114 1114 2 4617 ) insert ( 10561 4605 1114 1114 3 4618 ) insert ( 10562 4605 1114 1114 4 4619 ) insert ( 10563 4605 1114 1114 5 4620 ) insert ( 10564 4605 1114 1114 11 4637 ) insert ( 10565 4605 1184 1184 1 4616 ) insert ( 10566 4605 1184 1184 2 4617 ) insert ( 10567 4605 1184 1184 3 4618 ) insert ( 10568 4605 1184 1184 4 4619 ) insert ( 10569 4605 1184 1184 5 4620 ) insert ( 10570 4605 1184 1184 11 4637 ) insert ( 10571 4605 1082 1082 1 4616 ) insert ( 10572 4605 1082 1082 2 4617 ) insert ( 10573 4605 1082 1082 3 4618 ) insert ( 10574 4605 1082 1082 4 4619 ) insert ( 10575 4605 1082 1082 5 4620 ) insert ( 10576 4605 1082 1082 11 4629 ) insert ( 10577 4576 1114 1114 1 4591 ) insert ( 10578 4576 1114 1114 2 4592 ) insert ( 10579 4576 1114 1114 3 4593 ) insert ( 10580 4576 1114 1114 4 4594 ) insert ( 10581 4576 1114 1114 5 4595 ) insert ( 10582 4576 1114 1114 11 2039 ) insert ( 10583 4576 1184 1184 1 4591 ) insert ( 10584 4576 1184 1184 2 4592 ) insert ( 10585 4576 1184 1184 3 4593 ) insert ( 10586 4576 1184 1184 4 4594 ) insert ( 10587 4576 1184 1184 5 4595 ) insert ( 10588 4576 1184 1184 11 2039 ) insert ( 10589 4576 1082 1082 1 4591 ) insert ( 10590 4576 1082 1082 2 4592 ) insert ( 10591 4576 1082 1082 3 4593 ) insert ( 10592 4576 1082 1082 4 4594 ) insert ( 10593 4576 1082 1082 5 4595 ) insert ( 10594 4576 1082 1082 11 450 ) insert ( 10595 4078 1186 1186 1 3383 ) insert ( 10596 4078 1186 1186 2 3384 ) insert ( 10597 4078 1186 1186 3 3385 ) insert ( 10598 4078 1186 1186 4 3386 ) insert ( 10599 4613 1186 1186 1 4616 ) insert ( 10600 4613 1186 1186 2 4617 ) insert ( 10601 4613 1186 1186 3 4618 ) insert ( 10602 4613 1186 1186 4 4619 ) insert ( 10603 4613 1186 1186 5 4620 ) insert ( 10604 4613 1186 1186 11 4631 ) insert ( 10605 4588 1186 1186 1 4591 ) insert ( 10606 4588 1186 1186 2 4592 ) insert ( 10607 4588 1186 1186 3 4593 ) insert ( 10608 4588 1186 1186 4 4594 ) insert ( 10609 4588 1186 1186 5 4595 ) insert ( 10610 4588 1186 1186 11 1697 ) insert ( 10611 4058 1266 1266 1 3383 ) insert ( 10612 4058 1266 1266 2 3384 ) insert ( 10613 4058 1266 1266 3 3385 ) insert ( 10614 4058 1266 1266 4 3386 ) insert ( 10615 4604 1266 1266 1 4616 ) insert ( 10616 4604 1266 1266 2 4617 ) insert ( 10617 4604 1266 1266 3 4618 ) insert ( 10618 4604 1266 1266 4 4619 ) insert ( 10619 4604 1266 1266 5 4620 ) insert ( 10620 4604 1266 1266 11 4632 ) insert ( 10621 4575 1266 1266 1 4591 ) insert ( 10622 4575 1266 1266 2 4592 ) insert ( 10623 4575 1266 1266 3 4593 ) insert ( 10624 4575 1266 1266 4 4594 ) insert ( 10625 4575 1266 1266 5 4595 ) insert ( 10626 4575 1266 1266 11 1696 ) insert ( 10627 4079 1560 1560 1 3383 ) insert ( 10628 4079 1560 1560 2 3384 ) insert ( 10629 4079 1560 1560 3 3385 ) insert ( 10630 4079 1560 1560 4 3386 ) insert ( 10631 4080 1562 1562 1 3383 ) insert ( 10632 4080 1562 1562 2 3384 ) insert ( 10633 4080 1562 1562 3 3385 ) insert ( 10634 4080 1562 1562 4 3386 ) insert ( 10635 4055 1700 1700 1 3383 ) insert ( 10636 4055 1700 1700 2 3384 ) insert ( 10637 4055 1700 1700 3 3385 ) insert ( 10638 4055 1700 1700 4 3386 ) insert ( 10639 4603 1700 1700 1 4616 ) insert ( 10640 4603 1700 1700 2 4617 ) insert ( 10641 4603 1700 1700 3 4618 ) insert ( 10642 4603 1700 1700 4 4619 ) insert ( 10643 4603 1700 1700 5 4620 ) insert ( 10644 4603 1700 1700 11 4626 ) insert ( 10645 4574 1700 1700 1 4591 ) insert ( 10646 4574 1700 1700 2 4592 ) insert ( 10647 4574 1700 1700 3 4593 ) insert ( 10648 4574 1700 1700 4 4594 ) insert ( 10649 4574 1700 1700 5 4595 ) insert ( 10650 4574 1700 1700 11 432 ) insert ( 10651 4081 2950 2950 1 3383 ) insert ( 10652 4081 2950 2950 2 3384 ) insert ( 10653 4081 2950 2950 3 3385 ) insert ( 10654 4081 2950 2950 4 3386 ) insert ( 10655 4614 2950 2950 1 4616 ) insert ( 10656 4614 2950 2950 2 4617 ) insert ( 10657 4614 2950 2950 3 4618 ) insert ( 10658 4614 2950 2950 4 4619 ) insert ( 10659 4614 2950 2950 5 4620 ) insert ( 10660 4614 2950 2950 11 4628 ) insert ( 10661 4589 2950 2950 1 4591 ) insert ( 10662 4589 2950 2950 2 4592 ) insert ( 10663 4589 2950 2950 3 4593 ) insert ( 10664 4589 2950 2950 4 4594 ) insert ( 10665 4589 2950 2950 5 4595 ) insert ( 10666 4589 2950 2950 11 2963 ) insert ( 10667 4103 3831 3831 1 4105 ) insert ( 10668 4103 3831 3831 2 4106 ) insert ( 10669 4103 3831 3831 3 4107 ) insert ( 10670 4103 3831 3831 4 4108 ) insert ( 10671 4103 3831 3831 11 4057 ) insert ( 10672 4103 3831 3831 13 3859 ) insert ( 10673 4103 3831 3831 14 3850 ) insert ( 10674 4082 3220 3220 1 3383 ) insert ( 10675 4082 3220 3220 2 3384 ) insert ( 10676 4082 3220 3220 3 3385 ) insert ( 10677 4082 3220 3220 4 3386 ) insert ( 10678 4615 3220 3220 1 4616 ) insert ( 10679 4615 3220 3220 2 4617 ) insert ( 10680 4615 3220 3220 3 4618 ) insert ( 10681 4615 3220 3220 4 4619 ) insert ( 10682 4615 3220 3220 5 4620 ) insert ( 10683 4615 3220 3220 11 4633 ) insert ( 10684 4590 3220 3220 1 4591 ) insert ( 10685 4590 3220 3220 2 4592 ) insert ( 10686 4590 3220 3220 3 4593 ) insert ( 10687 4590 3220 3220 4 4594 ) insert ( 10688 4590 3220 3220 5 4595 ) insert ( 10689 4590 3220 3220 11 3252 ) insert ( 10690 4104 603 603 1 4105 ) insert ( 10691 4104 603 603 2 4106 ) insert ( 10692 4104 603 603 3 4107 ) insert ( 10693 4104 603 603 4 4108 ) insert ( 10694 4104 603 603 11 4067 ) insert ( 10695 4104 603 603 13 187 ) close pg_amproc create pg_language 2612 ( oid = oid , lanname = name , lanowner = oid , lanispl = bool , lanpltrusted = bool , lanplcallfoid = oid , laninline = oid , lanvalidator = oid , lanacl = _aclitem ) open pg_language insert ( 12 internal 10 f f 0 0 2246 _null_ ) insert ( 13 c 10 f f 0 0 2247 _null_ ) insert ( 14 sql 10 f t 0 0 2248 _null_ ) close pg_language create pg_largeobject_metadata 2995 ( oid = oid , lomowner = oid , lomacl = _aclitem ) open pg_largeobject_metadata close pg_largeobject_metadata create pg_largeobject 2613 ( loid = oid , pageno = int4 , data = bytea FORCE NOT NULL ) open pg_largeobject close pg_largeobject create pg_aggregate 2600 ( aggfnoid = regproc , aggkind = char , aggnumdirectargs = int2 , aggtransfn = regproc , aggfinalfn = regproc , aggcombinefn = regproc , aggserialfn = regproc , aggdeserialfn = regproc , aggmtransfn = regproc , aggminvtransfn = regproc , aggmfinalfn = regproc , aggfinalextra = bool , aggmfinalextra = bool , aggfinalmodify = char , aggmfinalmodify = char , aggsortop = oid , aggtranstype = oid , aggtransspace = int4 , aggmtranstype = oid , aggmtransspace = int4 , agginitval = text , aggminitval = text ) open pg_aggregate insert ( 2100 n 0 2746 3389 2785 2786 2787 2746 3387 3389 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2101 n 0 1963 1964 3324 - - 1963 3571 1964 f f r r 0 1016 0 1016 0 '{0,0}' '{0,0}' ) insert ( 2102 n 0 1962 1964 3324 - - 1962 3570 1964 f f r r 0 1016 0 1016 0 '{0,0}' '{0,0}' ) insert ( 2103 n 0 2858 1837 3337 2740 2741 2858 3548 1837 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2104 n 0 208 1830 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2105 n 0 222 1830 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2106 n 0 1843 1844 3325 6324 6325 1843 3549 1844 f f r r 0 2281 40 2281 40 _null_ _null_ ) insert ( 2107 n 0 2746 3388 2785 2786 2787 2746 3387 3388 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2108 n 0 1841 - 463 - - 1963 3571 3572 f f r r 0 20 0 1016 0 _null_ '{0,0}' ) insert ( 2109 n 0 1840 - 463 - - 1962 3570 3572 f f r r 0 20 0 1016 0 _null_ '{0,0}' ) insert ( 2110 n 0 204 - 204 - - - - - f f r r 0 700 0 0 0 _null_ _null_ ) insert ( 2111 n 0 218 - 218 - - - - - f f r r 0 701 0 0 0 _null_ _null_ ) insert ( 2112 n 0 894 - 894 - - 894 895 - f f r r 0 790 0 790 0 _null_ _null_ ) insert ( 2113 n 0 1843 6326 3325 6324 6325 1843 3549 6326 f f r r 0 2281 40 2281 40 _null_ _null_ ) insert ( 2114 n 0 2858 3178 3337 2740 2741 2858 3548 3178 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2115 n 0 1236 - 1236 - - - - - f f r r 413 20 0 0 0 _null_ _null_ ) insert ( 2116 n 0 768 - 768 - - - - - f f r r 521 23 0 0 0 _null_ _null_ ) insert ( 2117 n 0 770 - 770 - - - - - f f r r 520 21 0 0 0 _null_ _null_ ) insert ( 2118 n 0 1965 - 1965 - - - - - f f r r 610 26 0 0 0 _null_ _null_ ) insert ( 2119 n 0 209 - 209 - - - - - f f r r 623 700 0 0 0 _null_ _null_ ) insert ( 2120 n 0 223 - 223 - - - - - f f r r 674 701 0 0 0 _null_ _null_ ) insert ( 2122 n 0 1138 - 1138 - - - - - f f r r 1097 1082 0 0 0 _null_ _null_ ) insert ( 2123 n 0 1377 - 1377 - - - - - f f r r 1112 1083 0 0 0 _null_ _null_ ) insert ( 2124 n 0 1379 - 1379 - - - - - f f r r 1554 1266 0 0 0 _null_ _null_ ) insert ( 2125 n 0 898 - 898 - - - - - f f r r 903 790 0 0 0 _null_ _null_ ) insert ( 2126 n 0 2036 - 2036 - - - - - f f r r 2064 1114 0 0 0 _null_ _null_ ) insert ( 2127 n 0 1196 - 1196 - - - - - f f r r 1324 1184 0 0 0 _null_ _null_ ) insert ( 2128 n 0 1198 - 1198 - - - - - f f r r 1334 1186 0 0 0 _null_ _null_ ) insert ( 2129 n 0 458 - 458 - - - - - f f r r 666 25 0 0 0 _null_ _null_ ) insert ( 2130 n 0 1767 - 1767 - - - - - f f r r 1756 1700 0 0 0 _null_ _null_ ) insert ( 2050 n 0 515 - 515 - - - - - f f r r 1073 2277 0 0 0 _null_ _null_ ) insert ( 2244 n 0 1063 - 1063 - - - - - f f r r 1060 1042 0 0 0 _null_ _null_ ) insert ( 2797 n 0 2795 - 2795 - - - - - f f r r 2800 27 0 0 0 _null_ _null_ ) insert ( 3526 n 0 3525 - 3525 - - - - - f f r r 3519 3500 0 0 0 _null_ _null_ ) insert ( 3564 n 0 3562 - 3562 - - - - - f f r r 1205 869 0 0 0 _null_ _null_ ) insert ( 4189 n 0 4187 - 4187 - - - - - f f r r 3225 3220 0 0 0 _null_ _null_ ) insert ( 5099 n 0 5097 - 5097 - - - - - f f r r 5074 5069 0 0 0 _null_ _null_ ) insert ( 2131 n 0 1237 - 1237 - - - - - f f r r 412 20 0 0 0 _null_ _null_ ) insert ( 2132 n 0 769 - 769 - - - - - f f r r 97 23 0 0 0 _null_ _null_ ) insert ( 2133 n 0 771 - 771 - - - - - f f r r 95 21 0 0 0 _null_ _null_ ) insert ( 2134 n 0 1966 - 1966 - - - - - f f r r 609 26 0 0 0 _null_ _null_ ) insert ( 2135 n 0 211 - 211 - - - - - f f r r 622 700 0 0 0 _null_ _null_ ) insert ( 2136 n 0 224 - 224 - - - - - f f r r 672 701 0 0 0 _null_ _null_ ) insert ( 2138 n 0 1139 - 1139 - - - - - f f r r 1095 1082 0 0 0 _null_ _null_ ) insert ( 2139 n 0 1378 - 1378 - - - - - f f r r 1110 1083 0 0 0 _null_ _null_ ) insert ( 2140 n 0 1380 - 1380 - - - - - f f r r 1552 1266 0 0 0 _null_ _null_ ) insert ( 2141 n 0 899 - 899 - - - - - f f r r 902 790 0 0 0 _null_ _null_ ) insert ( 2142 n 0 2035 - 2035 - - - - - f f r r 2062 1114 0 0 0 _null_ _null_ ) insert ( 2143 n 0 1195 - 1195 - - - - - f f r r 1322 1184 0 0 0 _null_ _null_ ) insert ( 2144 n 0 1197 - 1197 - - - - - f f r r 1332 1186 0 0 0 _null_ _null_ ) insert ( 2145 n 0 459 - 459 - - - - - f f r r 664 25 0 0 0 _null_ _null_ ) insert ( 2146 n 0 1766 - 1766 - - - - - f f r r 1754 1700 0 0 0 _null_ _null_ ) insert ( 2051 n 0 516 - 516 - - - - - f f r r 1072 2277 0 0 0 _null_ _null_ ) insert ( 2245 n 0 1064 - 1064 - - - - - f f r r 1058 1042 0 0 0 _null_ _null_ ) insert ( 2798 n 0 2796 - 2796 - - - - - f f r r 2799 27 0 0 0 _null_ _null_ ) insert ( 3527 n 0 3524 - 3524 - - - - - f f r r 3518 3500 0 0 0 _null_ _null_ ) insert ( 3565 n 0 3563 - 3563 - - - - - f f r r 1203 869 0 0 0 _null_ _null_ ) insert ( 4190 n 0 4188 - 4188 - - - - - f f r r 3224 3220 0 0 0 _null_ _null_ ) insert ( 5100 n 0 5098 - 5098 - - - - - f f r r 5073 5069 0 0 0 _null_ _null_ ) insert ( 2147 n 0 2804 - 463 - - 2804 3547 - f f r r 0 20 0 20 0 0 0 ) insert ( 2803 n 0 1219 - 463 - - 1219 3546 - f f r r 0 20 0 20 0 0 0 ) insert ( 2718 n 0 1836 2514 3341 3335 3336 1836 3569 2514 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2719 n 0 1835 3390 3338 3339 3340 1835 3568 3390 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2720 n 0 1834 3390 3338 3339 3340 1834 3567 3390 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2721 n 0 208 2512 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2722 n 0 222 2512 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2723 n 0 1833 2514 3341 3335 3336 1833 3548 2514 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2641 n 0 1836 1838 3341 3335 3336 1836 3569 1838 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2642 n 0 1835 3391 3338 3339 3340 1835 3568 3391 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2643 n 0 1834 3391 3338 3339 3340 1834 3567 3391 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2644 n 0 208 1831 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2645 n 0 222 1831 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2646 n 0 1833 1838 3341 3335 3336 1833 3548 1838 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2148 n 0 1836 1838 3341 3335 3336 1836 3569 1838 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2149 n 0 1835 3391 3338 3339 3340 1835 3568 3391 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2150 n 0 1834 3391 3338 3339 3340 1834 3567 3391 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2151 n 0 208 1831 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2152 n 0 222 1831 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2153 n 0 1833 1838 3341 3335 3336 1833 3548 1838 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2724 n 0 1836 2596 3341 3335 3336 1836 3569 2596 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2725 n 0 1835 3392 3338 3339 3340 1835 3568 3392 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2726 n 0 1834 3392 3338 3339 3340 1834 3567 3392 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2727 n 0 208 2513 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2728 n 0 222 2513 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2729 n 0 1833 2596 3341 3335 3336 1833 3548 2596 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2712 n 0 1836 1839 3341 3335 3336 1836 3569 1839 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2713 n 0 1835 3393 3338 3339 3340 1835 3568 3393 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2714 n 0 1834 3393 3338 3339 3340 1834 3567 3393 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2715 n 0 208 1832 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2716 n 0 222 1832 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2717 n 0 1833 1839 3341 3335 3336 1833 3548 1839 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2154 n 0 1836 1839 3341 3335 3336 1836 3569 1839 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2155 n 0 1835 3393 3338 3339 3340 1835 3568 3393 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2156 n 0 1834 3393 3338 3339 3340 1834 3567 3393 f f r r 0 2281 48 2281 48 _null_ _null_ ) insert ( 2157 n 0 208 1832 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2158 n 0 222 1832 276 - - - - - f f r r 0 1022 0 0 0 '{0,0,0}' _null_ ) insert ( 2159 n 0 1833 1839 3341 3335 3336 1833 3548 1839 f f r r 0 2281 128 2281 128 _null_ _null_ ) insert ( 2818 n 0 2805 - 463 - - - - - f f r r 0 20 0 0 0 0 _null_ ) insert ( 2819 n 0 2806 2807 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2820 n 0 2806 2808 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2821 n 0 2806 2809 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2822 n 0 2806 2810 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2823 n 0 2806 2811 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2824 n 0 2806 2812 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2825 n 0 2806 2813 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2826 n 0 2806 2814 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2827 n 0 2806 2815 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2828 n 0 2806 2816 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2829 n 0 2806 2817 3342 - - - - - f f r r 0 1022 0 0 0 '{0,0,0,0,0,0}' _null_ ) insert ( 2517 n 0 2515 - 2515 - - 3496 3497 3498 f f r r 58 16 0 2281 16 _null_ _null_ ) insert ( 2518 n 0 2516 - 2516 - - 3496 3497 3499 f f r r 59 16 0 2281 16 _null_ _null_ ) insert ( 2519 n 0 2515 - 2515 - - 3496 3497 3498 f f r r 58 16 0 2281 16 _null_ _null_ ) insert ( 2236 n 0 1892 - 1892 - - - - - f f r r 0 21 0 0 0 _null_ _null_ ) insert ( 2237 n 0 1893 - 1893 - - - - - f f r r 0 21 0 0 0 _null_ _null_ ) insert ( 6164 n 0 1894 - 1894 - - - - - f f r r 0 21 0 0 0 _null_ _null_ ) insert ( 2238 n 0 1898 - 1898 - - - - - f f r r 0 23 0 0 0 _null_ _null_ ) insert ( 2239 n 0 1899 - 1899 - - - - - f f r r 0 23 0 0 0 _null_ _null_ ) insert ( 6165 n 0 1900 - 1900 - - - - - f f r r 0 23 0 0 0 _null_ _null_ ) insert ( 2240 n 0 1904 - 1904 - - - - - f f r r 0 20 0 0 0 _null_ _null_ ) insert ( 2241 n 0 1905 - 1905 - - - - - f f r r 0 20 0 0 0 _null_ _null_ ) insert ( 6166 n 0 1906 - 1906 - - - - - f f r r 0 20 0 0 0 _null_ _null_ ) insert ( 2242 n 0 1673 - 1673 - - - - - f f r r 0 1560 0 0 0 _null_ _null_ ) insert ( 2243 n 0 1674 - 1674 - - - - - f f r r 0 1560 0 0 0 _null_ _null_ ) insert ( 6167 n 0 1675 - 1675 - - - - - f f r r 0 1560 0 0 0 _null_ _null_ ) insert ( 2901 n 0 2900 - - - - - - - f f r r 0 142 0 0 0 _null_ _null_ ) insert ( 2335 n 0 2333 2334 6293 6294 6295 - - - t f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 4053 n 0 4051 4052 6296 6297 6298 - - - t f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3538 n 0 3535 3536 6299 6300 6301 - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3545 n 0 3543 3544 6299 6300 6301 - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 4450 n 0 4401 - 4401 - - - - - f f r r 0 3831 0 0 0 _null_ _null_ ) insert ( 4389 n 0 4388 - 4388 - - - - - f f r r 0 4537 0 0 0 _null_ _null_ ) insert ( 4301 n 0 4299 4300 - - - - - - t f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6227 n 0 6225 6226 - - - - - - t f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3175 n 0 3173 3174 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6276 n 0 6275 3174 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3197 n 0 3180 3196 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6281 n 0 6278 3196 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6280 n 0 6277 3196 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6282 n 0 6279 3196 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3267 n 0 3265 3266 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6284 n 0 6283 3266 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3270 n 0 3268 3269 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6289 n 0 6286 3269 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6288 n 0 6285 3269 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 6290 n 0 6287 3269 - - - - - - f f r r 0 2281 0 0 0 _null_ _null_ ) insert ( 3972 o 1 3970 3973 - - - - - - t f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3974 o 1 3970 3975 - - - - - - f f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3976 o 1 3970 3977 - - - - - - f f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3978 o 1 3970 3979 - - - - - - t f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3980 o 1 3970 3981 - - - - - - f f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3982 o 1 3970 3983 - - - - - - f f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3984 o 0 3970 3985 - - - - - - t f s s 0 2281 0 0 0 _null_ _null_ ) insert ( 3986 h 1 3971 3987 - - - - - - t f w w 0 2281 0 0 0 _null_ _null_ ) insert ( 3988 h 1 3971 3989 - - - - - - t f w w 0 2281 0 0 0 _null_ _null_ ) insert ( 3990 h 1 3971 3991 - - - - - - t f w w 0 2281 0 0 0 _null_ _null_ ) insert ( 3992 h 1 3971 3993 - - - - - - t f w w 0 2281 0 0 0 _null_ _null_ ) insert ( 6291 n 0 6292 - 6292 - - - - - f f r r 0 2283 0 0 0 _null_ _null_ ) close pg_aggregate create pg_statistic 2619 ( starelid = oid , staattnum = int2 , stainherit = bool , stanullfrac = float4 , stawidth = int4 , stadistinct = float4 , stakind1 = int2 , stakind2 = int2 , stakind3 = int2 , stakind4 = int2 , stakind5 = int2 , staop1 = oid , staop2 = oid , staop3 = oid , staop4 = oid , staop5 = oid , stacoll1 = oid , stacoll2 = oid , stacoll3 = oid , stacoll4 = oid , stacoll5 = oid , stanumbers1 = _float4 , stanumbers2 = _float4 , stanumbers3 = _float4 , stanumbers4 = _float4 , stanumbers5 = _float4 , stavalues1 = anyarray , stavalues2 = anyarray , stavalues3 = anyarray , stavalues4 = anyarray , stavalues5 = anyarray ) open pg_statistic close pg_statistic create pg_statistic_ext 3381 ( oid = oid , stxrelid = oid , stxname = name , stxnamespace = oid , stxowner = oid , stxkeys = int2vector FORCE NOT NULL , stxstattarget = int2 FORCE NULL , stxkind = _char FORCE NOT NULL , stxexprs = pg_node_tree ) open pg_statistic_ext close pg_statistic_ext create pg_statistic_ext_data 3429 ( stxoid = oid , stxdinherit = bool , stxdndistinct = pg_ndistinct , stxddependencies = pg_dependencies , stxdmcv = pg_mcv_list , stxdexpr = _pg_statistic ) open pg_statistic_ext_data close pg_statistic_ext_data create pg_rewrite 2618 ( oid = oid , rulename = name , ev_class = oid , ev_type = char , ev_enabled = char , is_instead = bool , ev_qual = pg_node_tree FORCE NOT NULL , ev_action = pg_node_tree FORCE NOT NULL ) open pg_rewrite close pg_rewrite create pg_trigger 2620 ( oid = oid , tgrelid = oid , tgparentid = oid , tgname = name , tgfoid = oid , tgtype = int2 , tgenabled = char , tgisinternal = bool , tgconstrrelid = oid , tgconstrindid = oid , tgconstraint = oid , tgdeferrable = bool , tginitdeferred = bool , tgnargs = int2 , tgattr = int2vector FORCE NOT NULL , tgargs = bytea FORCE NOT NULL , tgqual = pg_node_tree , tgoldtable = name , tgnewtable = name ) open pg_trigger close pg_trigger create pg_event_trigger 3466 ( oid = oid , evtname = name , evtevent = name , evtowner = oid , evtfoid = oid , evtenabled = char , evttags = _text ) open pg_event_trigger close pg_event_trigger create pg_description 2609 ( objoid = oid , classoid = oid , objsubid = int4 , description = text FORCE NOT NULL ) open pg_description insert ( 1242 1255 0 'I/O' ) insert ( 1243 1255 0 'I/O' ) insert ( 1244 1255 0 'I/O' ) insert ( 31 1255 0 'I/O' ) insert ( 1245 1255 0 'I/O' ) insert ( 33 1255 0 'I/O' ) insert ( 34 1255 0 'I/O' ) insert ( 35 1255 0 'I/O' ) insert ( 38 1255 0 'I/O' ) insert ( 39 1255 0 'I/O' ) insert ( 40 1255 0 'I/O' ) insert ( 41 1255 0 'I/O' ) insert ( 42 1255 0 'I/O' ) insert ( 43 1255 0 'I/O' ) insert ( 44 1255 0 'I/O' ) insert ( 45 1255 0 'I/O' ) insert ( 3494 1255 0 'convert proname to regproc' ) insert ( 3479 1255 0 'convert proname to regprocedure' ) insert ( 46 1255 0 'I/O' ) insert ( 47 1255 0 'I/O' ) insert ( 48 1255 0 'I/O' ) insert ( 49 1255 0 'I/O' ) insert ( 50 1255 0 'I/O' ) insert ( 51 1255 0 'I/O' ) insert ( 5070 1255 0 'I/O' ) insert ( 5081 1255 0 'I/O' ) insert ( 5082 1255 0 'I/O' ) insert ( 5083 1255 0 'I/O' ) insert ( 52 1255 0 'I/O' ) insert ( 53 1255 0 'I/O' ) insert ( 54 1255 0 'I/O' ) insert ( 55 1255 0 'I/O' ) insert ( 6242 1255 0 'planner support for text_starts_with' ) insert ( 5096 1255 0 less-equal-greater ) insert ( 5071 1255 0 'convert xid8 to xid' ) insert ( 5097 1255 0 'larger of two' ) insert ( 5098 1255 0 'smaller of two' ) insert ( 77 1255 0 'convert char to int4' ) insert ( 78 1255 0 'convert int4 to char' ) insert ( 1364 1255 0 'planner support for textregexeq' ) insert ( 1257 1255 0 length ) insert ( 89 1255 0 'PostgreSQL version string' ) insert ( 86 1255 0 'I/O' ) insert ( 87 1255 0 'I/O' ) insert ( 88 1255 0 'I/O' ) insert ( 90 1255 0 'I/O' ) insert ( 101 1255 0 'restriction selectivity of = and related operators' ) insert ( 102 1255 0 'restriction selectivity of <> and related operators' ) insert ( 103 1255 0 'restriction selectivity of < and related operators on scalar datatypes' ) insert ( 104 1255 0 'restriction selectivity of > and related operators on scalar datatypes' ) insert ( 105 1255 0 'join selectivity of = and related operators' ) insert ( 106 1255 0 'join selectivity of <> and related operators' ) insert ( 107 1255 0 'join selectivity of < and related operators on scalar datatypes' ) insert ( 108 1255 0 'join selectivity of > and related operators on scalar datatypes' ) insert ( 336 1255 0 'restriction selectivity of <= and related operators on scalar datatypes' ) insert ( 337 1255 0 'restriction selectivity of >= and related operators on scalar datatypes' ) insert ( 386 1255 0 'join selectivity of <= and related operators on scalar datatypes' ) insert ( 398 1255 0 'join selectivity of >= and related operators on scalar datatypes' ) insert ( 109 1255 0 'I/O' ) insert ( 110 1255 0 'I/O' ) insert ( 117 1255 0 'I/O' ) insert ( 118 1255 0 'I/O' ) insert ( 119 1255 0 'I/O' ) insert ( 120 1255 0 'I/O' ) insert ( 121 1255 0 'I/O' ) insert ( 122 1255 0 'I/O' ) insert ( 123 1255 0 'I/O' ) insert ( 124 1255 0 'I/O' ) insert ( 139 1255 0 'restriction selectivity for area-comparison operators' ) insert ( 140 1255 0 'join selectivity for area-comparison operators' ) insert ( 195 1255 0 'I/O' ) insert ( 196 1255 0 'I/O' ) insert ( 197 1255 0 'I/O' ) insert ( 198 1255 0 'I/O' ) insert ( 200 1255 0 'I/O' ) insert ( 201 1255 0 'I/O' ) insert ( 208 1255 0 'aggregate transition function' ) insert ( 209 1255 0 'larger of two' ) insert ( 211 1255 0 'smaller of two' ) insert ( 214 1255 0 'I/O' ) insert ( 215 1255 0 'I/O' ) insert ( 222 1255 0 'aggregate transition function' ) insert ( 276 1255 0 'aggregate combine function' ) insert ( 223 1255 0 'larger of two' ) insert ( 224 1255 0 'smaller of two' ) insert ( 228 1255 0 'round to nearest integer' ) insert ( 229 1255 0 'truncate to integer' ) insert ( 2308 1255 0 'nearest integer >= value' ) insert ( 2320 1255 0 'nearest integer >= value' ) insert ( 2309 1255 0 'nearest integer <= value' ) insert ( 2310 1255 0 'sign of value' ) insert ( 233 1255 0 'natural exponential (e^x)' ) insert ( 234 1255 0 'natural logarithm' ) insert ( 235 1255 0 'convert int2 to float8' ) insert ( 236 1255 0 'convert int2 to float4' ) insert ( 237 1255 0 'convert float8 to int2' ) insert ( 238 1255 0 'convert float4 to int2' ) insert ( 246 1255 0 less-equal-greater ) insert ( 253 1255 0 less-equal-greater ) insert ( 266 1255 0 'concatenate name and oid' ) insert ( 274 1255 0 'current date and time - increments during transactions' ) insert ( 320 1255 0 'bucket number of operand in equal-width histogram' ) insert ( 311 1255 0 'convert float4 to float8' ) insert ( 312 1255 0 'convert float8 to float4' ) insert ( 313 1255 0 'convert int2 to int4' ) insert ( 314 1255 0 'convert int4 to int2' ) insert ( 316 1255 0 'convert int4 to float8' ) insert ( 317 1255 0 'convert float8 to int4' ) insert ( 318 1255 0 'convert int4 to float4' ) insert ( 319 1255 0 'convert float4 to int4' ) insert ( 3 1255 0 'row-oriented heap table access method handler' ) insert ( 330 1255 0 'btree index access method handler' ) insert ( 331 1255 0 'hash index access method handler' ) insert ( 332 1255 0 'gist index access method handler' ) insert ( 333 1255 0 'gin index access method handler' ) insert ( 334 1255 0 'spgist index access method handler' ) insert ( 335 1255 0 'brin index access method handler' ) insert ( 3952 1255 0 'brin: standalone scan new table pages' ) insert ( 3999 1255 0 'brin: standalone scan new table pages' ) insert ( 4014 1255 0 'brin: desummarize page range' ) insert ( 338 1255 0 'validate an operator class' ) insert ( 636 1255 0 'test property of an index access method' ) insert ( 637 1255 0 'test property of an index' ) insert ( 638 1255 0 'test property of an index column' ) insert ( 676 1255 0 'return name of given index build phase' ) insert ( 347 1255 0 'I/O' ) insert ( 348 1255 0 'I/O' ) insert ( 350 1255 0 less-equal-greater ) insert ( 3129 1255 0 'sort support' ) insert ( 351 1255 0 less-equal-greater ) insert ( 3130 1255 0 'sort support' ) insert ( 842 1255 0 less-equal-greater ) insert ( 3131 1255 0 'sort support' ) insert ( 354 1255 0 less-equal-greater ) insert ( 3132 1255 0 'sort support' ) insert ( 355 1255 0 less-equal-greater ) insert ( 3133 1255 0 'sort support' ) insert ( 356 1255 0 less-equal-greater ) insert ( 3134 1255 0 'sort support' ) insert ( 404 1255 0 less-equal-greater ) insert ( 358 1255 0 less-equal-greater ) insert ( 359 1255 0 less-equal-greater ) insert ( 3135 1255 0 'sort support' ) insert ( 360 1255 0 less-equal-greater ) insert ( 3255 1255 0 'sort support' ) insert ( 5050 1255 0 'equal image' ) insert ( 377 1255 0 less-equal-greater ) insert ( 382 1255 0 less-equal-greater ) insert ( 4126 1255 0 'window RANGE support' ) insert ( 4127 1255 0 'window RANGE support' ) insert ( 4128 1255 0 'window RANGE support' ) insert ( 4129 1255 0 'window RANGE support' ) insert ( 4130 1255 0 'window RANGE support' ) insert ( 4131 1255 0 'window RANGE support' ) insert ( 4132 1255 0 'window RANGE support' ) insert ( 4139 1255 0 'window RANGE support' ) insert ( 4140 1255 0 'window RANGE support' ) insert ( 4141 1255 0 'window RANGE support' ) insert ( 401 1255 0 'convert char(n) to text' ) insert ( 406 1255 0 'convert name to text' ) insert ( 407 1255 0 'convert text to name' ) insert ( 408 1255 0 'convert name to char(n)' ) insert ( 409 1255 0 'convert char(n) to name' ) insert ( 449 1255 0 hash ) insert ( 441 1255 0 hash ) insert ( 450 1255 0 hash ) insert ( 425 1255 0 hash ) insert ( 949 1255 0 hash ) insert ( 442 1255 0 hash ) insert ( 451 1255 0 hash ) insert ( 443 1255 0 hash ) insert ( 452 1255 0 hash ) insert ( 444 1255 0 hash ) insert ( 453 1255 0 hash ) insert ( 445 1255 0 hash ) insert ( 454 1255 0 hash ) insert ( 446 1255 0 hash ) insert ( 455 1255 0 hash ) insert ( 447 1255 0 hash ) insert ( 400 1255 0 hash ) insert ( 448 1255 0 hash ) insert ( 456 1255 0 hash ) insert ( 772 1255 0 hash ) insert ( 457 1255 0 hash ) insert ( 776 1255 0 hash ) insert ( 329 1255 0 hash ) insert ( 777 1255 0 hash ) insert ( 399 1255 0 hash ) insert ( 778 1255 0 hash ) insert ( 422 1255 0 hash ) insert ( 779 1255 0 hash ) insert ( 432 1255 0 hash ) insert ( 780 1255 0 hash ) insert ( 328 1255 0 hash ) insert ( 781 1255 0 hash ) insert ( 438 1255 0 'count the number of NULL arguments' ) insert ( 440 1255 0 'count the number of non-NULL arguments' ) insert ( 458 1255 0 'larger of two' ) insert ( 459 1255 0 'smaller of two' ) insert ( 460 1255 0 'I/O' ) insert ( 461 1255 0 'I/O' ) insert ( 480 1255 0 'convert int8 to int4' ) insert ( 481 1255 0 'convert int4 to int8' ) insert ( 482 1255 0 'convert int8 to float8' ) insert ( 483 1255 0 'convert float8 to int8' ) insert ( 626 1255 0 hash ) insert ( 782 1255 0 hash ) insert ( 652 1255 0 'convert int8 to float4' ) insert ( 653 1255 0 'convert float4 to int8' ) insert ( 714 1255 0 'convert int8 to int2' ) insert ( 754 1255 0 'convert int2 to int8' ) insert ( 668 1255 0 'adjust char() to typmod length' ) insert ( 3097 1255 0 'planner support for varchar length coercion' ) insert ( 669 1255 0 'adjust varchar() to typmod length' ) insert ( 710 1255 0 'deprecated, use current_user instead' ) insert ( 720 1255 0 'octet length' ) insert ( 721 1255 0 'get byte' ) insert ( 722 1255 0 'set byte' ) insert ( 723 1255 0 'get bit' ) insert ( 724 1255 0 'set bit' ) insert ( 749 1255 0 'substitute portion of string' ) insert ( 752 1255 0 'substitute portion of string' ) insert ( 6163 1255 0 'number of set bits' ) insert ( 745 1255 0 'current user name' ) insert ( 746 1255 0 'session user name' ) insert ( 6311 1255 0 'system user name' ) insert ( 747 1255 0 'array dimensions' ) insert ( 748 1255 0 'number of array dimensions' ) insert ( 750 1255 0 'I/O' ) insert ( 751 1255 0 'I/O' ) insert ( 2091 1255 0 'array lower dimension' ) insert ( 2092 1255 0 'array upper dimension' ) insert ( 2176 1255 0 'array length' ) insert ( 3179 1255 0 'array cardinality' ) insert ( 378 1255 0 'append element onto end of array' ) insert ( 379 1255 0 'prepend element onto front of array' ) insert ( 394 1255 0 'split delimited text' ) insert ( 376 1255 0 'split delimited text, with null string' ) insert ( 6160 1255 0 'split delimited text' ) insert ( 6161 1255 0 'split delimited text, with null string' ) insert ( 395 1255 0 'concatenate array elements, using delimiter, into text' ) insert ( 384 1255 0 'concatenate array elements, using delimiter and null string, into text' ) insert ( 515 1255 0 'larger of two' ) insert ( 516 1255 0 'smaller of two' ) insert ( 3277 1255 0 'returns an offset of value in array' ) insert ( 3278 1255 0 'returns an offset of value in array with start index' ) insert ( 3279 1255 0 'returns an array of offsets of some value in array' ) insert ( 1191 1255 0 'array subscripts generator' ) insert ( 1192 1255 0 'array subscripts generator' ) insert ( 1193 1255 0 'array constructor with value' ) insert ( 1286 1255 0 'array constructor with value' ) insert ( 2331 1255 0 'expand array to set of rows' ) insert ( 3996 1255 0 'planner support for array_unnest' ) insert ( 3167 1255 0 'remove any occurrences of an element from an array' ) insert ( 3168 1255 0 'replace any occurrences of an element in an array' ) insert ( 2333 1255 0 'aggregate transition function' ) insert ( 6293 1255 0 'aggregate combine function' ) insert ( 6294 1255 0 'aggregate serial function' ) insert ( 6295 1255 0 'aggregate deserial function' ) insert ( 2334 1255 0 'aggregate final function' ) insert ( 2335 1255 0 'concatenate aggregate input into an array' ) insert ( 4051 1255 0 'aggregate transition function' ) insert ( 6296 1255 0 'aggregate combine function' ) insert ( 6297 1255 0 'aggregate serial function' ) insert ( 6298 1255 0 'aggregate deserial function' ) insert ( 4052 1255 0 'aggregate final function' ) insert ( 4053 1255 0 'concatenate aggregate input into an array' ) insert ( 3218 1255 0 'bucket number of operand given a sorted array of bucket lower bounds' ) insert ( 6172 1255 0 'remove last N elements of array' ) insert ( 6215 1255 0 'shuffle array' ) insert ( 6216 1255 0 'take samples from array' ) insert ( 3816 1255 0 'array typanalyze' ) insert ( 3817 1255 0 'restriction selectivity for array-containment operators' ) insert ( 3818 1255 0 'join selectivity for array-containment operators' ) insert ( 764 1255 0 'large object import' ) insert ( 767 1255 0 'large object import' ) insert ( 765 1255 0 'large object export' ) insert ( 766 1255 0 increment ) insert ( 768 1255 0 'larger of two' ) insert ( 769 1255 0 'smaller of two' ) insert ( 770 1255 0 'larger of two' ) insert ( 771 1255 0 'smaller of two' ) insert ( 849 1255 0 'position of substring' ) insert ( 1023 1255 0 'planner support for textlike' ) insert ( 860 1255 0 'convert char to char(n)' ) insert ( 861 1255 0 'name of the current database' ) insert ( 817 1255 0 'get the currently executing query' ) insert ( 886 1255 0 'I/O' ) insert ( 887 1255 0 'I/O' ) insert ( 898 1255 0 'larger of two' ) insert ( 899 1255 0 'smaller of two' ) insert ( 935 1255 0 'output money amount as words' ) insert ( 3823 1255 0 'convert money to numeric' ) insert ( 3824 1255 0 'convert numeric to money' ) insert ( 3811 1255 0 'convert int4 to money' ) insert ( 3812 1255 0 'convert int8 to money' ) insert ( 940 1255 0 modulus ) insert ( 941 1255 0 modulus ) insert ( 947 1255 0 modulus ) insert ( 5044 1255 0 'greatest common divisor' ) insert ( 5045 1255 0 'greatest common divisor' ) insert ( 5046 1255 0 'least common multiple' ) insert ( 5047 1255 0 'least common multiple' ) insert ( 944 1255 0 'convert text to char' ) insert ( 946 1255 0 'convert char to text' ) insert ( 952 1255 0 'large object open' ) insert ( 953 1255 0 'large object close' ) insert ( 954 1255 0 'large object read' ) insert ( 955 1255 0 'large object write' ) insert ( 956 1255 0 'large object seek' ) insert ( 3170 1255 0 'large object seek (64 bit)' ) insert ( 957 1255 0 'large object create' ) insert ( 715 1255 0 'large object create' ) insert ( 958 1255 0 'large object position' ) insert ( 3171 1255 0 'large object position (64 bit)' ) insert ( 1004 1255 0 'truncate large object' ) insert ( 3172 1255 0 'truncate large object (64 bit)' ) insert ( 3457 1255 0 'create new large object with given content' ) insert ( 3458 1255 0 'read entire large object' ) insert ( 3459 1255 0 'read large object from offset for length' ) insert ( 3460 1255 0 'write data at offset' ) insert ( 964 1255 0 'large object unlink (delete)' ) insert ( 975 1255 0 'box area' ) insert ( 976 1255 0 'box width' ) insert ( 977 1255 0 'box height' ) insert ( 979 1255 0 'area of a closed path' ) insert ( 4067 1255 0 'bounding box of two boxes' ) insert ( 981 1255 0 'box diagonal' ) insert ( 992 1255 0 'slope between points' ) insert ( 993 1255 0 'convert points to line segment' ) insert ( 1026 1255 0 'adjust timestamp to new time zone' ) insert ( 1031 1255 0 'I/O' ) insert ( 1032 1255 0 'I/O' ) insert ( 1035 1255 0 'add/update ACL item' ) insert ( 1036 1255 0 'remove ACL item' ) insert ( 1037 1255 0 contains ) insert ( 1365 1255 0 'make ACL item' ) insert ( 3943 1255 0 'show hardwired default privileges, primarily for use by the information schema' ) insert ( 1689 1255 0 'convert ACL item array to table, primarily for use by information schema' ) insert ( 1044 1255 0 'I/O' ) insert ( 1045 1255 0 'I/O' ) insert ( 2913 1255 0 'I/O typmod' ) insert ( 2914 1255 0 'I/O typmod' ) insert ( 1046 1255 0 'I/O' ) insert ( 1047 1255 0 'I/O' ) insert ( 2915 1255 0 'I/O typmod' ) insert ( 2916 1255 0 'I/O typmod' ) insert ( 1063 1255 0 'larger of two' ) insert ( 1064 1255 0 'smaller of two' ) insert ( 1078 1255 0 less-equal-greater ) insert ( 3328 1255 0 'sort support' ) insert ( 1080 1255 0 hash ) insert ( 972 1255 0 hash ) insert ( 1081 1255 0 'format a type oid and atttypmod to canonical SQL' ) insert ( 1084 1255 0 'I/O' ) insert ( 1085 1255 0 'I/O' ) insert ( 1092 1255 0 less-equal-greater ) insert ( 3136 1255 0 'sort support' ) insert ( 4133 1255 0 'window RANGE support' ) insert ( 1107 1255 0 less-equal-greater ) insert ( 1138 1255 0 'larger of two' ) insert ( 1139 1255 0 'smaller of two' ) insert ( 1143 1255 0 'I/O' ) insert ( 1144 1255 0 'I/O' ) insert ( 2909 1255 0 'I/O typmod' ) insert ( 2910 1255 0 'I/O typmod' ) insert ( 1150 1255 0 'I/O' ) insert ( 1151 1255 0 'I/O' ) insert ( 2907 1255 0 'I/O typmod' ) insert ( 2908 1255 0 'I/O typmod' ) insert ( 1158 1255 0 'convert UNIX epoch to timestamptz' ) insert ( 1159 1255 0 'adjust timestamp to new time zone' ) insert ( 6334 1255 0 'adjust timestamp to local time zone' ) insert ( 1160 1255 0 'I/O' ) insert ( 1161 1255 0 'I/O' ) insert ( 2903 1255 0 'I/O typmod' ) insert ( 2904 1255 0 'I/O typmod' ) insert ( 1171 1255 0 'extract field from timestamp with time zone' ) insert ( 6203 1255 0 'extract field from timestamp with time zone' ) insert ( 1172 1255 0 'extract field from interval' ) insert ( 6204 1255 0 'extract field from interval' ) insert ( 1174 1255 0 'convert date to timestamp with time zone' ) insert ( 2711 1255 0 'promote groups of 24 hours to numbers of days and promote groups of 30 days to numbers of months' ) insert ( 1175 1255 0 'promote groups of 24 hours to numbers of days' ) insert ( 1295 1255 0 'promote groups of 30 days to numbers of months' ) insert ( 1176 1255 0 'convert date and time to timestamp with time zone' ) insert ( 1178 1255 0 'convert timestamp with time zone to date' ) insert ( 1181 1255 0 'age of a transaction ID, in transactions before current transaction' ) insert ( 3939 1255 0 'age of a multi-transaction ID, in multi-transactions before current multi-transaction' ) insert ( 6221 1255 0 'add interval to timestamp with time zone' ) insert ( 6222 1255 0 'add interval to timestamp with time zone in specified time zone' ) insert ( 6223 1255 0 'subtract interval from timestamp with time zone' ) insert ( 6273 1255 0 'subtract interval from timestamp with time zone in specified time zone' ) insert ( 1195 1255 0 'smaller of two' ) insert ( 1196 1255 0 'larger of two' ) insert ( 1197 1255 0 'smaller of two' ) insert ( 1198 1255 0 'larger of two' ) insert ( 1199 1255 0 'date difference preserving months and years' ) insert ( 3918 1255 0 'planner support for interval length coercion' ) insert ( 1200 1255 0 'adjust interval precision' ) insert ( 1215 1255 0 'get description for object id and catalog name' ) insert ( 1216 1255 0 'get description for table column' ) insert ( 1993 1255 0 'get description for object id and shared catalog name' ) insert ( 1217 1255 0 'truncate timestamp with time zone to specified units' ) insert ( 1284 1255 0 'truncate timestamp with time zone to specified units in specified time zone' ) insert ( 1218 1255 0 'truncate interval to specified units' ) insert ( 1219 1255 0 increment ) insert ( 3546 1255 0 decrement ) insert ( 2804 1255 0 'increment, ignores second argument' ) insert ( 3547 1255 0 'decrement, ignores second argument' ) insert ( 1236 1255 0 'larger of two' ) insert ( 1237 1255 0 'smaller of two' ) insert ( 1024 1255 0 'planner support for texticregexeq' ) insert ( 1271 1255 0 'intervals overlap?' ) insert ( 1273 1255 0 'extract field from time with time zone' ) insert ( 6201 1255 0 'extract field from time with time zone' ) insert ( 1287 1255 0 'convert int8 to oid' ) insert ( 1288 1255 0 'convert oid to int8' ) insert ( 1291 1255 0 'trigger to suppress updates when new and old records match' ) insert ( 1294 1255 0 'latest tid of a tuple' ) insert ( 2794 1255 0 less-equal-greater ) insert ( 2795 1255 0 'larger of two' ) insert ( 2796 1255 0 'smaller of two' ) insert ( 2233 1255 0 hash ) insert ( 2234 1255 0 hash ) insert ( 1299 1255 0 'current transaction time' ) insert ( 2647 1255 0 'current transaction time' ) insert ( 2648 1255 0 'current statement time' ) insert ( 2649 1255 0 'current clock time' ) insert ( 1300 1255 0 'restriction selectivity for position-comparison operators' ) insert ( 1301 1255 0 'join selectivity for position-comparison operators' ) insert ( 1302 1255 0 'restriction selectivity for containment comparison operators' ) insert ( 1303 1255 0 'join selectivity for containment comparison operators' ) insert ( 1304 1255 0 'intervals overlap?' ) insert ( 1305 1255 0 'intervals overlap?' ) insert ( 1306 1255 0 'intervals overlap?' ) insert ( 1307 1255 0 'intervals overlap?' ) insert ( 1308 1255 0 'intervals overlap?' ) insert ( 1309 1255 0 'intervals overlap?' ) insert ( 1310 1255 0 'intervals overlap?' ) insert ( 1311 1255 0 'intervals overlap?' ) insert ( 1312 1255 0 'I/O' ) insert ( 1313 1255 0 'I/O' ) insert ( 2905 1255 0 'I/O typmod' ) insert ( 2906 1255 0 'I/O typmod' ) insert ( 1314 1255 0 less-equal-greater ) insert ( 1315 1255 0 less-equal-greater ) insert ( 1316 1255 0 'convert timestamp to time' ) insert ( 1317 1255 0 length ) insert ( 1318 1255 0 'character length' ) insert ( 1339 1255 0 'base 10 logarithm' ) insert ( 1340 1255 0 'base 10 logarithm' ) insert ( 1194 1255 0 'base 10 logarithm' ) insert ( 1341 1255 0 'natural logarithm' ) insert ( 1342 1255 0 'round to nearest integer' ) insert ( 1343 1255 0 'truncate to integer' ) insert ( 1344 1255 0 'square root' ) insert ( 1345 1255 0 'cube root' ) insert ( 1346 1255 0 exponentiation ) insert ( 1368 1255 0 exponentiation ) insert ( 1347 1255 0 'natural exponential (e^x)' ) insert ( 1348 1255 0 'deprecated, use two-argument form instead' ) insert ( 1349 1255 0 'print type names of oidvector field' ) insert ( 1350 1255 0 'I/O' ) insert ( 1351 1255 0 'I/O' ) insert ( 2911 1255 0 'I/O typmod' ) insert ( 2912 1255 0 'I/O typmod' ) insert ( 1358 1255 0 less-equal-greater ) insert ( 1359 1255 0 'convert date and time with time zone to timestamp with time zone' ) insert ( 1367 1255 0 'character length' ) insert ( 1369 1255 0 'character length' ) insert ( 1370 1255 0 'convert time to interval' ) insert ( 1372 1255 0 'character length' ) insert ( 1374 1255 0 'octet length' ) insert ( 1375 1255 0 'octet length' ) insert ( 1377 1255 0 'larger of two' ) insert ( 1378 1255 0 'smaller of two' ) insert ( 1379 1255 0 'larger of two' ) insert ( 1380 1255 0 'smaller of two' ) insert ( 1381 1255 0 'character length' ) insert ( 1384 1255 0 'extract field from date' ) insert ( 6199 1255 0 'extract field from date' ) insert ( 1385 1255 0 'extract field from time' ) insert ( 6200 1255 0 'extract field from time' ) insert ( 1386 1255 0 'date difference from today preserving months and years' ) insert ( 1388 1255 0 'convert timestamp with time zone to time with time zone' ) insert ( 1373 1255 0 'finite date?' ) insert ( 1389 1255 0 'finite timestamp?' ) insert ( 1390 1255 0 'finite interval?' ) insert ( 1376 1255 0 factorial ) insert ( 1394 1255 0 'absolute value' ) insert ( 1395 1255 0 'absolute value' ) insert ( 1396 1255 0 'absolute value' ) insert ( 1397 1255 0 'absolute value' ) insert ( 1398 1255 0 'absolute value' ) insert ( 1400 1255 0 'convert varchar to name' ) insert ( 1401 1255 0 'convert name to varchar' ) insert ( 1402 1255 0 'current schema name' ) insert ( 1403 1255 0 'current schema search list' ) insert ( 1404 1255 0 'substitute portion of string' ) insert ( 1405 1255 0 'substitute portion of string' ) insert ( 1406 1255 0 'vertically aligned' ) insert ( 1407 1255 0 'horizontally aligned' ) insert ( 1408 1255 0 parallel ) insert ( 1409 1255 0 perpendicular ) insert ( 1410 1255 0 vertical ) insert ( 1411 1255 0 horizontal ) insert ( 1412 1255 0 parallel ) insert ( 1413 1255 0 perpendicular ) insert ( 1414 1255 0 vertical ) insert ( 1415 1255 0 horizontal ) insert ( 1416 1255 0 'center of' ) insert ( 1419 1255 0 'convert interval to time' ) insert ( 1421 1255 0 'convert points to box' ) insert ( 1430 1255 0 'path closed?' ) insert ( 1431 1255 0 'path open?' ) insert ( 1433 1255 0 'close path' ) insert ( 1434 1255 0 'open path' ) insert ( 1440 1255 0 'convert x, y to point' ) insert ( 1446 1255 0 'convert polygon to bounding box' ) insert ( 1447 1255 0 'convert polygon to path' ) insert ( 1448 1255 0 'convert box to polygon' ) insert ( 1449 1255 0 'convert path to polygon' ) insert ( 1450 1255 0 'I/O' ) insert ( 1451 1255 0 'I/O' ) insert ( 1468 1255 0 'area of circle' ) insert ( 1469 1255 0 'diameter of circle' ) insert ( 1470 1255 0 'radius of circle' ) insert ( 1473 1255 0 'convert point and radius to circle' ) insert ( 1474 1255 0 'convert polygon to circle' ) insert ( 1475 1255 0 'convert vertex count and circle to polygon' ) insert ( 4091 1255 0 'convert point to empty box' ) insert ( 1479 1255 0 'convert box to circle' ) insert ( 1480 1255 0 'convert circle to box' ) insert ( 1490 1255 0 'I/O' ) insert ( 1491 1255 0 'I/O' ) insert ( 1493 1255 0 'construct line from points' ) insert ( 1530 1255 0 'distance between endpoints' ) insert ( 1531 1255 0 'sum of path segments' ) insert ( 1532 1255 0 'center of' ) insert ( 1534 1255 0 'center of' ) insert ( 1540 1255 0 'center of' ) insert ( 1541 1255 0 'diagonal of' ) insert ( 1542 1255 0 'center of' ) insert ( 1543 1255 0 'center of' ) insert ( 1544 1255 0 'convert circle to 12-vertex polygon' ) insert ( 1545 1255 0 'number of points' ) insert ( 1556 1255 0 'number of points' ) insert ( 1564 1255 0 'I/O' ) insert ( 1565 1255 0 'I/O' ) insert ( 2919 1255 0 'I/O typmod' ) insert ( 2920 1255 0 'I/O typmod' ) insert ( 1569 1255 0 'matches LIKE expression' ) insert ( 1570 1255 0 'does not match LIKE expression' ) insert ( 1571 1255 0 'matches LIKE expression' ) insert ( 1572 1255 0 'does not match LIKE expression' ) insert ( 1574 1255 0 'sequence next value' ) insert ( 1575 1255 0 'sequence current value' ) insert ( 1576 1255 0 'set sequence value' ) insert ( 1765 1255 0 'set sequence value and is_called status' ) insert ( 3078 1255 0 'sequence parameters, for use by information schema' ) insert ( 4032 1255 0 'sequence last value' ) insert ( 275 1255 0 'return the next oid for a system table' ) insert ( 6241 1255 0 'stop making pinned objects during initdb' ) insert ( 1579 1255 0 'I/O' ) insert ( 1580 1255 0 'I/O' ) insert ( 2902 1255 0 'I/O typmod' ) insert ( 2921 1255 0 'I/O typmod' ) insert ( 1596 1255 0 less-equal-greater ) insert ( 1598 1255 0 'random value' ) insert ( 6212 1255 0 'random value from normal distribution' ) insert ( 6339 1255 0 'random integer in range' ) insert ( 6340 1255 0 'random bigint in range' ) insert ( 6341 1255 0 'random numeric in range' ) insert ( 1599 1255 0 'set random seed' ) insert ( 1600 1255 0 arcsine ) insert ( 1601 1255 0 arccosine ) insert ( 1602 1255 0 arctangent ) insert ( 1603 1255 0 'arctangent, two arguments' ) insert ( 1604 1255 0 sine ) insert ( 1605 1255 0 cosine ) insert ( 1606 1255 0 tangent ) insert ( 1607 1255 0 cotangent ) insert ( 2731 1255 0 'arcsine, degrees' ) insert ( 2732 1255 0 'arccosine, degrees' ) insert ( 2733 1255 0 'arctangent, degrees' ) insert ( 2734 1255 0 'arctangent, two arguments, degrees' ) insert ( 2735 1255 0 'sine, degrees' ) insert ( 2736 1255 0 'cosine, degrees' ) insert ( 2737 1255 0 'tangent, degrees' ) insert ( 2738 1255 0 'cotangent, degrees' ) insert ( 1608 1255 0 'radians to degrees' ) insert ( 1609 1255 0 'degrees to radians' ) insert ( 1610 1255 0 PI ) insert ( 2462 1255 0 'hyperbolic sine' ) insert ( 2463 1255 0 'hyperbolic cosine' ) insert ( 2464 1255 0 'hyperbolic tangent' ) insert ( 2465 1255 0 'inverse hyperbolic sine' ) insert ( 2466 1255 0 'inverse hyperbolic cosine' ) insert ( 2467 1255 0 'inverse hyperbolic tangent' ) insert ( 6219 1255 0 'error function' ) insert ( 6220 1255 0 'complementary error function' ) insert ( 1620 1255 0 'convert first char to int4' ) insert ( 1621 1255 0 'convert int4 to char' ) insert ( 1622 1255 0 'replicate string n times' ) insert ( 1623 1255 0 'convert SQL regexp pattern to POSIX style' ) insert ( 1986 1255 0 'convert SQL regexp pattern to POSIX style' ) insert ( 1987 1255 0 'convert SQL regexp pattern to POSIX style' ) insert ( 1025 1255 0 'planner support for texticlike' ) insert ( 1637 1255 0 'convert LIKE pattern to use backslash escapes' ) insert ( 868 1255 0 'position of substring' ) insert ( 870 1255 0 lowercase ) insert ( 871 1255 0 uppercase ) insert ( 872 1255 0 'capitalize each word' ) insert ( 873 1255 0 'left-pad string to length' ) insert ( 874 1255 0 'right-pad string to length' ) insert ( 875 1255 0 'trim selected characters from left end of string' ) insert ( 876 1255 0 'trim selected characters from right end of string' ) insert ( 877 1255 0 'extract portion of string' ) insert ( 878 1255 0 'map a set of characters appearing in string' ) insert ( 879 1255 0 'left-pad string to length' ) insert ( 880 1255 0 'right-pad string to length' ) insert ( 881 1255 0 'trim spaces from left end of string' ) insert ( 882 1255 0 'trim spaces from right end of string' ) insert ( 883 1255 0 'extract portion of string' ) insert ( 884 1255 0 'trim selected characters from both ends of string' ) insert ( 885 1255 0 'trim spaces from both ends of string' ) insert ( 936 1255 0 'extract portion of string' ) insert ( 937 1255 0 'extract portion of string' ) insert ( 2087 1255 0 'replace all occurrences in string of old_substr with new_substr' ) insert ( 2284 1255 0 'replace text using regexp' ) insert ( 2285 1255 0 'replace text using regexp' ) insert ( 6251 1255 0 'replace text using regexp' ) insert ( 6252 1255 0 'replace text using regexp' ) insert ( 6253 1255 0 'replace text using regexp' ) insert ( 3396 1255 0 'find first match for regexp' ) insert ( 3397 1255 0 'find first match for regexp' ) insert ( 2763 1255 0 'find match(es) for regexp' ) insert ( 2764 1255 0 'find match(es) for regexp' ) insert ( 6254 1255 0 'count regexp matches' ) insert ( 6255 1255 0 'count regexp matches' ) insert ( 6256 1255 0 'count regexp matches' ) insert ( 6257 1255 0 'position of regexp match' ) insert ( 6258 1255 0 'position of regexp match' ) insert ( 6259 1255 0 'position of regexp match' ) insert ( 6260 1255 0 'position of regexp match' ) insert ( 6261 1255 0 'position of regexp match' ) insert ( 6262 1255 0 'position of regexp match' ) insert ( 6263 1255 0 'test for regexp match' ) insert ( 6264 1255 0 'test for regexp match' ) insert ( 6265 1255 0 'extract substring that matches regexp' ) insert ( 6266 1255 0 'extract substring that matches regexp' ) insert ( 6267 1255 0 'extract substring that matches regexp' ) insert ( 6268 1255 0 'extract substring that matches regexp' ) insert ( 6269 1255 0 'extract substring that matches regexp' ) insert ( 2088 1255 0 'split string by field_sep and return field_num' ) insert ( 2765 1255 0 'split string by pattern' ) insert ( 2766 1255 0 'split string by pattern' ) insert ( 2767 1255 0 'split string by pattern' ) insert ( 2768 1255 0 'split string by pattern' ) insert ( 6330 1255 0 'convert int4 number to binary' ) insert ( 6331 1255 0 'convert int8 number to binary' ) insert ( 6332 1255 0 'convert int4 number to oct' ) insert ( 6333 1255 0 'convert int8 number to oct' ) insert ( 2089 1255 0 'convert int4 number to hex' ) insert ( 2090 1255 0 'convert int8 number to hex' ) insert ( 1039 1255 0 'encoding name of current database' ) insert ( 810 1255 0 'encoding name of current database' ) insert ( 1713 1255 0 'length of string in specified encoding' ) insert ( 1714 1255 0 'convert string with specified source encoding name' ) insert ( 1717 1255 0 'convert string with specified destination encoding name' ) insert ( 1813 1255 0 'convert string with specified encoding names' ) insert ( 1264 1255 0 'convert encoding name to encoding id' ) insert ( 1597 1255 0 'convert encoding id to encoding name' ) insert ( 2319 1255 0 'maximum octet length of a character in given encoding' ) insert ( 1573 1255 0 'source text of a rule' ) insert ( 1640 1255 0 'select statement of a view' ) insert ( 1641 1255 0 'select statement of a view' ) insert ( 1642 1255 0 'role name by OID (with fallback)' ) insert ( 1643 1255 0 'index description' ) insert ( 3415 1255 0 'extended statistics object description' ) insert ( 6174 1255 0 'extended statistics columns' ) insert ( 6173 1255 0 'extended statistics expressions' ) insert ( 3352 1255 0 'partition key description' ) insert ( 3408 1255 0 'partition constraint description' ) insert ( 1662 1255 0 'trigger description' ) insert ( 1387 1255 0 'constraint description' ) insert ( 1716 1255 0 'deparse an encoded expression' ) insert ( 1665 1255 0 'name of sequence for a serial column' ) insert ( 2098 1255 0 'definition of a function' ) insert ( 2162 1255 0 'argument list of a function' ) insert ( 2232 1255 0 'identity argument list of a function' ) insert ( 2165 1255 0 'result type of a function' ) insert ( 3808 1255 0 'function argument default' ) insert ( 6197 1255 0 'function SQL body' ) insert ( 1686 1255 0 'list of SQL keywords' ) insert ( 6159 1255 0 'list of catalog foreign key relationships' ) insert ( 2289 1255 0 'convert generic options array to name/value table' ) insert ( 1619 1255 0 'type of the argument' ) insert ( 6315 1255 0 'base type of a domain type' ) insert ( 3162 1255 0 'collation of the argument; implementation of the COLLATION FOR expression' ) insert ( 3842 1255 0 'is a relation insertable/updatable/deletable' ) insert ( 3843 1255 0 'is a column updatable' ) insert ( 6120 1255 0 'oid of replica identity index if any' ) insert ( 1250 1255 0 'deferred UNIQUE constraint check' ) insert ( 1644 1255 0 'referential integrity FOREIGN KEY ... REFERENCES' ) insert ( 1645 1255 0 'referential integrity FOREIGN KEY ... REFERENCES' ) insert ( 1646 1255 0 'referential integrity ON DELETE CASCADE' ) insert ( 1647 1255 0 'referential integrity ON UPDATE CASCADE' ) insert ( 1648 1255 0 'referential integrity ON DELETE RESTRICT' ) insert ( 1649 1255 0 'referential integrity ON UPDATE RESTRICT' ) insert ( 1650 1255 0 'referential integrity ON DELETE SET NULL' ) insert ( 1651 1255 0 'referential integrity ON UPDATE SET NULL' ) insert ( 1652 1255 0 'referential integrity ON DELETE SET DEFAULT' ) insert ( 1653 1255 0 'referential integrity ON UPDATE SET DEFAULT' ) insert ( 1654 1255 0 'referential integrity ON DELETE NO ACTION' ) insert ( 1655 1255 0 'referential integrity ON UPDATE NO ACTION' ) insert ( 1672 1255 0 less-equal-greater ) insert ( 1680 1255 0 'extract portion of bitstring' ) insert ( 1681 1255 0 'bitstring length' ) insert ( 1682 1255 0 'octet length' ) insert ( 1683 1255 0 'convert int4 to bitstring' ) insert ( 1684 1255 0 'convert bitstring to int4' ) insert ( 1685 1255 0 'adjust bit() to typmod length' ) insert ( 3158 1255 0 'planner support for varbit length coercion' ) insert ( 1687 1255 0 'adjust varbit() to typmod length' ) insert ( 1698 1255 0 'position of sub-bitstring' ) insert ( 1699 1255 0 'extract portion of bitstring' ) insert ( 3030 1255 0 'substitute portion of bitstring' ) insert ( 3031 1255 0 'substitute portion of bitstring' ) insert ( 3032 1255 0 'get bit' ) insert ( 3033 1255 0 'set bit' ) insert ( 6162 1255 0 'number of set bits' ) insert ( 436 1255 0 'I/O' ) insert ( 437 1255 0 'I/O' ) insert ( 753 1255 0 'MACADDR manufacturer fields' ) insert ( 836 1255 0 less-equal-greater ) insert ( 3359 1255 0 'sort support' ) insert ( 4110 1255 0 'I/O' ) insert ( 4111 1255 0 'I/O' ) insert ( 4112 1255 0 'MACADDR8 manufacturer fields' ) insert ( 4119 1255 0 less-equal-greater ) insert ( 4123 1255 0 'convert macaddr to macaddr8' ) insert ( 4124 1255 0 'convert macaddr8 to macaddr' ) insert ( 4125 1255 0 'set 7th bit in macaddr8' ) insert ( 910 1255 0 'I/O' ) insert ( 911 1255 0 'I/O' ) insert ( 1267 1255 0 'I/O' ) insert ( 1427 1255 0 'I/O' ) insert ( 3562 1255 0 'larger of two' ) insert ( 3563 1255 0 'smaller of two' ) insert ( 926 1255 0 less-equal-greater ) insert ( 1173 1255 0 'planner support for network_sub/superset' ) insert ( 5033 1255 0 'sort support' ) insert ( 598 1255 0 'abbreviated display of inet value' ) insert ( 599 1255 0 'abbreviated display of cidr value' ) insert ( 605 1255 0 'change netmask of inet' ) insert ( 635 1255 0 'change netmask of cidr' ) insert ( 711 1255 0 'address family (4 for IPv4, 6 for IPv6)' ) insert ( 683 1255 0 'network part of address' ) insert ( 696 1255 0 'netmask of address' ) insert ( 697 1255 0 'netmask length' ) insert ( 698 1255 0 'broadcast address of network' ) insert ( 699 1255 0 'show address octets only' ) insert ( 730 1255 0 'show all parts of inet/cidr value' ) insert ( 1362 1255 0 'hostmask of address' ) insert ( 1715 1255 0 'convert inet to cidr' ) insert ( 2196 1255 0 'inet address of the client' ) insert ( 2197 1255 0 'client''s port number for this connection' ) insert ( 2198 1255 0 'inet address of the server' ) insert ( 2199 1255 0 'server''s port number for this connection' ) insert ( 4071 1255 0 'are the addresses from the same family?' ) insert ( 4063 1255 0 'the smallest network which includes both of the given networks' ) insert ( 3553 1255 0 'GiST support' ) insert ( 3554 1255 0 'GiST support' ) insert ( 3555 1255 0 'GiST support' ) insert ( 3573 1255 0 'GiST support' ) insert ( 3557 1255 0 'GiST support' ) insert ( 3558 1255 0 'GiST support' ) insert ( 3559 1255 0 'GiST support' ) insert ( 3795 1255 0 'SP-GiST support' ) insert ( 3796 1255 0 'SP-GiST support' ) insert ( 3797 1255 0 'SP-GiST support' ) insert ( 3798 1255 0 'SP-GiST support' ) insert ( 3799 1255 0 'SP-GiST support' ) insert ( 3560 1255 0 'restriction selectivity for network operators' ) insert ( 3561 1255 0 'join selectivity for network operators' ) insert ( 1693 1255 0 less-equal-greater ) insert ( 1688 1255 0 hash ) insert ( 3409 1255 0 hash ) insert ( 1696 1255 0 hash ) insert ( 3410 1255 0 hash ) insert ( 1697 1255 0 hash ) insert ( 3418 1255 0 hash ) insert ( 1701 1255 0 'I/O' ) insert ( 1702 1255 0 'I/O' ) insert ( 2917 1255 0 'I/O typmod' ) insert ( 2918 1255 0 'I/O typmod' ) insert ( 3157 1255 0 'planner support for numeric length coercion' ) insert ( 1703 1255 0 'adjust numeric to typmod precision/scale' ) insert ( 1705 1255 0 'absolute value' ) insert ( 1706 1255 0 'sign of value' ) insert ( 1707 1255 0 'value rounded to ''scale''' ) insert ( 1708 1255 0 'value rounded to ''scale'' of zero' ) insert ( 1709 1255 0 'value truncated to ''scale''' ) insert ( 1710 1255 0 'value truncated to ''scale'' of zero' ) insert ( 1711 1255 0 'nearest integer >= value' ) insert ( 2167 1255 0 'nearest integer >= value' ) insert ( 1712 1255 0 'nearest integer <= value' ) insert ( 1728 1255 0 modulus ) insert ( 5048 1255 0 'greatest common divisor' ) insert ( 5049 1255 0 'least common multiple' ) insert ( 1730 1255 0 'square root' ) insert ( 1731 1255 0 'square root' ) insert ( 1732 1255 0 'natural exponential (e^x)' ) insert ( 1733 1255 0 'natural exponential (e^x)' ) insert ( 1734 1255 0 'natural logarithm' ) insert ( 1735 1255 0 'natural logarithm' ) insert ( 1736 1255 0 'logarithm base m of n' ) insert ( 1737 1255 0 'logarithm base m of n' ) insert ( 1738 1255 0 exponentiation ) insert ( 2169 1255 0 exponentiation ) insert ( 3281 1255 0 'number of decimal digits in the fractional part' ) insert ( 5042 1255 0 'minimum scale needed to represent the value' ) insert ( 5043 1255 0 'numeric with minimum scale needed to represent the value' ) insert ( 1740 1255 0 'convert int4 to numeric' ) insert ( 1741 1255 0 'base 10 logarithm' ) insert ( 1481 1255 0 'base 10 logarithm' ) insert ( 1742 1255 0 'convert float4 to numeric' ) insert ( 1743 1255 0 'convert float8 to numeric' ) insert ( 1744 1255 0 'convert numeric to int4' ) insert ( 1745 1255 0 'convert numeric to float4' ) insert ( 1746 1255 0 'convert numeric to float8' ) insert ( 1973 1255 0 'trunc(x/y)' ) insert ( 1980 1255 0 'trunc(x/y)' ) insert ( 2170 1255 0 'bucket number of operand in equal-width histogram' ) insert ( 1764 1255 0 'increment by one' ) insert ( 1766 1255 0 'smaller of two' ) insert ( 1767 1255 0 'larger of two' ) insert ( 1769 1255 0 less-equal-greater ) insert ( 3283 1255 0 'sort support' ) insert ( 1779 1255 0 'convert numeric to int8' ) insert ( 1781 1255 0 'convert int8 to numeric' ) insert ( 1782 1255 0 'convert int2 to numeric' ) insert ( 1783 1255 0 'convert numeric to int2' ) insert ( 6103 1255 0 'convert numeric to pg_lsn' ) insert ( 3556 1255 0 'convert jsonb to boolean' ) insert ( 3449 1255 0 'convert jsonb to numeric' ) insert ( 3450 1255 0 'convert jsonb to int2' ) insert ( 3451 1255 0 'convert jsonb to int4' ) insert ( 3452 1255 0 'convert jsonb to int8' ) insert ( 3453 1255 0 'convert jsonb to float4' ) insert ( 2580 1255 0 'convert jsonb to float8' ) insert ( 1770 1255 0 'format timestamp with time zone to text' ) insert ( 1772 1255 0 'format numeric to text' ) insert ( 1773 1255 0 'format int4 to text' ) insert ( 1774 1255 0 'format int8 to text' ) insert ( 1775 1255 0 'format float4 to text' ) insert ( 1776 1255 0 'format float8 to text' ) insert ( 1777 1255 0 'convert text to numeric' ) insert ( 1778 1255 0 'convert text to timestamp with time zone' ) insert ( 1780 1255 0 'convert text to date' ) insert ( 1768 1255 0 'format interval to text' ) insert ( 1282 1255 0 'quote an identifier for usage in a querystring' ) insert ( 1283 1255 0 'quote a literal for usage in a querystring' ) insert ( 1285 1255 0 'quote a data value for usage in a querystring' ) insert ( 1289 1255 0 'quote a possibly-null literal for usage in a querystring' ) insert ( 1290 1255 0 'quote a possibly-null data value for usage in a querystring' ) insert ( 1798 1255 0 'I/O' ) insert ( 1799 1255 0 'I/O' ) insert ( 3058 1255 0 'concatenate values' ) insert ( 3059 1255 0 'concatenate values with separators' ) insert ( 3060 1255 0 'extract the first n characters' ) insert ( 3061 1255 0 'extract the last n characters' ) insert ( 3062 1255 0 'reverse text' ) insert ( 3539 1255 0 'format text message' ) insert ( 3540 1255 0 'format text message' ) insert ( 1810 1255 0 'length in bits' ) insert ( 1811 1255 0 'length in bits' ) insert ( 1812 1255 0 'length in bits' ) insert ( 1814 1255 0 'restriction selectivity of ILIKE' ) insert ( 1815 1255 0 'restriction selectivity of NOT ILIKE' ) insert ( 1816 1255 0 'join selectivity of ILIKE' ) insert ( 1817 1255 0 'join selectivity of NOT ILIKE' ) insert ( 1818 1255 0 'restriction selectivity of regex match' ) insert ( 1819 1255 0 'restriction selectivity of LIKE' ) insert ( 1820 1255 0 'restriction selectivity of case-insensitive regex match' ) insert ( 1821 1255 0 'restriction selectivity of regex non-match' ) insert ( 1822 1255 0 'restriction selectivity of NOT LIKE' ) insert ( 1823 1255 0 'restriction selectivity of case-insensitive regex non-match' ) insert ( 1824 1255 0 'join selectivity of regex match' ) insert ( 1825 1255 0 'join selectivity of LIKE' ) insert ( 1826 1255 0 'join selectivity of case-insensitive regex match' ) insert ( 1827 1255 0 'join selectivity of regex non-match' ) insert ( 1828 1255 0 'join selectivity of NOT LIKE' ) insert ( 1829 1255 0 'join selectivity of case-insensitive regex non-match' ) insert ( 3437 1255 0 'restriction selectivity of exact prefix' ) insert ( 3438 1255 0 'join selectivity of exact prefix' ) insert ( 1830 1255 0 'aggregate final function' ) insert ( 2512 1255 0 'aggregate final function' ) insert ( 1831 1255 0 'aggregate final function' ) insert ( 2513 1255 0 'aggregate final function' ) insert ( 1832 1255 0 'aggregate final function' ) insert ( 1833 1255 0 'aggregate transition function' ) insert ( 3341 1255 0 'aggregate combine function' ) insert ( 2858 1255 0 'aggregate transition function' ) insert ( 3337 1255 0 'aggregate combine function' ) insert ( 2740 1255 0 'aggregate serial function' ) insert ( 2741 1255 0 'aggregate deserial function' ) insert ( 3335 1255 0 'aggregate serial function' ) insert ( 3336 1255 0 'aggregate deserial function' ) insert ( 3548 1255 0 'aggregate transition function' ) insert ( 1834 1255 0 'aggregate transition function' ) insert ( 1835 1255 0 'aggregate transition function' ) insert ( 1836 1255 0 'aggregate transition function' ) insert ( 3338 1255 0 'aggregate combine function' ) insert ( 3339 1255 0 'aggregate serial function' ) insert ( 3340 1255 0 'aggregate deserial function' ) insert ( 2746 1255 0 'aggregate transition function' ) insert ( 3567 1255 0 'aggregate transition function' ) insert ( 3568 1255 0 'aggregate transition function' ) insert ( 3569 1255 0 'aggregate transition function' ) insert ( 3387 1255 0 'aggregate transition function' ) insert ( 2785 1255 0 'aggregate combine function' ) insert ( 2786 1255 0 'aggregate serial function' ) insert ( 2787 1255 0 'aggregate deserial function' ) insert ( 3324 1255 0 'aggregate combine function' ) insert ( 3178 1255 0 'aggregate final function' ) insert ( 1837 1255 0 'aggregate final function' ) insert ( 2514 1255 0 'aggregate final function' ) insert ( 1838 1255 0 'aggregate final function' ) insert ( 2596 1255 0 'aggregate final function' ) insert ( 1839 1255 0 'aggregate final function' ) insert ( 1840 1255 0 'aggregate transition function' ) insert ( 1841 1255 0 'aggregate transition function' ) insert ( 1842 1255 0 'aggregate transition function' ) insert ( 3388 1255 0 'aggregate final function' ) insert ( 3389 1255 0 'aggregate final function' ) insert ( 3390 1255 0 'aggregate final function' ) insert ( 3391 1255 0 'aggregate final function' ) insert ( 3392 1255 0 'aggregate final function' ) insert ( 3393 1255 0 'aggregate final function' ) insert ( 1843 1255 0 'aggregate transition function' ) insert ( 3325 1255 0 'aggregate combine function' ) insert ( 3549 1255 0 'aggregate transition function' ) insert ( 6324 1255 0 'aggregate serial function' ) insert ( 6325 1255 0 'aggregate deserial function' ) insert ( 1844 1255 0 'aggregate final function' ) insert ( 6326 1255 0 'aggregate final function' ) insert ( 1962 1255 0 'aggregate transition function' ) insert ( 1963 1255 0 'aggregate transition function' ) insert ( 3570 1255 0 'aggregate transition function' ) insert ( 3571 1255 0 'aggregate transition function' ) insert ( 1964 1255 0 'aggregate final function' ) insert ( 3572 1255 0 'aggregate final function' ) insert ( 2805 1255 0 'aggregate transition function' ) insert ( 2806 1255 0 'aggregate transition function' ) insert ( 3342 1255 0 'aggregate combine function' ) insert ( 2807 1255 0 'aggregate final function' ) insert ( 2808 1255 0 'aggregate final function' ) insert ( 2809 1255 0 'aggregate final function' ) insert ( 2810 1255 0 'aggregate final function' ) insert ( 2811 1255 0 'aggregate final function' ) insert ( 2812 1255 0 'aggregate final function' ) insert ( 2813 1255 0 'aggregate final function' ) insert ( 2814 1255 0 'aggregate final function' ) insert ( 2815 1255 0 'aggregate final function' ) insert ( 2816 1255 0 'aggregate final function' ) insert ( 2817 1255 0 'aggregate final function' ) insert ( 3535 1255 0 'aggregate transition function' ) insert ( 6299 1255 0 'aggregate combine function' ) insert ( 6300 1255 0 'aggregate serial function' ) insert ( 6301 1255 0 'aggregate deserial function' ) insert ( 3536 1255 0 'aggregate final function' ) insert ( 3538 1255 0 'concatenate aggregate input into a string' ) insert ( 3543 1255 0 'aggregate transition function' ) insert ( 3544 1255 0 'aggregate final function' ) insert ( 3545 1255 0 'concatenate aggregate input into a bytea' ) insert ( 1845 1255 0 'encode text from DB encoding to ASCII text' ) insert ( 1846 1255 0 'encode text from encoding to ASCII text' ) insert ( 1847 1255 0 'encode text from encoding to ASCII text' ) insert ( 1922 1255 0 'user privilege on relation by username, rel name' ) insert ( 1923 1255 0 'user privilege on relation by username, rel oid' ) insert ( 1924 1255 0 'user privilege on relation by user oid, rel name' ) insert ( 1925 1255 0 'user privilege on relation by user oid, rel oid' ) insert ( 1926 1255 0 'current user privilege on relation by rel name' ) insert ( 1927 1255 0 'current user privilege on relation by rel oid' ) insert ( 2181 1255 0 'user privilege on sequence by username, seq name' ) insert ( 2182 1255 0 'user privilege on sequence by username, seq oid' ) insert ( 2183 1255 0 'user privilege on sequence by user oid, seq name' ) insert ( 2184 1255 0 'user privilege on sequence by user oid, seq oid' ) insert ( 2185 1255 0 'current user privilege on sequence by seq name' ) insert ( 2186 1255 0 'current user privilege on sequence by seq oid' ) insert ( 3012 1255 0 'user privilege on column by username, rel name, col name' ) insert ( 3013 1255 0 'user privilege on column by username, rel name, col attnum' ) insert ( 3014 1255 0 'user privilege on column by username, rel oid, col name' ) insert ( 3015 1255 0 'user privilege on column by username, rel oid, col attnum' ) insert ( 3016 1255 0 'user privilege on column by user oid, rel name, col name' ) insert ( 3017 1255 0 'user privilege on column by user oid, rel name, col attnum' ) insert ( 3018 1255 0 'user privilege on column by user oid, rel oid, col name' ) insert ( 3019 1255 0 'user privilege on column by user oid, rel oid, col attnum' ) insert ( 3020 1255 0 'current user privilege on column by rel name, col name' ) insert ( 3021 1255 0 'current user privilege on column by rel name, col attnum' ) insert ( 3022 1255 0 'current user privilege on column by rel oid, col name' ) insert ( 3023 1255 0 'current user privilege on column by rel oid, col attnum' ) insert ( 3024 1255 0 'user privilege on any column by username, rel name' ) insert ( 3025 1255 0 'user privilege on any column by username, rel oid' ) insert ( 3026 1255 0 'user privilege on any column by user oid, rel name' ) insert ( 3027 1255 0 'user privilege on any column by user oid, rel oid' ) insert ( 3028 1255 0 'current user privilege on any column by rel name' ) insert ( 3029 1255 0 'current user privilege on any column by rel oid' ) insert ( 3355 1255 0 'I/O' ) insert ( 3356 1255 0 'I/O' ) insert ( 3357 1255 0 'I/O' ) insert ( 3358 1255 0 'I/O' ) insert ( 3404 1255 0 'I/O' ) insert ( 3405 1255 0 'I/O' ) insert ( 3406 1255 0 'I/O' ) insert ( 3407 1255 0 'I/O' ) insert ( 5018 1255 0 'I/O' ) insert ( 5019 1255 0 'I/O' ) insert ( 5020 1255 0 'I/O' ) insert ( 5021 1255 0 'I/O' ) insert ( 3427 1255 0 'details about MCV list items' ) insert ( 1928 1255 0 'statistics: number of scans done for table/index' ) insert ( 6310 1255 0 'statistics: time of the last scan for table/index' ) insert ( 1929 1255 0 'statistics: number of tuples read by seqscan' ) insert ( 1930 1255 0 'statistics: number of tuples fetched by idxscan' ) insert ( 1931 1255 0 'statistics: number of tuples inserted' ) insert ( 1932 1255 0 'statistics: number of tuples updated' ) insert ( 1933 1255 0 'statistics: number of tuples deleted' ) insert ( 1972 1255 0 'statistics: number of tuples hot updated' ) insert ( 6217 1255 0 'statistics: number of tuples updated onto a new page' ) insert ( 2878 1255 0 'statistics: number of live tuples' ) insert ( 2879 1255 0 'statistics: number of dead tuples' ) insert ( 3177 1255 0 'statistics: number of tuples changed since last analyze' ) insert ( 5053 1255 0 'statistics: number of tuples inserted since last vacuum' ) insert ( 1934 1255 0 'statistics: number of blocks fetched' ) insert ( 1935 1255 0 'statistics: number of blocks found in cache' ) insert ( 2781 1255 0 'statistics: last manual vacuum time for a table' ) insert ( 2782 1255 0 'statistics: last auto vacuum time for a table' ) insert ( 2783 1255 0 'statistics: last manual analyze time for a table' ) insert ( 2784 1255 0 'statistics: last auto analyze time for a table' ) insert ( 3054 1255 0 'statistics: number of manual vacuums for a table' ) insert ( 3055 1255 0 'statistics: number of auto vacuums for a table' ) insert ( 3056 1255 0 'statistics: number of manual analyzes for a table' ) insert ( 3057 1255 0 'statistics: number of auto analyzes for a table' ) insert ( 1936 1255 0 'statistics: currently active backend IDs' ) insert ( 2022 1255 0 'statistics: information about currently active backends' ) insert ( 6318 1255 0 'describe wait events' ) insert ( 3318 1255 0 'statistics: information about progress of backends running maintenance command' ) insert ( 3099 1255 0 'statistics: information about currently active replication' ) insert ( 3317 1255 0 'statistics: information about WAL receiver' ) insert ( 6169 1255 0 'statistics: information about replication slot' ) insert ( 6230 1255 0 'statistics: check if a stats object exists' ) insert ( 6231 1255 0 'statistics: information about subscription stats' ) insert ( 6118 1255 0 'statistics: information about subscription' ) insert ( 2026 1255 0 'statistics: current backend PID' ) insert ( 1937 1255 0 'statistics: PID of backend' ) insert ( 1938 1255 0 'statistics: database ID of backend' ) insert ( 6107 1255 0 'statistics: get subtransaction status of backend' ) insert ( 1939 1255 0 'statistics: user ID of backend' ) insert ( 1940 1255 0 'statistics: current query of backend' ) insert ( 2788 1255 0 'statistics: wait event type on which backend is currently waiting' ) insert ( 2853 1255 0 'statistics: wait event on which backend is currently waiting' ) insert ( 2094 1255 0 'statistics: start time for current query of backend' ) insert ( 2857 1255 0 'statistics: start time for backend''s current transaction' ) insert ( 1391 1255 0 'statistics: start time for current backend session' ) insert ( 1392 1255 0 'statistics: address of client connected to backend' ) insert ( 1393 1255 0 'statistics: port number of client connected to backend' ) insert ( 1941 1255 0 'statistics: number of backends in database' ) insert ( 1942 1255 0 'statistics: transactions committed' ) insert ( 1943 1255 0 'statistics: transactions rolled back' ) insert ( 1944 1255 0 'statistics: blocks fetched for database' ) insert ( 1945 1255 0 'statistics: blocks found in cache for database' ) insert ( 2758 1255 0 'statistics: tuples returned for database' ) insert ( 2759 1255 0 'statistics: tuples fetched for database' ) insert ( 2760 1255 0 'statistics: tuples inserted in database' ) insert ( 2761 1255 0 'statistics: tuples updated in database' ) insert ( 2762 1255 0 'statistics: tuples deleted in database' ) insert ( 3065 1255 0 'statistics: recovery conflicts in database caused by drop tablespace' ) insert ( 3066 1255 0 'statistics: recovery conflicts in database caused by relation lock' ) insert ( 3067 1255 0 'statistics: recovery conflicts in database caused by snapshot expiry' ) insert ( 6309 1255 0 'statistics: recovery conflicts in database caused by logical replication slot' ) insert ( 3068 1255 0 'statistics: recovery conflicts in database caused by shared buffer pin' ) insert ( 3069 1255 0 'statistics: recovery conflicts in database caused by buffer deadlock' ) insert ( 3070 1255 0 'statistics: recovery conflicts in database' ) insert ( 3152 1255 0 'statistics: deadlocks detected in database' ) insert ( 3426 1255 0 'statistics: checksum failures detected in database' ) insert ( 3428 1255 0 'statistics: when last checksum failure was detected in database' ) insert ( 3074 1255 0 'statistics: last reset for a database' ) insert ( 3150 1255 0 'statistics: number of temporary files written' ) insert ( 3151 1255 0 'statistics: number of bytes in temporary files written' ) insert ( 2844 1255 0 'statistics: block read time, in milliseconds' ) insert ( 2845 1255 0 'statistics: block write time, in milliseconds' ) insert ( 6185 1255 0 'statistics: session time, in milliseconds' ) insert ( 6186 1255 0 'statistics: session active time, in milliseconds' ) insert ( 6187 1255 0 'statistics: session idle in transaction time, in milliseconds' ) insert ( 6188 1255 0 'statistics: total number of sessions' ) insert ( 6189 1255 0 'statistics: number of sessions disconnected by the client closing the network connection' ) insert ( 6190 1255 0 'statistics: number of sessions disconnected by fatal errors' ) insert ( 6191 1255 0 'statistics: number of sessions killed by administrative action' ) insert ( 3195 1255 0 'statistics: information about WAL archiver' ) insert ( 2769 1255 0 'statistics: number of timed checkpoints started by the checkpointer' ) insert ( 2770 1255 0 'statistics: number of backend requested checkpoints started by the checkpointer' ) insert ( 6327 1255 0 'statistics: number of timed restartpoints started by the checkpointer' ) insert ( 6328 1255 0 'statistics: number of backend requested restartpoints started by the checkpointer' ) insert ( 6329 1255 0 'statistics: number of backend performed restartpoints' ) insert ( 2771 1255 0 'statistics: number of buffers written during checkpoints and restartpoints' ) insert ( 6314 1255 0 'statistics: last reset for the checkpointer' ) insert ( 2772 1255 0 'statistics: number of buffers written by the bgwriter for cleaning dirty buffers' ) insert ( 2773 1255 0 'statistics: number of times the bgwriter stopped processing when it had written too many buffers while cleaning' ) insert ( 3075 1255 0 'statistics: last reset for the bgwriter' ) insert ( 3160 1255 0 'statistics: checkpoint/restartpoint time spent writing buffers to disk, in milliseconds' ) insert ( 3161 1255 0 'statistics: checkpoint/restartpoint time spent synchronizing buffers to disk, in milliseconds' ) insert ( 2859 1255 0 'statistics: number of buffer allocations' ) insert ( 6214 1255 0 'statistics: per backend type IO statistics' ) insert ( 1136 1255 0 'statistics: information about WAL activity' ) insert ( 6248 1255 0 'statistics: information about WAL prefetching' ) insert ( 2306 1255 0 'statistics: information about SLRU caches' ) insert ( 2978 1255 0 'statistics: number of function calls' ) insert ( 2979 1255 0 'statistics: total execution time of function, in milliseconds' ) insert ( 2980 1255 0 'statistics: self execution time of function, in milliseconds' ) insert ( 3037 1255 0 'statistics: number of scans done for table/index in current transaction' ) insert ( 3038 1255 0 'statistics: number of tuples read by seqscan in current transaction' ) insert ( 3039 1255 0 'statistics: number of tuples fetched by idxscan in current transaction' ) insert ( 3040 1255 0 'statistics: number of tuples inserted in current transaction' ) insert ( 3041 1255 0 'statistics: number of tuples updated in current transaction' ) insert ( 3042 1255 0 'statistics: number of tuples deleted in current transaction' ) insert ( 3043 1255 0 'statistics: number of tuples hot updated in current transaction' ) insert ( 6218 1255 0 'statistics: number of tuples updated onto a new page in current transaction' ) insert ( 3044 1255 0 'statistics: number of blocks fetched in current transaction' ) insert ( 3045 1255 0 'statistics: number of blocks found in cache in current transaction' ) insert ( 3046 1255 0 'statistics: number of function calls in current transaction' ) insert ( 3047 1255 0 'statistics: total execution time of function in current transaction, in milliseconds' ) insert ( 3048 1255 0 'statistics: self execution time of function in current transaction, in milliseconds' ) insert ( 3788 1255 0 'statistics: timestamp of the current statistics snapshot' ) insert ( 2230 1255 0 'statistics: discard current transaction''s statistics snapshot' ) insert ( 2137 1255 0 'statistics: force stats to be flushed after the next commit' ) insert ( 2274 1255 0 'statistics: reset collected statistics for current database' ) insert ( 3775 1255 0 'statistics: reset collected statistics shared across the cluster' ) insert ( 3776 1255 0 'statistics: reset collected statistics for a single table or index in the current database or shared across all databases in the cluster' ) insert ( 3777 1255 0 'statistics: reset collected statistics for a single function in the current database' ) insert ( 2307 1255 0 'statistics: reset collected statistics for a single SLRU' ) insert ( 6170 1255 0 'statistics: reset collected statistics for a single replication slot' ) insert ( 6232 1255 0 'statistics: reset collected statistics for a single subscription' ) insert ( 3163 1255 0 'current trigger depth' ) insert ( 3778 1255 0 'tablespace location' ) insert ( 1946 1255 0 'convert bytea value into some ascii-only text string' ) insert ( 1947 1255 0 'convert ascii-encoded text string into bytea value' ) insert ( 1954 1255 0 less-equal-greater ) insert ( 3331 1255 0 'sort support' ) insert ( 3917 1255 0 'planner support for timestamp length coercion' ) insert ( 3944 1255 0 'planner support for time length coercion' ) insert ( 1961 1255 0 'adjust timestamp precision' ) insert ( 1965 1255 0 'larger of two' ) insert ( 1966 1255 0 'smaller of two' ) insert ( 1967 1255 0 'adjust timestamptz precision' ) insert ( 1968 1255 0 'adjust time precision' ) insert ( 1969 1255 0 'adjust time with time zone precision' ) insert ( 2007 1255 0 'matches LIKE expression' ) insert ( 2008 1255 0 'does not match LIKE expression' ) insert ( 2009 1255 0 'convert LIKE pattern to use backslash escapes' ) insert ( 2010 1255 0 'octet length' ) insert ( 2012 1255 0 'extract portion of string' ) insert ( 2013 1255 0 'extract portion of string' ) insert ( 2085 1255 0 'extract portion of string' ) insert ( 2086 1255 0 'extract portion of string' ) insert ( 2014 1255 0 'position of substring' ) insert ( 2015 1255 0 'trim selected bytes from both ends of string' ) insert ( 6195 1255 0 'trim selected bytes from left end of string' ) insert ( 6196 1255 0 'trim selected bytes from right end of string' ) insert ( 2019 1255 0 'convert timestamp with time zone to time' ) insert ( 2020 1255 0 'truncate timestamp to specified units' ) insert ( 6177 1255 0 'bin timestamp into specified interval' ) insert ( 6178 1255 0 'bin timestamp with time zone into specified interval' ) insert ( 2021 1255 0 'extract field from timestamp' ) insert ( 6202 1255 0 'extract field from timestamp' ) insert ( 2024 1255 0 'convert date to timestamp' ) insert ( 2025 1255 0 'convert date and time to timestamp' ) insert ( 2027 1255 0 'convert timestamp with time zone to timestamp' ) insert ( 2028 1255 0 'convert timestamp to timestamp with time zone' ) insert ( 2029 1255 0 'convert timestamp to date' ) insert ( 2035 1255 0 'smaller of two' ) insert ( 2036 1255 0 'larger of two' ) insert ( 2037 1255 0 'adjust time with time zone to new zone' ) insert ( 2038 1255 0 'adjust time with time zone to new zone' ) insert ( 6336 1255 0 'adjust time to local time zone' ) insert ( 2039 1255 0 hash ) insert ( 3411 1255 0 hash ) insert ( 2041 1255 0 'intervals overlap?' ) insert ( 2042 1255 0 'intervals overlap?' ) insert ( 2043 1255 0 'intervals overlap?' ) insert ( 2044 1255 0 'intervals overlap?' ) insert ( 2045 1255 0 less-equal-greater ) insert ( 3137 1255 0 'sort support' ) insert ( 4134 1255 0 'window RANGE support' ) insert ( 4135 1255 0 'window RANGE support' ) insert ( 4136 1255 0 'window RANGE support' ) insert ( 4137 1255 0 'window RANGE support' ) insert ( 4138 1255 0 'window RANGE support' ) insert ( 2046 1255 0 'convert time with time zone to time' ) insert ( 2047 1255 0 'convert time to time with time zone' ) insert ( 2048 1255 0 'finite timestamp?' ) insert ( 2049 1255 0 'format timestamp to text' ) insert ( 2058 1255 0 'date difference preserving months and years' ) insert ( 2059 1255 0 'date difference from today preserving months and years' ) insert ( 2069 1255 0 'adjust timestamp to new time zone' ) insert ( 2070 1255 0 'adjust timestamp to new time zone' ) insert ( 6335 1255 0 'adjust timestamp to local time zone' ) insert ( 2073 1255 0 'extract text matching regular expression' ) insert ( 2074 1255 0 'extract text matching SQL regular expression' ) insert ( 2075 1255 0 'convert int8 to bitstring' ) insert ( 2076 1255 0 'convert bitstring to int8' ) insert ( 2077 1255 0 'SHOW X as a function' ) insert ( 3294 1255 0 'SHOW X as a function, optionally no error for missing variable' ) insert ( 2078 1255 0 'SET X as a function' ) insert ( 2084 1255 0 'SHOW ALL as a function' ) insert ( 6240 1255 0 'return flags for specified GUC' ) insert ( 3329 1255 0 'show config file settings' ) insert ( 3401 1255 0 'show pg_hba.conf rules' ) insert ( 6250 1255 0 'show pg_ident.conf mappings' ) insert ( 1371 1255 0 'view system lock information' ) insert ( 2561 1255 0 'get array of PIDs of sessions blocking specified backend PID from acquiring a heavyweight lock' ) insert ( 3376 1255 0 'get array of PIDs of sessions blocking specified backend PID from acquiring a safe snapshot' ) insert ( 3378 1255 0 'isolationtester support function' ) insert ( 1065 1255 0 'view two-phase transactions' ) insert ( 3819 1255 0 'view members of a multixactid' ) insert ( 3581 1255 0 'get commit timestamp of a transaction' ) insert ( 6168 1255 0 'get commit timestamp and replication origin of a transaction' ) insert ( 3583 1255 0 'get transaction Id, commit timestamp and replication origin of latest transaction commit' ) insert ( 3537 1255 0 'get identification of SQL object' ) insert ( 3839 1255 0 'get machine-parseable identification of SQL object' ) insert ( 3382 1255 0 'get identification of SQL object for pg_get_object_address()' ) insert ( 3954 1255 0 'get OID-based object address from name/args arrays' ) insert ( 2079 1255 0 'is table visible in search path?' ) insert ( 2080 1255 0 'is type visible in search path?' ) insert ( 2081 1255 0 'is function visible in search path?' ) insert ( 2082 1255 0 'is operator visible in search path?' ) insert ( 2083 1255 0 'is opclass visible in search path?' ) insert ( 3829 1255 0 'is opfamily visible in search path?' ) insert ( 2093 1255 0 'is conversion visible in search path?' ) insert ( 3403 1255 0 'is statistics object visible in search path?' ) insert ( 3756 1255 0 'is text search parser visible in search path?' ) insert ( 3757 1255 0 'is text search dictionary visible in search path?' ) insert ( 3768 1255 0 'is text search template visible in search path?' ) insert ( 3758 1255 0 'is text search configuration visible in search path?' ) insert ( 3815 1255 0 'is collation visible in search path?' ) insert ( 2854 1255 0 'get OID of current session''s temp schema, if any' ) insert ( 2855 1255 0 'is schema another session''s temp schema?' ) insert ( 2171 1255 0 'cancel a server process'' current query' ) insert ( 2096 1255 0 'terminate a server process' ) insert ( 2172 1255 0 'prepare for taking an online backup' ) insert ( 2739 1255 0 'finish taking an online backup' ) insert ( 3436 1255 0 'promote standby server' ) insert ( 2848 1255 0 'switch to new wal file' ) insert ( 6305 1255 0 'log details of the current snapshot to WAL' ) insert ( 3098 1255 0 'create a named restore point' ) insert ( 2849 1255 0 'current wal write location' ) insert ( 2852 1255 0 'current wal insert location' ) insert ( 3330 1255 0 'current wal flush location' ) insert ( 2850 1255 0 'wal filename and byte offset, given a wal location' ) insert ( 2851 1255 0 'wal filename, given a wal location' ) insert ( 6213 1255 0 'sequence number and timeline ID given a wal filename' ) insert ( 3165 1255 0 'difference in bytes, given two wal locations' ) insert ( 3809 1255 0 'export a snapshot' ) insert ( 3810 1255 0 'true if server is in recovery' ) insert ( 3820 1255 0 'current wal flush location' ) insert ( 3821 1255 0 'last wal replay location' ) insert ( 3830 1255 0 'timestamp of last replay xact' ) insert ( 3071 1255 0 'pause wal replay' ) insert ( 3072 1255 0 'resume wal replay, if it was paused' ) insert ( 3073 1255 0 'true if wal replay is paused' ) insert ( 1137 1255 0 'get wal replay pause state' ) insert ( 6224 1255 0 'get resource managers loaded in system' ) insert ( 2621 1255 0 'reload configuration files' ) insert ( 2622 1255 0 'rotate log file' ) insert ( 3800 1255 0 'current logging collector file location' ) insert ( 3801 1255 0 'current logging collector file location' ) insert ( 2623 1255 0 'get information about file' ) insert ( 3307 1255 0 'get information about file' ) insert ( 2624 1255 0 'read text from a file' ) insert ( 3293 1255 0 'read text from a file' ) insert ( 3826 1255 0 'read text from a file' ) insert ( 6208 1255 0 'read text from a file' ) insert ( 3827 1255 0 'read bytea from a file' ) insert ( 3295 1255 0 'read bytea from a file' ) insert ( 3828 1255 0 'read bytea from a file' ) insert ( 6209 1255 0 'read bytea from a file' ) insert ( 2625 1255 0 'list all files in a directory' ) insert ( 3297 1255 0 'list all files in a directory' ) insert ( 2626 1255 0 'sleep for the specified time in seconds' ) insert ( 3935 1255 0 'sleep for the specified interval' ) insert ( 3936 1255 0 'sleep until the specified time' ) insert ( 315 1255 0 'Is JIT compilation available in this session?' ) insert ( 2971 1255 0 'convert boolean to text' ) insert ( 2100 1255 0 'the average (arithmetic mean) as numeric of all bigint values' ) insert ( 2101 1255 0 'the average (arithmetic mean) as numeric of all integer values' ) insert ( 2102 1255 0 'the average (arithmetic mean) as numeric of all smallint values' ) insert ( 2103 1255 0 'the average (arithmetic mean) as numeric of all numeric values' ) insert ( 2104 1255 0 'the average (arithmetic mean) as float8 of all float4 values' ) insert ( 2105 1255 0 'the average (arithmetic mean) as float8 of all float8 values' ) insert ( 2106 1255 0 'the average (arithmetic mean) as interval of all interval values' ) insert ( 2107 1255 0 'sum as numeric across all bigint input values' ) insert ( 2108 1255 0 'sum as bigint across all integer input values' ) insert ( 2109 1255 0 'sum as bigint across all smallint input values' ) insert ( 2110 1255 0 'sum as float4 across all float4 input values' ) insert ( 2111 1255 0 'sum as float8 across all float8 input values' ) insert ( 2112 1255 0 'sum as money across all money input values' ) insert ( 2113 1255 0 'sum as interval across all interval input values' ) insert ( 2114 1255 0 'sum as numeric across all numeric input values' ) insert ( 2115 1255 0 'maximum value of all bigint input values' ) insert ( 2116 1255 0 'maximum value of all integer input values' ) insert ( 2117 1255 0 'maximum value of all smallint input values' ) insert ( 2118 1255 0 'maximum value of all oid input values' ) insert ( 2119 1255 0 'maximum value of all float4 input values' ) insert ( 2120 1255 0 'maximum value of all float8 input values' ) insert ( 2122 1255 0 'maximum value of all date input values' ) insert ( 2123 1255 0 'maximum value of all time input values' ) insert ( 2124 1255 0 'maximum value of all time with time zone input values' ) insert ( 2125 1255 0 'maximum value of all money input values' ) insert ( 2126 1255 0 'maximum value of all timestamp input values' ) insert ( 2127 1255 0 'maximum value of all timestamp with time zone input values' ) insert ( 2128 1255 0 'maximum value of all interval input values' ) insert ( 2129 1255 0 'maximum value of all text input values' ) insert ( 2130 1255 0 'maximum value of all numeric input values' ) insert ( 2050 1255 0 'maximum value of all anyarray input values' ) insert ( 2244 1255 0 'maximum value of all bpchar input values' ) insert ( 2797 1255 0 'maximum value of all tid input values' ) insert ( 3564 1255 0 'maximum value of all inet input values' ) insert ( 4189 1255 0 'maximum value of all pg_lsn input values' ) insert ( 5099 1255 0 'maximum value of all xid8 input values' ) insert ( 2131 1255 0 'minimum value of all bigint input values' ) insert ( 2132 1255 0 'minimum value of all integer input values' ) insert ( 2133 1255 0 'minimum value of all smallint input values' ) insert ( 2134 1255 0 'minimum value of all oid input values' ) insert ( 2135 1255 0 'minimum value of all float4 input values' ) insert ( 2136 1255 0 'minimum value of all float8 input values' ) insert ( 2138 1255 0 'minimum value of all date input values' ) insert ( 2139 1255 0 'minimum value of all time input values' ) insert ( 2140 1255 0 'minimum value of all time with time zone input values' ) insert ( 2141 1255 0 'minimum value of all money input values' ) insert ( 2142 1255 0 'minimum value of all timestamp input values' ) insert ( 2143 1255 0 'minimum value of all timestamp with time zone input values' ) insert ( 2144 1255 0 'minimum value of all interval input values' ) insert ( 2145 1255 0 'minimum value of all text values' ) insert ( 2146 1255 0 'minimum value of all numeric input values' ) insert ( 2051 1255 0 'minimum value of all anyarray input values' ) insert ( 2245 1255 0 'minimum value of all bpchar input values' ) insert ( 2798 1255 0 'minimum value of all tid input values' ) insert ( 3565 1255 0 'minimum value of all inet input values' ) insert ( 4190 1255 0 'minimum value of all pg_lsn input values' ) insert ( 5100 1255 0 'minimum value of all xid8 input values' ) insert ( 2147 1255 0 'number of input rows for which the input expression is not null' ) insert ( 2803 1255 0 'number of input rows' ) insert ( 6236 1255 0 'planner support for count run condition' ) insert ( 2718 1255 0 'population variance of bigint input values (square of the population standard deviation)' ) insert ( 2719 1255 0 'population variance of integer input values (square of the population standard deviation)' ) insert ( 2720 1255 0 'population variance of smallint input values (square of the population standard deviation)' ) insert ( 2721 1255 0 'population variance of float4 input values (square of the population standard deviation)' ) insert ( 2722 1255 0 'population variance of float8 input values (square of the population standard deviation)' ) insert ( 2723 1255 0 'population variance of numeric input values (square of the population standard deviation)' ) insert ( 2641 1255 0 'sample variance of bigint input values (square of the sample standard deviation)' ) insert ( 2642 1255 0 'sample variance of integer input values (square of the sample standard deviation)' ) insert ( 2643 1255 0 'sample variance of smallint input values (square of the sample standard deviation)' ) insert ( 2644 1255 0 'sample variance of float4 input values (square of the sample standard deviation)' ) insert ( 2645 1255 0 'sample variance of float8 input values (square of the sample standard deviation)' ) insert ( 2646 1255 0 'sample variance of numeric input values (square of the sample standard deviation)' ) insert ( 2148 1255 0 'historical alias for var_samp' ) insert ( 2149 1255 0 'historical alias for var_samp' ) insert ( 2150 1255 0 'historical alias for var_samp' ) insert ( 2151 1255 0 'historical alias for var_samp' ) insert ( 2152 1255 0 'historical alias for var_samp' ) insert ( 2153 1255 0 'historical alias for var_samp' ) insert ( 2724 1255 0 'population standard deviation of bigint input values' ) insert ( 2725 1255 0 'population standard deviation of integer input values' ) insert ( 2726 1255 0 'population standard deviation of smallint input values' ) insert ( 2727 1255 0 'population standard deviation of float4 input values' ) insert ( 2728 1255 0 'population standard deviation of float8 input values' ) insert ( 2729 1255 0 'population standard deviation of numeric input values' ) insert ( 2712 1255 0 'sample standard deviation of bigint input values' ) insert ( 2713 1255 0 'sample standard deviation of integer input values' ) insert ( 2714 1255 0 'sample standard deviation of smallint input values' ) insert ( 2715 1255 0 'sample standard deviation of float4 input values' ) insert ( 2716 1255 0 'sample standard deviation of float8 input values' ) insert ( 2717 1255 0 'sample standard deviation of numeric input values' ) insert ( 2154 1255 0 'historical alias for stddev_samp' ) insert ( 2155 1255 0 'historical alias for stddev_samp' ) insert ( 2156 1255 0 'historical alias for stddev_samp' ) insert ( 2157 1255 0 'historical alias for stddev_samp' ) insert ( 2158 1255 0 'historical alias for stddev_samp' ) insert ( 2159 1255 0 'historical alias for stddev_samp' ) insert ( 2818 1255 0 'number of input rows in which both expressions are not null' ) insert ( 2819 1255 0 'sum of squares of the independent variable (sum(X^2) - sum(X)^2/N)' ) insert ( 2820 1255 0 'sum of squares of the dependent variable (sum(Y^2) - sum(Y)^2/N)' ) insert ( 2821 1255 0 'sum of products of independent times dependent variable (sum(X*Y) - sum(X) * sum(Y)/N)' ) insert ( 2822 1255 0 'average of the independent variable (sum(X)/N)' ) insert ( 2823 1255 0 'average of the dependent variable (sum(Y)/N)' ) insert ( 2824 1255 0 'square of the correlation coefficient' ) insert ( 2825 1255 0 'slope of the least-squares-fit linear equation determined by the (X, Y) pairs' ) insert ( 2826 1255 0 'y-intercept of the least-squares-fit linear equation determined by the (X, Y) pairs' ) insert ( 2827 1255 0 'population covariance' ) insert ( 2828 1255 0 'sample covariance' ) insert ( 2829 1255 0 'correlation coefficient' ) insert ( 2166 1255 0 less-equal-greater ) insert ( 3332 1255 0 'sort support' ) insert ( 2180 1255 0 less-equal-greater ) insert ( 3333 1255 0 'sort support' ) insert ( 2188 1255 0 less-equal-greater ) insert ( 2189 1255 0 less-equal-greater ) insert ( 2190 1255 0 less-equal-greater ) insert ( 2191 1255 0 less-equal-greater ) insert ( 2192 1255 0 less-equal-greater ) insert ( 2193 1255 0 less-equal-greater ) insert ( 2194 1255 0 less-equal-greater ) insert ( 2195 1255 0 less-equal-greater ) insert ( 2212 1255 0 'I/O' ) insert ( 2213 1255 0 'I/O' ) insert ( 2214 1255 0 'I/O' ) insert ( 2215 1255 0 'I/O' ) insert ( 3492 1255 0 'convert operator name to regoper' ) insert ( 3476 1255 0 'convert operator name to regoperator' ) insert ( 2216 1255 0 'I/O' ) insert ( 2217 1255 0 'I/O' ) insert ( 2218 1255 0 'I/O' ) insert ( 2219 1255 0 'I/O' ) insert ( 3495 1255 0 'convert classname to regclass' ) insert ( 4193 1255 0 'I/O' ) insert ( 4194 1255 0 'I/O' ) insert ( 4195 1255 0 'convert classname to regcollation' ) insert ( 2220 1255 0 'I/O' ) insert ( 2221 1255 0 'I/O' ) insert ( 3493 1255 0 'convert type name to regtype' ) insert ( 6317 1255 0 'convert type name to type modifier' ) insert ( 1079 1255 0 'convert text to regclass' ) insert ( 4098 1255 0 'I/O' ) insert ( 4092 1255 0 'I/O' ) insert ( 4093 1255 0 'convert role name to regrole' ) insert ( 4084 1255 0 'I/O' ) insert ( 4085 1255 0 'I/O' ) insert ( 4086 1255 0 'convert namespace name to regnamespace' ) insert ( 6210 1255 0 'test whether string is valid input for data type' ) insert ( 6211 1255 0 'get error details if string is not valid input for data type' ) insert ( 1268 1255 0 'parse qualified identifier to array of identifiers' ) insert ( 2246 1255 0 '(internal)' ) insert ( 2247 1255 0 '(internal)' ) insert ( 2248 1255 0 '(internal)' ) insert ( 2250 1255 0 'user privilege on database by username, database name' ) insert ( 2251 1255 0 'user privilege on database by username, database oid' ) insert ( 2252 1255 0 'user privilege on database by user oid, database name' ) insert ( 2253 1255 0 'user privilege on database by user oid, database oid' ) insert ( 2254 1255 0 'current user privilege on database by database name' ) insert ( 2255 1255 0 'current user privilege on database by database oid' ) insert ( 2256 1255 0 'user privilege on function by username, function name' ) insert ( 2257 1255 0 'user privilege on function by username, function oid' ) insert ( 2258 1255 0 'user privilege on function by user oid, function name' ) insert ( 2259 1255 0 'user privilege on function by user oid, function oid' ) insert ( 2260 1255 0 'current user privilege on function by function name' ) insert ( 2261 1255 0 'current user privilege on function by function oid' ) insert ( 2262 1255 0 'user privilege on language by username, language name' ) insert ( 2263 1255 0 'user privilege on language by username, language oid' ) insert ( 2264 1255 0 'user privilege on language by user oid, language name' ) insert ( 2265 1255 0 'user privilege on language by user oid, language oid' ) insert ( 2266 1255 0 'current user privilege on language by language name' ) insert ( 2267 1255 0 'current user privilege on language by language oid' ) insert ( 2268 1255 0 'user privilege on schema by username, schema name' ) insert ( 2269 1255 0 'user privilege on schema by username, schema oid' ) insert ( 2270 1255 0 'user privilege on schema by user oid, schema name' ) insert ( 2271 1255 0 'user privilege on schema by user oid, schema oid' ) insert ( 2272 1255 0 'current user privilege on schema by schema name' ) insert ( 2273 1255 0 'current user privilege on schema by schema oid' ) insert ( 2390 1255 0 'user privilege on tablespace by username, tablespace name' ) insert ( 2391 1255 0 'user privilege on tablespace by username, tablespace oid' ) insert ( 2392 1255 0 'user privilege on tablespace by user oid, tablespace name' ) insert ( 2393 1255 0 'user privilege on tablespace by user oid, tablespace oid' ) insert ( 2394 1255 0 'current user privilege on tablespace by tablespace name' ) insert ( 2395 1255 0 'current user privilege on tablespace by tablespace oid' ) insert ( 3000 1255 0 'user privilege on foreign data wrapper by username, foreign data wrapper name' ) insert ( 3001 1255 0 'user privilege on foreign data wrapper by username, foreign data wrapper oid' ) insert ( 3002 1255 0 'user privilege on foreign data wrapper by user oid, foreign data wrapper name' ) insert ( 3003 1255 0 'user privilege on foreign data wrapper by user oid, foreign data wrapper oid' ) insert ( 3004 1255 0 'current user privilege on foreign data wrapper by foreign data wrapper name' ) insert ( 3005 1255 0 'current user privilege on foreign data wrapper by foreign data wrapper oid' ) insert ( 3006 1255 0 'user privilege on server by username, server name' ) insert ( 3007 1255 0 'user privilege on server by username, server oid' ) insert ( 3008 1255 0 'user privilege on server by user oid, server name' ) insert ( 3009 1255 0 'user privilege on server by user oid, server oid' ) insert ( 3010 1255 0 'current user privilege on server by server name' ) insert ( 3011 1255 0 'current user privilege on server by server oid' ) insert ( 3138 1255 0 'user privilege on type by username, type name' ) insert ( 3139 1255 0 'user privilege on type by username, type oid' ) insert ( 3140 1255 0 'user privilege on type by user oid, type name' ) insert ( 3141 1255 0 'user privilege on type by user oid, type oid' ) insert ( 3142 1255 0 'current user privilege on type by type name' ) insert ( 3143 1255 0 'current user privilege on type by type oid' ) insert ( 6205 1255 0 'user privilege on parameter by username, parameter name' ) insert ( 6206 1255 0 'user privilege on parameter by user oid, parameter name' ) insert ( 6207 1255 0 'current user privilege on parameter by parameter name' ) insert ( 2705 1255 0 'user privilege on role by username, role name' ) insert ( 2706 1255 0 'user privilege on role by username, role oid' ) insert ( 2707 1255 0 'user privilege on role by user oid, role name' ) insert ( 2708 1255 0 'user privilege on role by user oid, role oid' ) insert ( 2709 1255 0 'current user privilege on role by role name' ) insert ( 2710 1255 0 'current user privilege on role by role oid' ) insert ( 1269 1255 0 'bytes required to store the value, perhaps with compression' ) insert ( 2121 1255 0 'compression method for the compressed datum' ) insert ( 6316 1255 0 'chunk ID of on-disk TOASTed value' ) insert ( 2322 1255 0 'total disk space usage for the specified tablespace' ) insert ( 2323 1255 0 'total disk space usage for the specified tablespace' ) insert ( 2324 1255 0 'total disk space usage for the specified database' ) insert ( 2168 1255 0 'total disk space usage for the specified database' ) insert ( 2325 1255 0 'disk space usage for the main fork of the specified table or index' ) insert ( 2332 1255 0 'disk space usage for the specified fork of a table or index' ) insert ( 2286 1255 0 'total disk space usage for the specified table and associated indexes' ) insert ( 2288 1255 0 'convert a long int to a human readable text using size units' ) insert ( 3166 1255 0 'convert a numeric to a human readable text using size units' ) insert ( 3334 1255 0 'convert a size in human-readable format with size units into bytes' ) insert ( 2997 1255 0 'disk space usage for the specified table, including TOAST, free space and visibility map' ) insert ( 2998 1255 0 'disk space usage for all indexes attached to the specified table' ) insert ( 2999 1255 0 'filenode identifier of relation' ) insert ( 3454 1255 0 'relation OID for filenode and tablespace' ) insert ( 3034 1255 0 'file path of relation' ) insert ( 2316 1255 0 '(internal)' ) insert ( 2290 1255 0 'I/O' ) insert ( 2291 1255 0 'I/O' ) insert ( 2292 1255 0 'I/O' ) insert ( 2293 1255 0 'I/O' ) insert ( 2294 1255 0 'I/O' ) insert ( 2295 1255 0 'I/O' ) insert ( 2296 1255 0 'I/O' ) insert ( 2297 1255 0 'I/O' ) insert ( 2298 1255 0 'I/O' ) insert ( 2299 1255 0 'I/O' ) insert ( 2300 1255 0 'I/O' ) insert ( 2301 1255 0 'I/O' ) insert ( 3594 1255 0 'I/O' ) insert ( 3595 1255 0 'I/O' ) insert ( 2302 1255 0 'I/O' ) insert ( 2303 1255 0 'I/O' ) insert ( 2304 1255 0 'I/O' ) insert ( 2305 1255 0 'I/O' ) insert ( 2312 1255 0 'I/O' ) insert ( 2313 1255 0 'I/O' ) insert ( 2398 1255 0 'I/O' ) insert ( 2399 1255 0 'I/O' ) insert ( 2597 1255 0 'I/O' ) insert ( 2598 1255 0 'I/O' ) insert ( 2777 1255 0 'I/O' ) insert ( 2778 1255 0 'I/O' ) insert ( 3116 1255 0 'I/O' ) insert ( 3117 1255 0 'I/O' ) insert ( 326 1255 0 'I/O' ) insert ( 327 1255 0 'I/O' ) insert ( 3311 1255 0 'I/O' ) insert ( 3312 1255 0 'I/O' ) insert ( 267 1255 0 'I/O' ) insert ( 268 1255 0 'I/O' ) insert ( 5086 1255 0 'I/O' ) insert ( 5087 1255 0 'I/O' ) insert ( 5088 1255 0 'I/O' ) insert ( 5089 1255 0 'I/O' ) insert ( 5090 1255 0 'I/O' ) insert ( 5091 1255 0 'I/O' ) insert ( 5092 1255 0 'I/O' ) insert ( 5093 1255 0 'I/O' ) insert ( 5094 1255 0 'I/O' ) insert ( 5095 1255 0 'I/O' ) insert ( 4226 1255 0 'I/O' ) insert ( 4227 1255 0 'I/O' ) insert ( 3313 1255 0 'BERNOULLI tablesample method handler' ) insert ( 3314 1255 0 'SYSTEM tablesample method handler' ) insert ( 2311 1255 0 'MD5 hash' ) insert ( 2321 1255 0 'MD5 hash' ) insert ( 3419 1255 0 'SHA-224 hash' ) insert ( 3420 1255 0 'SHA-256 hash' ) insert ( 3421 1255 0 'SHA-384 hash' ) insert ( 3422 1255 0 'SHA-512 hash' ) insert ( 2344 1255 0 less-equal-greater ) insert ( 2357 1255 0 less-equal-greater ) insert ( 2370 1255 0 less-equal-greater ) insert ( 2383 1255 0 less-equal-greater ) insert ( 2526 1255 0 less-equal-greater ) insert ( 2533 1255 0 less-equal-greater ) insert ( 2400 1255 0 'I/O' ) insert ( 2401 1255 0 'I/O' ) insert ( 2402 1255 0 'I/O' ) insert ( 2403 1255 0 'I/O' ) insert ( 2404 1255 0 'I/O' ) insert ( 2405 1255 0 'I/O' ) insert ( 2406 1255 0 'I/O' ) insert ( 2407 1255 0 'I/O' ) insert ( 2408 1255 0 'I/O' ) insert ( 2409 1255 0 'I/O' ) insert ( 2410 1255 0 'I/O' ) insert ( 2411 1255 0 'I/O' ) insert ( 2412 1255 0 'I/O' ) insert ( 2413 1255 0 'I/O' ) insert ( 2414 1255 0 'I/O' ) insert ( 2415 1255 0 'I/O' ) insert ( 2416 1255 0 'I/O' ) insert ( 2417 1255 0 'I/O' ) insert ( 2418 1255 0 'I/O' ) insert ( 2419 1255 0 'I/O' ) insert ( 2420 1255 0 'I/O' ) insert ( 2421 1255 0 'I/O' ) insert ( 2422 1255 0 'I/O' ) insert ( 2423 1255 0 'I/O' ) insert ( 2424 1255 0 'I/O' ) insert ( 2425 1255 0 'I/O' ) insert ( 2426 1255 0 'I/O' ) insert ( 2427 1255 0 'I/O' ) insert ( 2428 1255 0 'I/O' ) insert ( 2429 1255 0 'I/O' ) insert ( 2430 1255 0 'I/O' ) insert ( 2431 1255 0 'I/O' ) insert ( 2432 1255 0 'I/O' ) insert ( 2433 1255 0 'I/O' ) insert ( 2434 1255 0 'I/O' ) insert ( 2435 1255 0 'I/O' ) insert ( 2436 1255 0 'I/O' ) insert ( 2437 1255 0 'I/O' ) insert ( 2438 1255 0 'I/O' ) insert ( 2439 1255 0 'I/O' ) insert ( 2440 1255 0 'I/O' ) insert ( 2441 1255 0 'I/O' ) insert ( 2442 1255 0 'I/O' ) insert ( 2443 1255 0 'I/O' ) insert ( 2444 1255 0 'I/O' ) insert ( 2445 1255 0 'I/O' ) insert ( 2446 1255 0 'I/O' ) insert ( 2447 1255 0 'I/O' ) insert ( 2448 1255 0 'I/O' ) insert ( 2449 1255 0 'I/O' ) insert ( 2450 1255 0 'I/O' ) insert ( 2451 1255 0 'I/O' ) insert ( 2452 1255 0 'I/O' ) insert ( 2453 1255 0 'I/O' ) insert ( 4196 1255 0 'I/O' ) insert ( 4197 1255 0 'I/O' ) insert ( 2454 1255 0 'I/O' ) insert ( 2455 1255 0 'I/O' ) insert ( 4094 1255 0 'I/O' ) insert ( 4095 1255 0 'I/O' ) insert ( 4087 1255 0 'I/O' ) insert ( 4088 1255 0 'I/O' ) insert ( 2456 1255 0 'I/O' ) insert ( 2457 1255 0 'I/O' ) insert ( 2458 1255 0 'I/O' ) insert ( 2459 1255 0 'I/O' ) insert ( 2460 1255 0 'I/O' ) insert ( 2461 1255 0 'I/O' ) insert ( 2468 1255 0 'I/O' ) insert ( 2469 1255 0 'I/O' ) insert ( 2470 1255 0 'I/O' ) insert ( 2471 1255 0 'I/O' ) insert ( 2472 1255 0 'I/O' ) insert ( 2473 1255 0 'I/O' ) insert ( 2474 1255 0 'I/O' ) insert ( 2475 1255 0 'I/O' ) insert ( 2476 1255 0 'I/O' ) insert ( 2477 1255 0 'I/O' ) insert ( 2478 1255 0 'I/O' ) insert ( 2479 1255 0 'I/O' ) insert ( 2480 1255 0 'I/O' ) insert ( 2481 1255 0 'I/O' ) insert ( 2482 1255 0 'I/O' ) insert ( 2483 1255 0 'I/O' ) insert ( 2484 1255 0 'I/O' ) insert ( 2485 1255 0 'I/O' ) insert ( 2486 1255 0 'I/O' ) insert ( 2487 1255 0 'I/O' ) insert ( 2488 1255 0 'I/O' ) insert ( 2489 1255 0 'I/O' ) insert ( 2490 1255 0 'I/O' ) insert ( 2491 1255 0 'I/O' ) insert ( 2492 1255 0 'I/O' ) insert ( 2493 1255 0 'I/O' ) insert ( 2494 1255 0 'I/O' ) insert ( 2495 1255 0 'I/O' ) insert ( 2496 1255 0 'I/O' ) insert ( 2497 1255 0 'I/O' ) insert ( 2498 1255 0 'I/O' ) insert ( 2499 1255 0 'I/O' ) insert ( 2500 1255 0 'I/O' ) insert ( 2501 1255 0 'I/O' ) insert ( 2502 1255 0 'I/O' ) insert ( 2503 1255 0 'I/O' ) insert ( 3120 1255 0 'I/O' ) insert ( 3121 1255 0 'I/O' ) insert ( 3446 1255 0 'I/O' ) insert ( 3447 1255 0 'I/O' ) insert ( 2504 1255 0 'source text of a rule with pretty-print option' ) insert ( 2505 1255 0 'select statement of a view with pretty-print option' ) insert ( 2506 1255 0 'select statement of a view with pretty-print option' ) insert ( 3159 1255 0 'select statement of a view with pretty-printing and specified line wrapping' ) insert ( 2507 1255 0 'index description (full create statement or single expression) with pretty-print option' ) insert ( 2508 1255 0 'constraint description with pretty-print option' ) insert ( 2509 1255 0 'deparse an encoded expression with pretty-print option' ) insert ( 2510 1255 0 'get the prepared statements for this session' ) insert ( 2511 1255 0 'get the open cursors for this session' ) insert ( 2599 1255 0 'get the available time zone abbreviations' ) insert ( 2856 1255 0 'get the available time zone names' ) insert ( 2730 1255 0 'trigger description with pretty-print option' ) insert ( 3035 1255 0 'get the channels that the current backend listens to' ) insert ( 3036 1255 0 'send a notification event' ) insert ( 3296 1255 0 'get the fraction of the asynchronous notification queue currently in use' ) insert ( 5052 1255 0 'allocations from the main shared memory segment' ) insert ( 2282 1255 0 'information about all memory contexts of local backend' ) insert ( 4543 1255 0 'log memory contexts of the specified backend' ) insert ( 1066 1255 0 'non-persistent series generator' ) insert ( 1067 1255 0 'non-persistent series generator' ) insert ( 3994 1255 0 'planner support for generate_series' ) insert ( 1068 1255 0 'non-persistent series generator' ) insert ( 1069 1255 0 'non-persistent series generator' ) insert ( 3995 1255 0 'planner support for generate_series' ) insert ( 3259 1255 0 'non-persistent series generator' ) insert ( 3260 1255 0 'non-persistent series generator' ) insert ( 938 1255 0 'non-persistent series generator' ) insert ( 939 1255 0 'non-persistent series generator' ) insert ( 6274 1255 0 'non-persistent series generator' ) insert ( 2515 1255 0 'aggregate transition function' ) insert ( 2516 1255 0 'aggregate transition function' ) insert ( 3496 1255 0 'aggregate transition function' ) insert ( 3497 1255 0 'aggregate transition function' ) insert ( 3498 1255 0 'aggregate final function' ) insert ( 3499 1255 0 'aggregate final function' ) insert ( 2517 1255 0 'boolean-and aggregate' ) insert ( 2518 1255 0 'boolean-or aggregate' ) insert ( 2519 1255 0 'boolean-and aggregate' ) insert ( 2236 1255 0 'bitwise-and smallint aggregate' ) insert ( 2237 1255 0 'bitwise-or smallint aggregate' ) insert ( 6164 1255 0 'bitwise-xor smallint aggregate' ) insert ( 2238 1255 0 'bitwise-and integer aggregate' ) insert ( 2239 1255 0 'bitwise-or integer aggregate' ) insert ( 6165 1255 0 'bitwise-xor integer aggregate' ) insert ( 2240 1255 0 'bitwise-and bigint aggregate' ) insert ( 2241 1255 0 'bitwise-or bigint aggregate' ) insert ( 6166 1255 0 'bitwise-xor bigint aggregate' ) insert ( 2242 1255 0 'bitwise-and bit aggregate' ) insert ( 2243 1255 0 'bitwise-or bit aggregate' ) insert ( 6167 1255 0 'bitwise-xor bit aggregate' ) insert ( 2556 1255 0 'get OIDs of databases in a tablespace' ) insert ( 2557 1255 0 'convert int4 to boolean' ) insert ( 2558 1255 0 'convert boolean to int4' ) insert ( 2559 1255 0 'current value from last used sequence' ) insert ( 2560 1255 0 'postmaster start time' ) insert ( 2034 1255 0 'configuration load time' ) insert ( 2578 1255 0 'GiST support' ) insert ( 2581 1255 0 'GiST support' ) insert ( 2582 1255 0 'GiST support' ) insert ( 2583 1255 0 'GiST support' ) insert ( 2584 1255 0 'GiST support' ) insert ( 3998 1255 0 'GiST support' ) insert ( 2585 1255 0 'GiST support' ) insert ( 2586 1255 0 'GiST support' ) insert ( 2591 1255 0 'GiST support' ) insert ( 2592 1255 0 'GiST support' ) insert ( 1030 1255 0 'GiST support' ) insert ( 3282 1255 0 'GiST support' ) insert ( 2179 1255 0 'GiST support' ) insert ( 3064 1255 0 'GiST support' ) insert ( 3280 1255 0 'GiST support' ) insert ( 3288 1255 0 'GiST support' ) insert ( 3435 1255 0 'sort support' ) insert ( 2743 1255 0 'GIN array support' ) insert ( 2774 1255 0 'GIN array support' ) insert ( 2744 1255 0 'GIN array support' ) insert ( 3920 1255 0 'GIN array support' ) insert ( 3076 1255 0 'GIN array support (obsolete)' ) insert ( 3383 1255 0 'BRIN minmax support' ) insert ( 3384 1255 0 'BRIN minmax support' ) insert ( 3385 1255 0 'BRIN minmax support' ) insert ( 3386 1255 0 'BRIN minmax support' ) insert ( 4616 1255 0 'BRIN multi minmax support' ) insert ( 4617 1255 0 'BRIN multi minmax support' ) insert ( 4618 1255 0 'BRIN multi minmax support' ) insert ( 4619 1255 0 'BRIN multi minmax support' ) insert ( 4620 1255 0 'BRIN multi minmax support' ) insert ( 4621 1255 0 'BRIN multi minmax int2 distance' ) insert ( 4622 1255 0 'BRIN multi minmax int4 distance' ) insert ( 4623 1255 0 'BRIN multi minmax int8 distance' ) insert ( 4624 1255 0 'BRIN multi minmax float4 distance' ) insert ( 4625 1255 0 'BRIN multi minmax float8 distance' ) insert ( 4626 1255 0 'BRIN multi minmax numeric distance' ) insert ( 4627 1255 0 'BRIN multi minmax tid distance' ) insert ( 4628 1255 0 'BRIN multi minmax uuid distance' ) insert ( 4629 1255 0 'BRIN multi minmax date distance' ) insert ( 4630 1255 0 'BRIN multi minmax time distance' ) insert ( 4631 1255 0 'BRIN multi minmax interval distance' ) insert ( 4632 1255 0 'BRIN multi minmax timetz distance' ) insert ( 4633 1255 0 'BRIN multi minmax pg_lsn distance' ) insert ( 4634 1255 0 'BRIN multi minmax macaddr distance' ) insert ( 4635 1255 0 'BRIN multi minmax macaddr8 distance' ) insert ( 4636 1255 0 'BRIN multi minmax inet distance' ) insert ( 4637 1255 0 'BRIN multi minmax timestamp distance' ) insert ( 4105 1255 0 'BRIN inclusion support' ) insert ( 4106 1255 0 'BRIN inclusion support' ) insert ( 4107 1255 0 'BRIN inclusion support' ) insert ( 4108 1255 0 'BRIN inclusion support' ) insert ( 4591 1255 0 'BRIN bloom support' ) insert ( 4592 1255 0 'BRIN bloom support' ) insert ( 4593 1255 0 'BRIN bloom support' ) insert ( 4594 1255 0 'BRIN bloom support' ) insert ( 4595 1255 0 'BRIN bloom support' ) insert ( 2880 1255 0 'obtain exclusive advisory lock' ) insert ( 3089 1255 0 'obtain exclusive advisory lock' ) insert ( 2881 1255 0 'obtain shared advisory lock' ) insert ( 3090 1255 0 'obtain shared advisory lock' ) insert ( 2882 1255 0 'obtain exclusive advisory lock if available' ) insert ( 3091 1255 0 'obtain exclusive advisory lock if available' ) insert ( 2883 1255 0 'obtain shared advisory lock if available' ) insert ( 3092 1255 0 'obtain shared advisory lock if available' ) insert ( 2884 1255 0 'release exclusive advisory lock' ) insert ( 2885 1255 0 'release shared advisory lock' ) insert ( 2886 1255 0 'obtain exclusive advisory lock' ) insert ( 3093 1255 0 'obtain exclusive advisory lock' ) insert ( 2887 1255 0 'obtain shared advisory lock' ) insert ( 3094 1255 0 'obtain shared advisory lock' ) insert ( 2888 1255 0 'obtain exclusive advisory lock if available' ) insert ( 3095 1255 0 'obtain exclusive advisory lock if available' ) insert ( 2889 1255 0 'obtain shared advisory lock if available' ) insert ( 3096 1255 0 'obtain shared advisory lock if available' ) insert ( 2890 1255 0 'release exclusive advisory lock' ) insert ( 2891 1255 0 'release shared advisory lock' ) insert ( 2892 1255 0 'release all advisory locks' ) insert ( 2893 1255 0 'I/O' ) insert ( 2894 1255 0 'I/O' ) insert ( 2895 1255 0 'generate XML comment' ) insert ( 2896 1255 0 'perform a non-validating parse of a character string to produce an XML value' ) insert ( 2897 1255 0 'validate an XML value' ) insert ( 2898 1255 0 'I/O' ) insert ( 2899 1255 0 'I/O' ) insert ( 2900 1255 0 'aggregate transition function' ) insert ( 2901 1255 0 'concatenate XML values' ) insert ( 2922 1255 0 'serialize an XML value to a character string' ) insert ( 3813 1255 0 'generate XML text node' ) insert ( 2923 1255 0 'map table contents to XML' ) insert ( 2924 1255 0 'map query result to XML' ) insert ( 2925 1255 0 'map rows from cursor to XML' ) insert ( 2926 1255 0 'map table structure to XML Schema' ) insert ( 2927 1255 0 'map query result structure to XML Schema' ) insert ( 2928 1255 0 'map cursor structure to XML Schema' ) insert ( 2929 1255 0 'map table contents and structure to XML and XML Schema' ) insert ( 2930 1255 0 'map query result and structure to XML and XML Schema' ) insert ( 2933 1255 0 'map schema contents to XML' ) insert ( 2934 1255 0 'map schema structure to XML Schema' ) insert ( 2935 1255 0 'map schema contents and structure to XML and XML Schema' ) insert ( 2936 1255 0 'map database contents to XML' ) insert ( 2937 1255 0 'map database structure to XML Schema' ) insert ( 2938 1255 0 'map database contents and structure to XML and XML Schema' ) insert ( 2931 1255 0 'evaluate XPath expression, with namespaces support' ) insert ( 2932 1255 0 'evaluate XPath expression' ) insert ( 2614 1255 0 'test XML value against XPath expression' ) insert ( 3049 1255 0 'test XML value against XPath expression, with namespace support' ) insert ( 3050 1255 0 'test XML value against XPath expression' ) insert ( 3051 1255 0 'determine if a string is well formed XML' ) insert ( 3052 1255 0 'determine if a string is well formed XML document' ) insert ( 3053 1255 0 'determine if a string is well formed XML content' ) insert ( 321 1255 0 'I/O' ) insert ( 322 1255 0 'I/O' ) insert ( 323 1255 0 'I/O' ) insert ( 324 1255 0 'I/O' ) insert ( 3153 1255 0 'map array to json' ) insert ( 3154 1255 0 'map array to json with optional pretty printing' ) insert ( 3155 1255 0 'map row to json' ) insert ( 3156 1255 0 'map row to json with optional pretty printing' ) insert ( 3173 1255 0 'json aggregate transition function' ) insert ( 6275 1255 0 'json aggregate transition function' ) insert ( 3174 1255 0 'json aggregate final function' ) insert ( 3175 1255 0 'aggregate input into json' ) insert ( 6276 1255 0 'aggregate input into json' ) insert ( 3180 1255 0 'json object aggregate transition function' ) insert ( 6277 1255 0 'json object aggregate transition function' ) insert ( 6278 1255 0 'json object aggregate transition function' ) insert ( 6279 1255 0 'json object aggregate transition function' ) insert ( 3196 1255 0 'json object aggregate final function' ) insert ( 3197 1255 0 'aggregate input into a json object' ) insert ( 6280 1255 0 'aggregate non-NULL input into a json object' ) insert ( 6281 1255 0 'aggregate input into a json object with unique keys' ) insert ( 6282 1255 0 'aggregate non-NULL input into a json object with unique keys' ) insert ( 3198 1255 0 'build a json array from any inputs' ) insert ( 3199 1255 0 'build an empty json array' ) insert ( 3200 1255 0 'build a json object from pairwise key/value inputs' ) insert ( 3201 1255 0 'build an empty json object' ) insert ( 3202 1255 0 'map text array of key value pairs to json object' ) insert ( 3203 1255 0 'map text arrays of keys and values to json object' ) insert ( 3176 1255 0 'map input to json' ) insert ( 3261 1255 0 'remove object fields with null values from json' ) insert ( 3951 1255 0 'get value from json with path elements' ) insert ( 3953 1255 0 'get value from json as text with path elements' ) insert ( 3955 1255 0 'key value pairs of a json object' ) insert ( 3969 1255 0 'elements of json array' ) insert ( 3956 1255 0 'length of json array' ) insert ( 3957 1255 0 'get json object keys' ) insert ( 3958 1255 0 'key value pairs of a json object' ) insert ( 3959 1255 0 'key value pairs of a json object' ) insert ( 3960 1255 0 'get record fields from a json object' ) insert ( 3961 1255 0 'get set of records with fields from a json array of objects' ) insert ( 3204 1255 0 'get record fields from a json object' ) insert ( 3205 1255 0 'get set of records with fields from a json array of objects' ) insert ( 3968 1255 0 'get the type of a json value' ) insert ( 2952 1255 0 'I/O' ) insert ( 2953 1255 0 'I/O' ) insert ( 2960 1255 0 less-equal-greater ) insert ( 3300 1255 0 'sort support' ) insert ( 2961 1255 0 'I/O' ) insert ( 2962 1255 0 'I/O' ) insert ( 2963 1255 0 hash ) insert ( 3412 1255 0 hash ) insert ( 3432 1255 0 'generate random UUID' ) insert ( 6342 1255 0 'extract timestamp from UUID' ) insert ( 6343 1255 0 'extract version from RFC 4122 UUID' ) insert ( 3229 1255 0 'I/O' ) insert ( 3230 1255 0 'I/O' ) insert ( 3238 1255 0 'I/O' ) insert ( 3239 1255 0 'I/O' ) insert ( 3251 1255 0 less-equal-greater ) insert ( 3252 1255 0 hash ) insert ( 3413 1255 0 hash ) insert ( 4187 1255 0 'larger of two' ) insert ( 4188 1255 0 'smaller of two' ) insert ( 3504 1255 0 'I/O' ) insert ( 3505 1255 0 'I/O' ) insert ( 3506 1255 0 'I/O' ) insert ( 3507 1255 0 'I/O' ) insert ( 3514 1255 0 less-equal-greater ) insert ( 3515 1255 0 hash ) insert ( 3414 1255 0 hash ) insert ( 3524 1255 0 'smaller of two' ) insert ( 3525 1255 0 'larger of two' ) insert ( 3526 1255 0 'maximum value of all enum input values' ) insert ( 3527 1255 0 'minimum value of all enum input values' ) insert ( 3528 1255 0 'first value of the input enum type' ) insert ( 3529 1255 0 'last value of the input enum type' ) insert ( 3530 1255 0 'range between the two given enum values, as an ordered array' ) insert ( 3531 1255 0 'range of the given enum type, as an ordered array' ) insert ( 3532 1255 0 'I/O' ) insert ( 3533 1255 0 'I/O' ) insert ( 3610 1255 0 'I/O' ) insert ( 3639 1255 0 'I/O' ) insert ( 3611 1255 0 'I/O' ) insert ( 3638 1255 0 'I/O' ) insert ( 3612 1255 0 'I/O' ) insert ( 3641 1255 0 'I/O' ) insert ( 3613 1255 0 'I/O' ) insert ( 3640 1255 0 'I/O' ) insert ( 3646 1255 0 'I/O' ) insert ( 3647 1255 0 'I/O' ) insert ( 3622 1255 0 less-equal-greater ) insert ( 3711 1255 0 'number of lexemes' ) insert ( 3623 1255 0 'strip position information' ) insert ( 3624 1255 0 'set given weight for whole tsvector' ) insert ( 3320 1255 0 'set given weight for given lexemes' ) insert ( 3321 1255 0 'delete lexeme' ) insert ( 3323 1255 0 'delete given lexemes' ) insert ( 3322 1255 0 'expand tsvector to set of rows' ) insert ( 3326 1255 0 'convert tsvector to array of lexemes' ) insert ( 3327 1255 0 'build tsvector from array of lexemes' ) insert ( 3319 1255 0 'delete lexemes that do not have one of the given weights' ) insert ( 3648 1255 0 'GiST tsvector support' ) insert ( 3649 1255 0 'GiST tsvector support' ) insert ( 3650 1255 0 'GiST tsvector support' ) insert ( 3651 1255 0 'GiST tsvector support' ) insert ( 3652 1255 0 'GiST tsvector support' ) insert ( 3653 1255 0 'GiST tsvector support' ) insert ( 3654 1255 0 'GiST tsvector support' ) insert ( 3790 1255 0 'GiST tsvector support (obsolete)' ) insert ( 3434 1255 0 'GiST tsvector support' ) insert ( 3656 1255 0 'GIN tsvector support' ) insert ( 3657 1255 0 'GIN tsvector support' ) insert ( 3658 1255 0 'GIN tsvector support' ) insert ( 3921 1255 0 'GIN tsvector support' ) insert ( 3724 1255 0 'GIN tsvector support' ) insert ( 2700 1255 0 'GIN tsvector support' ) insert ( 3077 1255 0 'GIN tsvector support (obsolete)' ) insert ( 3087 1255 0 'GIN tsvector support (obsolete)' ) insert ( 3088 1255 0 'GIN tsvector support (obsolete)' ) insert ( 3791 1255 0 'GIN tsvector support (obsolete)' ) insert ( 3792 1255 0 'GIN tsvector support (obsolete)' ) insert ( 3789 1255 0 'clean up GIN pending list' ) insert ( 3668 1255 0 less-equal-greater ) insert ( 5004 1255 0 'phrase-concatenate with distance' ) insert ( 3672 1255 0 'number of nodes' ) insert ( 3673 1255 0 'show real useful query for GiST index' ) insert ( 3684 1255 0 'rewrite tsquery' ) insert ( 3685 1255 0 'rewrite tsquery' ) insert ( 3695 1255 0 'GiST tsquery support' ) insert ( 3697 1255 0 'GiST tsquery support' ) insert ( 3698 1255 0 'GiST tsquery support' ) insert ( 3699 1255 0 'GiST tsquery support' ) insert ( 3700 1255 0 'GiST tsquery support' ) insert ( 3701 1255 0 'GiST tsquery support' ) insert ( 3793 1255 0 'GiST tsquery support (obsolete)' ) insert ( 3686 1255 0 'restriction selectivity of tsvector @@ tsquery' ) insert ( 3687 1255 0 'join selectivity of tsvector @@ tsquery' ) insert ( 3688 1255 0 'tsvector typanalyze' ) insert ( 3689 1255 0 'statistics of tsvector column' ) insert ( 3690 1255 0 'statistics of tsvector column' ) insert ( 3703 1255 0 relevance ) insert ( 3704 1255 0 relevance ) insert ( 3705 1255 0 relevance ) insert ( 3706 1255 0 relevance ) insert ( 3707 1255 0 relevance ) insert ( 3708 1255 0 relevance ) insert ( 3709 1255 0 relevance ) insert ( 3710 1255 0 relevance ) insert ( 3713 1255 0 'get parser''s token types' ) insert ( 3714 1255 0 'get parser''s token types' ) insert ( 3715 1255 0 'parse text to tokens' ) insert ( 3716 1255 0 'parse text to tokens' ) insert ( 3717 1255 0 '(internal)' ) insert ( 3718 1255 0 '(internal)' ) insert ( 3719 1255 0 '(internal)' ) insert ( 3720 1255 0 '(internal)' ) insert ( 3721 1255 0 '(internal)' ) insert ( 3723 1255 0 'normalize one word by dictionary' ) insert ( 6183 1255 0 'debug function for text search configuration' ) insert ( 6184 1255 0 'debug function for current text search configuration' ) insert ( 3725 1255 0 '(internal)' ) insert ( 3726 1255 0 '(internal)' ) insert ( 3728 1255 0 '(internal)' ) insert ( 3729 1255 0 '(internal)' ) insert ( 3731 1255 0 '(internal)' ) insert ( 3732 1255 0 '(internal)' ) insert ( 3740 1255 0 '(internal)' ) insert ( 3741 1255 0 '(internal)' ) insert ( 3743 1255 0 'generate headline' ) insert ( 3744 1255 0 'generate headline' ) insert ( 3754 1255 0 'generate headline' ) insert ( 3755 1255 0 'generate headline' ) insert ( 4201 1255 0 'generate headline from jsonb' ) insert ( 4202 1255 0 'generate headline from jsonb' ) insert ( 4203 1255 0 'generate headline from jsonb' ) insert ( 4204 1255 0 'generate headline from jsonb' ) insert ( 4205 1255 0 'generate headline from json' ) insert ( 4206 1255 0 'generate headline from json' ) insert ( 4207 1255 0 'generate headline from json' ) insert ( 4208 1255 0 'generate headline from json' ) insert ( 3745 1255 0 'transform to tsvector' ) insert ( 3746 1255 0 'make tsquery' ) insert ( 3747 1255 0 'transform to tsquery' ) insert ( 5006 1255 0 'transform to tsquery' ) insert ( 5007 1255 0 'transform to tsquery' ) insert ( 3749 1255 0 'transform to tsvector' ) insert ( 3750 1255 0 'make tsquery' ) insert ( 3751 1255 0 'transform to tsquery' ) insert ( 5001 1255 0 'transform to tsquery' ) insert ( 5009 1255 0 'transform to tsquery' ) insert ( 4209 1255 0 'transform string values from jsonb to tsvector' ) insert ( 4213 1255 0 'transform specified values from jsonb to tsvector' ) insert ( 4210 1255 0 'transform string values from json to tsvector' ) insert ( 4215 1255 0 'transform specified values from json to tsvector' ) insert ( 4211 1255 0 'transform string values from jsonb to tsvector' ) insert ( 4214 1255 0 'transform specified values from jsonb to tsvector' ) insert ( 4212 1255 0 'transform string values from json to tsvector' ) insert ( 4216 1255 0 'transform specified values from json to tsvector' ) insert ( 3752 1255 0 'trigger for automatic update of tsvector column' ) insert ( 3753 1255 0 'trigger for automatic update of tsvector column' ) insert ( 3759 1255 0 'get current tsearch configuration' ) insert ( 3736 1255 0 'I/O' ) insert ( 3737 1255 0 'I/O' ) insert ( 3738 1255 0 'I/O' ) insert ( 3739 1255 0 'I/O' ) insert ( 3771 1255 0 'I/O' ) insert ( 3772 1255 0 'I/O' ) insert ( 3773 1255 0 'I/O' ) insert ( 3774 1255 0 'I/O' ) insert ( 3806 1255 0 'I/O' ) insert ( 3805 1255 0 'I/O' ) insert ( 3804 1255 0 'I/O' ) insert ( 3803 1255 0 'I/O' ) insert ( 3263 1255 0 'map text array of key value pairs to jsonb object' ) insert ( 3264 1255 0 'map text array of key value pairs to jsonb object' ) insert ( 3787 1255 0 'map input to jsonb' ) insert ( 3265 1255 0 'jsonb aggregate transition function' ) insert ( 6283 1255 0 'jsonb aggregate transition function' ) insert ( 3266 1255 0 'jsonb aggregate final function' ) insert ( 3267 1255 0 'aggregate input into jsonb' ) insert ( 6284 1255 0 'aggregate input into jsonb skipping nulls' ) insert ( 3268 1255 0 'jsonb object aggregate transition function' ) insert ( 6285 1255 0 'jsonb object aggregate transition function' ) insert ( 6286 1255 0 'jsonb object aggregate transition function' ) insert ( 6287 1255 0 'jsonb object aggregate transition function' ) insert ( 3269 1255 0 'jsonb object aggregate final function' ) insert ( 3270 1255 0 'aggregate inputs into jsonb object' ) insert ( 6288 1255 0 'aggregate non-NULL inputs into jsonb object' ) insert ( 6289 1255 0 'aggregate inputs into jsonb object checking key uniqueness' ) insert ( 6290 1255 0 'aggregate non-NULL inputs into jsonb object checking key uniqueness' ) insert ( 3271 1255 0 'build a jsonb array from any inputs' ) insert ( 3272 1255 0 'build an empty jsonb array' ) insert ( 3273 1255 0 'build a jsonb object from pairwise key/value inputs' ) insert ( 3274 1255 0 'build an empty jsonb object' ) insert ( 3262 1255 0 'remove object fields with null values from jsonb' ) insert ( 3217 1255 0 'get value from jsonb with path elements' ) insert ( 3940 1255 0 'get value from jsonb as text with path elements' ) insert ( 3219 1255 0 'elements of a jsonb array' ) insert ( 3465 1255 0 'elements of jsonb array' ) insert ( 3207 1255 0 'length of jsonb array' ) insert ( 3931 1255 0 'get jsonb object keys' ) insert ( 3208 1255 0 'key value pairs of a jsonb object' ) insert ( 3932 1255 0 'key value pairs of a jsonb object' ) insert ( 3209 1255 0 'get record fields from a jsonb object' ) insert ( 6338 1255 0 'test get record fields from a jsonb object' ) insert ( 3475 1255 0 'get set of records with fields from a jsonb array of objects' ) insert ( 3490 1255 0 'get record fields from a jsonb object' ) insert ( 3491 1255 0 'get set of records with fields from a jsonb array of objects' ) insert ( 3210 1255 0 'get the type of a jsonb value' ) insert ( 4044 1255 0 less-equal-greater ) insert ( 4045 1255 0 hash ) insert ( 3416 1255 0 hash ) insert ( 3480 1255 0 'GIN support' ) insert ( 3482 1255 0 'GIN support' ) insert ( 3483 1255 0 'GIN support' ) insert ( 3484 1255 0 'GIN support' ) insert ( 3488 1255 0 'GIN support' ) insert ( 3485 1255 0 'GIN support' ) insert ( 3486 1255 0 'GIN support' ) insert ( 3487 1255 0 'GIN support' ) insert ( 3489 1255 0 'GIN support' ) insert ( 5054 1255 0 'Set part of a jsonb, handle NULL value' ) insert ( 3305 1255 0 'Set part of a jsonb' ) insert ( 3306 1255 0 'Indented text from jsonb' ) insert ( 3579 1255 0 'Insert value into a jsonb' ) insert ( 4001 1255 0 'I/O' ) insert ( 4002 1255 0 'I/O' ) insert ( 4003 1255 0 'I/O' ) insert ( 4004 1255 0 'I/O' ) insert ( 4005 1255 0 'jsonpath exists test' ) insert ( 4006 1255 0 'jsonpath query' ) insert ( 4007 1255 0 'jsonpath query wrapped into array' ) insert ( 4008 1255 0 'jsonpath query first item' ) insert ( 4009 1255 0 'jsonpath match' ) insert ( 1177 1255 0 'jsonpath exists test with timezone' ) insert ( 1179 1255 0 'jsonpath query with timezone' ) insert ( 1180 1255 0 'jsonpath query wrapped into array with timezone' ) insert ( 2023 1255 0 'jsonpath query first item with timezone' ) insert ( 2030 1255 0 'jsonpath match with timezone' ) insert ( 4010 1255 0 'implementation of @? operator' ) insert ( 4011 1255 0 'implementation of @@ operator' ) insert ( 2939 1255 0 'I/O' ) insert ( 2940 1255 0 'I/O' ) insert ( 2941 1255 0 'I/O' ) insert ( 2942 1255 0 'I/O' ) insert ( 2943 1255 0 'get current transaction ID' ) insert ( 3348 1255 0 'get current transaction ID' ) insert ( 2944 1255 0 'get current snapshot' ) insert ( 2945 1255 0 'get xmin of snapshot' ) insert ( 2946 1255 0 'get xmax of snapshot' ) insert ( 2947 1255 0 'get set of in-progress txids in snapshot' ) insert ( 2948 1255 0 'is txid visible in snapshot?' ) insert ( 3360 1255 0 'commit status of transaction' ) insert ( 5055 1255 0 'I/O' ) insert ( 5056 1255 0 'I/O' ) insert ( 5057 1255 0 'I/O' ) insert ( 5058 1255 0 'I/O' ) insert ( 5061 1255 0 'get current snapshot' ) insert ( 5062 1255 0 'get xmin of snapshot' ) insert ( 5063 1255 0 'get xmax of snapshot' ) insert ( 5064 1255 0 'get set of in-progress transactions in snapshot' ) insert ( 5065 1255 0 'is xid8 visible in snapshot?' ) insert ( 5059 1255 0 'get current transaction ID' ) insert ( 5060 1255 0 'get current transaction ID' ) insert ( 5066 1255 0 'commit status of transaction' ) insert ( 2987 1255 0 less-equal-greater ) insert ( 6192 1255 0 hash ) insert ( 6193 1255 0 hash ) insert ( 3187 1255 0 'less-equal-greater based on byte images' ) insert ( 5051 1255 0 'equal image' ) insert ( 3082 1255 0 'list available extensions' ) insert ( 3083 1255 0 'list available extension versions' ) insert ( 3084 1255 0 'list an extension''s version update paths' ) insert ( 3086 1255 0 'flag an extension''s table contents to be emitted by pg_dump' ) insert ( 3100 1255 0 'row number within partition' ) insert ( 6233 1255 0 'planner support for row_number' ) insert ( 3101 1255 0 'integer rank with gaps' ) insert ( 6234 1255 0 'planner support for rank' ) insert ( 3102 1255 0 'integer rank without gaps' ) insert ( 6235 1255 0 'planner support for dense_rank' ) insert ( 3103 1255 0 'fractional rank within partition' ) insert ( 6306 1255 0 'planner support for percent_rank' ) insert ( 3104 1255 0 'fractional row number within partition' ) insert ( 6307 1255 0 'planner support for cume_dist' ) insert ( 3105 1255 0 'split rows into N groups' ) insert ( 6308 1255 0 'planner support for ntile' ) insert ( 3106 1255 0 'fetch the preceding row value' ) insert ( 3107 1255 0 'fetch the Nth preceding row value' ) insert ( 3108 1255 0 'fetch the Nth preceding row value with default' ) insert ( 3109 1255 0 'fetch the following row value' ) insert ( 3110 1255 0 'fetch the Nth following row value' ) insert ( 3111 1255 0 'fetch the Nth following row value with default' ) insert ( 3112 1255 0 'fetch the first row value' ) insert ( 3113 1255 0 'fetch the last row value' ) insert ( 3114 1255 0 'fetch the Nth row value' ) insert ( 3832 1255 0 'I/O' ) insert ( 3833 1255 0 'I/O' ) insert ( 3834 1255 0 'I/O' ) insert ( 3835 1255 0 'I/O' ) insert ( 3836 1255 0 'I/O' ) insert ( 3837 1255 0 'I/O' ) insert ( 3848 1255 0 'lower bound of range' ) insert ( 3849 1255 0 'upper bound of range' ) insert ( 3850 1255 0 'is the range empty?' ) insert ( 3851 1255 0 'is the range''s lower bound inclusive?' ) insert ( 3852 1255 0 'is the range''s upper bound inclusive?' ) insert ( 3853 1255 0 'is the range''s lower bound infinite?' ) insert ( 3854 1255 0 'is the range''s upper bound infinite?' ) insert ( 6345 1255 0 'planner support for range_contains_elem' ) insert ( 6346 1255 0 'planner support for elem_contained_by_range' ) insert ( 4057 1255 0 'the smallest range which includes both of the given ranges' ) insert ( 4228 1255 0 'the smallest range which includes the whole multirange' ) insert ( 3870 1255 0 less-equal-greater ) insert ( 3875 1255 0 'GiST support' ) insert ( 3876 1255 0 'GiST support' ) insert ( 3879 1255 0 'GiST support' ) insert ( 3880 1255 0 'GiST support' ) insert ( 3881 1255 0 'GiST support' ) insert ( 6154 1255 0 'GiST support' ) insert ( 6156 1255 0 'GiST support' ) insert ( 3902 1255 0 'hash a range' ) insert ( 3417 1255 0 'hash a range' ) insert ( 3916 1255 0 'range typanalyze' ) insert ( 3169 1255 0 'restriction selectivity for range operators' ) insert ( 4401 1255 0 'range aggregate by intersecting' ) insert ( 4450 1255 0 'range aggregate by intersecting' ) insert ( 3914 1255 0 'convert an int4 range to canonical form' ) insert ( 3928 1255 0 'convert an int8 range to canonical form' ) insert ( 3915 1255 0 'convert a date range to canonical form' ) insert ( 3922 1255 0 'float8 difference of two int4 values' ) insert ( 3923 1255 0 'float8 difference of two int8 values' ) insert ( 3924 1255 0 'float8 difference of two numeric values' ) insert ( 3925 1255 0 'float8 difference of two date values' ) insert ( 3929 1255 0 'float8 difference of two timestamp values' ) insert ( 3930 1255 0 'float8 difference of two timestamp with time zone values' ) insert ( 3840 1255 0 'int4range constructor' ) insert ( 3841 1255 0 'int4range constructor' ) insert ( 3844 1255 0 'numrange constructor' ) insert ( 3845 1255 0 'numrange constructor' ) insert ( 3933 1255 0 'tsrange constructor' ) insert ( 3934 1255 0 'tsrange constructor' ) insert ( 3937 1255 0 'tstzrange constructor' ) insert ( 3938 1255 0 'tstzrange constructor' ) insert ( 3941 1255 0 'daterange constructor' ) insert ( 3942 1255 0 'daterange constructor' ) insert ( 3945 1255 0 'int8range constructor' ) insert ( 3946 1255 0 'int8range constructor' ) insert ( 4229 1255 0 'I/O' ) insert ( 4230 1255 0 'I/O' ) insert ( 4231 1255 0 'I/O' ) insert ( 4232 1255 0 'I/O' ) insert ( 4233 1255 0 'I/O' ) insert ( 4234 1255 0 'I/O' ) insert ( 4235 1255 0 'lower bound of multirange' ) insert ( 4236 1255 0 'upper bound of multirange' ) insert ( 4237 1255 0 'is the multirange empty?' ) insert ( 4238 1255 0 'is the multirange''s lower bound inclusive?' ) insert ( 4239 1255 0 'is the multirange''s upper bound inclusive?' ) insert ( 4240 1255 0 'is the multirange''s lower bound infinite?' ) insert ( 4241 1255 0 'is the multirange''s upper bound infinite?' ) insert ( 4242 1255 0 'multirange typanalyze' ) insert ( 4243 1255 0 'restriction selectivity for multirange operators' ) insert ( 4273 1255 0 less-equal-greater ) insert ( 4278 1255 0 'hash a multirange' ) insert ( 4279 1255 0 'hash a multirange' ) insert ( 4280 1255 0 'int4multirange constructor' ) insert ( 4281 1255 0 'int4multirange constructor' ) insert ( 4282 1255 0 'int4multirange constructor' ) insert ( 4283 1255 0 'nummultirange constructor' ) insert ( 4284 1255 0 'nummultirange constructor' ) insert ( 4285 1255 0 'nummultirange constructor' ) insert ( 4286 1255 0 'tsmultirange constructor' ) insert ( 4287 1255 0 'tsmultirange constructor' ) insert ( 4288 1255 0 'tsmultirange constructor' ) insert ( 4289 1255 0 'tstzmultirange constructor' ) insert ( 4290 1255 0 'tstzmultirange constructor' ) insert ( 4291 1255 0 'tstzmultirange constructor' ) insert ( 4292 1255 0 'datemultirange constructor' ) insert ( 4293 1255 0 'datemultirange constructor' ) insert ( 4294 1255 0 'datemultirange constructor' ) insert ( 4295 1255 0 'int8multirange constructor' ) insert ( 4296 1255 0 'int8multirange constructor' ) insert ( 4297 1255 0 'int8multirange constructor' ) insert ( 4298 1255 0 'anymultirange cast' ) insert ( 4299 1255 0 'aggregate transition function' ) insert ( 4300 1255 0 'aggregate final function' ) insert ( 4301 1255 0 'combine aggregate input into a multirange' ) insert ( 6225 1255 0 'aggregate transition function' ) insert ( 6226 1255 0 'aggregate final function' ) insert ( 6227 1255 0 'combine aggregate input into a multirange' ) insert ( 4388 1255 0 'range aggregate by intersecting' ) insert ( 4389 1255 0 'range aggregate by intersecting' ) insert ( 1293 1255 0 'expand multirange to set of ranges' ) insert ( 3846 1255 0 'construct date' ) insert ( 3847 1255 0 'construct time' ) insert ( 3461 1255 0 'construct timestamp' ) insert ( 3462 1255 0 'construct timestamp with time zone' ) insert ( 3463 1255 0 'construct timestamp with time zone' ) insert ( 3464 1255 0 'construct interval' ) insert ( 4018 1255 0 'SP-GiST support for quad tree over point' ) insert ( 4019 1255 0 'SP-GiST support for quad tree over point' ) insert ( 4020 1255 0 'SP-GiST support for quad tree over point' ) insert ( 4021 1255 0 'SP-GiST support for quad tree over point' ) insert ( 4022 1255 0 'SP-GiST support for quad tree and k-d tree over point' ) insert ( 4023 1255 0 'SP-GiST support for k-d tree over point' ) insert ( 4024 1255 0 'SP-GiST support for k-d tree over point' ) insert ( 4025 1255 0 'SP-GiST support for k-d tree over point' ) insert ( 4026 1255 0 'SP-GiST support for k-d tree over point' ) insert ( 4027 1255 0 'SP-GiST support for radix tree over text' ) insert ( 4028 1255 0 'SP-GiST support for radix tree over text' ) insert ( 4029 1255 0 'SP-GiST support for radix tree over text' ) insert ( 4030 1255 0 'SP-GiST support for radix tree over text' ) insert ( 4031 1255 0 'SP-GiST support for radix tree over text' ) insert ( 3469 1255 0 'SP-GiST support for quad tree over range' ) insert ( 3470 1255 0 'SP-GiST support for quad tree over range' ) insert ( 3471 1255 0 'SP-GiST support for quad tree over range' ) insert ( 3472 1255 0 'SP-GiST support for quad tree over range' ) insert ( 3473 1255 0 'SP-GiST support for quad tree over range' ) insert ( 5012 1255 0 'SP-GiST support for quad tree over box' ) insert ( 5013 1255 0 'SP-GiST support for quad tree over box' ) insert ( 5014 1255 0 'SP-GiST support for quad tree over box' ) insert ( 5015 1255 0 'SP-GiST support for quad tree over box' ) insert ( 5016 1255 0 'SP-GiST support for quad tree over box' ) insert ( 5010 1255 0 'SP-GiST support for quad tree over 2-D types represented by their bounding boxes' ) insert ( 5011 1255 0 'SP-GiST support for quad tree over polygons' ) insert ( 3779 1255 0 'create a physical replication slot' ) insert ( 4220 1255 0 'copy a physical replication slot, changing temporality' ) insert ( 4221 1255 0 'copy a physical replication slot' ) insert ( 3780 1255 0 'drop a replication slot' ) insert ( 3781 1255 0 'information about replication slots currently in use' ) insert ( 3786 1255 0 'set up a logical replication slot' ) insert ( 4222 1255 0 'copy a logical replication slot, changing temporality and plugin' ) insert ( 4223 1255 0 'copy a logical replication slot, changing temporality' ) insert ( 4224 1255 0 'copy a logical replication slot' ) insert ( 3782 1255 0 'get changes from replication slot' ) insert ( 3783 1255 0 'get binary changes from replication slot' ) insert ( 3784 1255 0 'peek at changes from replication slot' ) insert ( 3785 1255 0 'peek at binary changes from replication slot' ) insert ( 3878 1255 0 'advance logical replication slot' ) insert ( 3577 1255 0 'emit a textual logical decoding message' ) insert ( 3578 1255 0 'emit a binary logical decoding message' ) insert ( 6344 1255 0 'sync replication slots from the primary to the standby' ) insert ( 3566 1255 0 'list objects dropped by the current command' ) insert ( 4566 1255 0 'return Oid of the table getting rewritten' ) insert ( 4567 1255 0 'return reason code for table getting rewritten' ) insert ( 4568 1255 0 'list DDL actions being executed by the current command' ) insert ( 3970 1255 0 'aggregate transition function' ) insert ( 3971 1255 0 'aggregate transition function' ) insert ( 3972 1255 0 'discrete percentile' ) insert ( 3973 1255 0 'aggregate final function' ) insert ( 3974 1255 0 'continuous distribution percentile' ) insert ( 3975 1255 0 'aggregate final function' ) insert ( 3976 1255 0 'continuous distribution percentile' ) insert ( 3977 1255 0 'aggregate final function' ) insert ( 3978 1255 0 'multiple discrete percentiles' ) insert ( 3979 1255 0 'aggregate final function' ) insert ( 3980 1255 0 'multiple continuous percentiles' ) insert ( 3981 1255 0 'aggregate final function' ) insert ( 3982 1255 0 'multiple continuous percentiles' ) insert ( 3983 1255 0 'aggregate final function' ) insert ( 3984 1255 0 'most common value' ) insert ( 3985 1255 0 'aggregate final function' ) insert ( 3986 1255 0 'rank of hypothetical row' ) insert ( 3987 1255 0 'aggregate final function' ) insert ( 3988 1255 0 'fractional rank of hypothetical row' ) insert ( 3989 1255 0 'aggregate final function' ) insert ( 3990 1255 0 'cumulative distribution of hypothetical row' ) insert ( 3991 1255 0 'aggregate final function' ) insert ( 3992 1255 0 'rank of hypothetical row without gaps' ) insert ( 3993 1255 0 'aggregate final function' ) insert ( 3582 1255 0 'for use by pg_upgrade' ) insert ( 3584 1255 0 'for use by pg_upgrade' ) insert ( 4390 1255 0 'for use by pg_upgrade' ) insert ( 4391 1255 0 'for use by pg_upgrade' ) insert ( 3586 1255 0 'for use by pg_upgrade' ) insert ( 3587 1255 0 'for use by pg_upgrade' ) insert ( 3588 1255 0 'for use by pg_upgrade' ) insert ( 3589 1255 0 'for use by pg_upgrade' ) insert ( 3590 1255 0 'for use by pg_upgrade' ) insert ( 3591 1255 0 'for use by pg_upgrade' ) insert ( 4083 1255 0 'for use by pg_upgrade' ) insert ( 4101 1255 0 'for use by pg_upgrade' ) insert ( 4545 1255 0 'for use by pg_upgrade' ) insert ( 4546 1255 0 'for use by pg_upgrade' ) insert ( 4547 1255 0 'for use by pg_upgrade' ) insert ( 4548 1255 0 'for use by pg_upgrade' ) insert ( 6312 1255 0 'for use by pg_upgrade' ) insert ( 6319 1255 0 'for use by pg_upgrade (relation for pg_subscription_rel)' ) insert ( 6320 1255 0 'for use by pg_upgrade (remote_lsn for origin)' ) insert ( 4302 1255 0 'internal conversion function for KOI8R to MULE_INTERNAL' ) insert ( 4303 1255 0 'internal conversion function for MULE_INTERNAL to KOI8R' ) insert ( 4304 1255 0 'internal conversion function for ISO-8859-5 to MULE_INTERNAL' ) insert ( 4305 1255 0 'internal conversion function for MULE_INTERNAL to ISO-8859-5' ) insert ( 4306 1255 0 'internal conversion function for WIN1251 to MULE_INTERNAL' ) insert ( 4307 1255 0 'internal conversion function for MULE_INTERNAL to WIN1251' ) insert ( 4308 1255 0 'internal conversion function for WIN866 to MULE_INTERNAL' ) insert ( 4309 1255 0 'internal conversion function for MULE_INTERNAL to WIN866' ) insert ( 4310 1255 0 'internal conversion function for KOI8R to WIN1251' ) insert ( 4311 1255 0 'internal conversion function for WIN1251 to KOI8R' ) insert ( 4312 1255 0 'internal conversion function for KOI8R to WIN866' ) insert ( 4313 1255 0 'internal conversion function for WIN866 to KOI8R' ) insert ( 4314 1255 0 'internal conversion function for WIN866 to WIN1251' ) insert ( 4315 1255 0 'internal conversion function for WIN1251 to WIN866' ) insert ( 4316 1255 0 'internal conversion function for ISO-8859-5 to KOI8R' ) insert ( 4317 1255 0 'internal conversion function for KOI8R to ISO-8859-5' ) insert ( 4318 1255 0 'internal conversion function for ISO-8859-5 to WIN1251' ) insert ( 4319 1255 0 'internal conversion function for WIN1251 to ISO-8859-5' ) insert ( 4320 1255 0 'internal conversion function for ISO-8859-5 to WIN866' ) insert ( 4321 1255 0 'internal conversion function for WIN866 to ISO-8859-5' ) insert ( 4322 1255 0 'internal conversion function for EUC_CN to MULE_INTERNAL' ) insert ( 4323 1255 0 'internal conversion function for MULE_INTERNAL to EUC_CN' ) insert ( 4324 1255 0 'internal conversion function for EUC_JP to SJIS' ) insert ( 4325 1255 0 'internal conversion function for SJIS to EUC_JP' ) insert ( 4326 1255 0 'internal conversion function for EUC_JP to MULE_INTERNAL' ) insert ( 4327 1255 0 'internal conversion function for SJIS to MULE_INTERNAL' ) insert ( 4328 1255 0 'internal conversion function for MULE_INTERNAL to EUC_JP' ) insert ( 4329 1255 0 'internal conversion function for MULE_INTERNAL to SJIS' ) insert ( 4330 1255 0 'internal conversion function for EUC_KR to MULE_INTERNAL' ) insert ( 4331 1255 0 'internal conversion function for MULE_INTERNAL to EUC_KR' ) insert ( 4332 1255 0 'internal conversion function for EUC_TW to BIG5' ) insert ( 4333 1255 0 'internal conversion function for BIG5 to EUC_TW' ) insert ( 4334 1255 0 'internal conversion function for EUC_TW to MULE_INTERNAL' ) insert ( 4335 1255 0 'internal conversion function for BIG5 to MULE_INTERNAL' ) insert ( 4336 1255 0 'internal conversion function for MULE_INTERNAL to EUC_TW' ) insert ( 4337 1255 0 'internal conversion function for MULE_INTERNAL to BIG5' ) insert ( 4338 1255 0 'internal conversion function for LATIN2 to MULE_INTERNAL' ) insert ( 4339 1255 0 'internal conversion function for MULE_INTERNAL to LATIN2' ) insert ( 4340 1255 0 'internal conversion function for WIN1250 to MULE_INTERNAL' ) insert ( 4341 1255 0 'internal conversion function for MULE_INTERNAL to WIN1250' ) insert ( 4342 1255 0 'internal conversion function for LATIN2 to WIN1250' ) insert ( 4343 1255 0 'internal conversion function for WIN1250 to LATIN2' ) insert ( 4344 1255 0 'internal conversion function for LATIN1 to MULE_INTERNAL' ) insert ( 4345 1255 0 'internal conversion function for MULE_INTERNAL to LATIN1' ) insert ( 4346 1255 0 'internal conversion function for LATIN3 to MULE_INTERNAL' ) insert ( 4347 1255 0 'internal conversion function for MULE_INTERNAL to LATIN3' ) insert ( 4348 1255 0 'internal conversion function for LATIN4 to MULE_INTERNAL' ) insert ( 4349 1255 0 'internal conversion function for MULE_INTERNAL to LATIN4' ) insert ( 4352 1255 0 'internal conversion function for BIG5 to UTF8' ) insert ( 4353 1255 0 'internal conversion function for UTF8 to BIG5' ) insert ( 4354 1255 0 'internal conversion function for UTF8 to KOI8R' ) insert ( 4355 1255 0 'internal conversion function for KOI8R to UTF8' ) insert ( 4356 1255 0 'internal conversion function for UTF8 to KOI8U' ) insert ( 4357 1255 0 'internal conversion function for KOI8U to UTF8' ) insert ( 4358 1255 0 'internal conversion function for UTF8 to WIN' ) insert ( 4359 1255 0 'internal conversion function for WIN to UTF8' ) insert ( 4360 1255 0 'internal conversion function for EUC_CN to UTF8' ) insert ( 4361 1255 0 'internal conversion function for UTF8 to EUC_CN' ) insert ( 4362 1255 0 'internal conversion function for EUC_JP to UTF8' ) insert ( 4363 1255 0 'internal conversion function for UTF8 to EUC_JP' ) insert ( 4364 1255 0 'internal conversion function for EUC_KR to UTF8' ) insert ( 4365 1255 0 'internal conversion function for UTF8 to EUC_KR' ) insert ( 4366 1255 0 'internal conversion function for EUC_TW to UTF8' ) insert ( 4367 1255 0 'internal conversion function for UTF8 to EUC_TW' ) insert ( 4368 1255 0 'internal conversion function for GB18030 to UTF8' ) insert ( 4369 1255 0 'internal conversion function for UTF8 to GB18030' ) insert ( 4370 1255 0 'internal conversion function for GBK to UTF8' ) insert ( 4371 1255 0 'internal conversion function for UTF8 to GBK' ) insert ( 4372 1255 0 'internal conversion function for UTF8 to ISO-8859 2-16' ) insert ( 4373 1255 0 'internal conversion function for ISO-8859 2-16 to UTF8' ) insert ( 4374 1255 0 'internal conversion function for LATIN1 to UTF8' ) insert ( 4375 1255 0 'internal conversion function for UTF8 to LATIN1' ) insert ( 4376 1255 0 'internal conversion function for JOHAB to UTF8' ) insert ( 4377 1255 0 'internal conversion function for UTF8 to JOHAB' ) insert ( 4378 1255 0 'internal conversion function for SJIS to UTF8' ) insert ( 4379 1255 0 'internal conversion function for UTF8 to SJIS' ) insert ( 4380 1255 0 'internal conversion function for UHC to UTF8' ) insert ( 4381 1255 0 'internal conversion function for UTF8 to UHC' ) insert ( 4382 1255 0 'internal conversion function for EUC_JIS_2004 to UTF8' ) insert ( 4383 1255 0 'internal conversion function for UTF8 to EUC_JIS_2004' ) insert ( 4384 1255 0 'internal conversion function for SHIFT_JIS_2004 to UTF8' ) insert ( 4385 1255 0 'internal conversion function for UTF8 to SHIFT_JIS_2004' ) insert ( 4386 1255 0 'internal conversion function for EUC_JIS_2004 to SHIFT_JIS_2004' ) insert ( 4387 1255 0 'internal conversion function for SHIFT_JIS_2004 to EUC_JIS_2004' ) insert ( 5040 1255 0 'restriction selectivity for generic matching operators' ) insert ( 5041 1255 0 'join selectivity for generic matching operators' ) insert ( 6003 1255 0 'create a replication origin' ) insert ( 6004 1255 0 'drop replication origin identified by its name' ) insert ( 6005 1255 0 'translate the replication origin''s name to its id' ) insert ( 6006 1255 0 'configure session to maintain replication progress tracking for the passed in origin' ) insert ( 6007 1255 0 'teardown configured replication progress tracking' ) insert ( 6008 1255 0 'is a replication origin configured in this session' ) insert ( 6009 1255 0 'get the replication progress of the current session' ) insert ( 6010 1255 0 'setup the transaction''s origin lsn and timestamp' ) insert ( 6011 1255 0 'reset the transaction''s origin lsn and timestamp' ) insert ( 6012 1255 0 'advance replication origin to specific location' ) insert ( 6013 1255 0 'get an individual replication origin''s replication progress' ) insert ( 6014 1255 0 'get progress for all replication origins' ) insert ( 6119 1255 0 'get information of the tables that are part of the specified publications' ) insert ( 6121 1255 0 'returns whether a relation can be part of a publication' ) insert ( 3298 1255 0 'row security for current context active on table by table oid' ) insert ( 3299 1255 0 'row security for current context active on table by table name' ) insert ( 3400 1255 0 'pg_config binary as a function' ) insert ( 3441 1255 0 'pg_controldata general state information as a function' ) insert ( 3442 1255 0 'pg_controldata checkpoint state information as a function' ) insert ( 3443 1255 0 'pg_controldata recovery state information as a function' ) insert ( 3444 1255 0 'pg_controldata init state information as a function' ) insert ( 6179 1255 0 'standard array subscripting support' ) insert ( 6180 1255 0 'raw array subscripting support' ) insert ( 6098 1255 0 'jsonb subscripting logic' ) insert ( 3445 1255 0 'import collations from operating system' ) insert ( 3448 1255 0 'get actual version of collation from operating system' ) insert ( 6249 1255 0 'get actual version of database collation from operating system' ) insert ( 3353 1255 0 'list files in the log directory' ) insert ( 3354 1255 0 'list of files in the WAL directory' ) insert ( 5031 1255 0 'list of files in the archive_status directory' ) insert ( 5029 1255 0 'list files in the pgsql_tmp directory' ) insert ( 5030 1255 0 'list files in the pgsql_tmp directory' ) insert ( 6270 1255 0 'list of files in the pg_logical/snapshots directory' ) insert ( 6271 1255 0 'list of files in the pg_logical/mappings directory' ) insert ( 6272 1255 0 'list of files in the pg_replslot/slot_name directory' ) insert ( 5028 1255 0 'hash partition CHECK constraint' ) insert ( 3423 1255 0 'view partition tree tables' ) insert ( 3425 1255 0 'view ancestors of the partition' ) insert ( 3424 1255 0 'get top-most partition root parent' ) insert ( 4549 1255 0 'Unicode version used by Postgres' ) insert ( 6099 1255 0 'Unicode version used by ICU, if enabled' ) insert ( 6105 1255 0 'check valid Unicode' ) insert ( 4350 1255 0 'Unicode normalization' ) insert ( 4351 1255 0 'check Unicode normalization' ) insert ( 6198 1255 0 'unescape Unicode characters' ) insert ( 4596 1255 0 'I/O' ) insert ( 4597 1255 0 'I/O' ) insert ( 4598 1255 0 'I/O' ) insert ( 4599 1255 0 'I/O' ) insert ( 4638 1255 0 'I/O' ) insert ( 4639 1255 0 'I/O' ) insert ( 4640 1255 0 'I/O' ) insert ( 4641 1255 0 'I/O' ) insert ( 6291 1255 0 'arbitrary value from among input values' ) insert ( 6292 1255 0 'aggregate transition function' ) insert ( 6321 1255 0 'list of available WAL summary files' ) insert ( 6322 1255 0 'contents of a WAL summary file' ) insert ( 6323 1255 0 'WAL summarizer state' ) insert ( 16 1247 0 'boolean, format ''t''/''f''' ) insert ( 17 1247 0 'variable-length string, binary values escaped' ) insert ( 18 1247 0 'single character' ) insert ( 19 1247 0 '63-byte type for storing system identifiers' ) insert ( 20 1247 0 '~18 digit integer, 8-byte storage' ) insert ( 21 1247 0 '-32 thousand to 32 thousand, 2-byte storage' ) insert ( 22 1247 0 'array of int2, used in system tables' ) insert ( 23 1247 0 '-2 billion to 2 billion integer, 4-byte storage' ) insert ( 24 1247 0 'registered procedure' ) insert ( 25 1247 0 'variable-length string, no limit specified' ) insert ( 26 1247 0 'object identifier(oid), maximum 4 billion' ) insert ( 27 1247 0 'tuple physical location, format ''(block,offset)''' ) insert ( 28 1247 0 'transaction id' ) insert ( 29 1247 0 'command identifier type, sequence in transaction id' ) insert ( 30 1247 0 'array of oids, used in system tables' ) insert ( 114 1247 0 'JSON stored as text' ) insert ( 142 1247 0 'XML content' ) insert ( 194 1247 0 'string representing an internal node tree' ) insert ( 3361 1247 0 'multivariate ndistinct coefficients' ) insert ( 3402 1247 0 'multivariate dependencies' ) insert ( 5017 1247 0 'multivariate MCV list' ) insert ( 32 1247 0 'internal type for passing CollectedCommand' ) insert ( 5069 1247 0 'full transaction id' ) insert ( 600 1247 0 'geometric point, format ''(x,y)''' ) insert ( 601 1247 0 'geometric line segment, format ''[point1,point2]''' ) insert ( 602 1247 0 'geometric path, format ''(point1,...)''' ) insert ( 603 1247 0 'geometric box, format ''lower left point,upper right point''' ) insert ( 604 1247 0 'geometric polygon, format ''(point1,...)''' ) insert ( 628 1247 0 'geometric line, formats ''{A,B,C}''/''[point1,point2]''' ) insert ( 700 1247 0 'single-precision floating point number, 4-byte storage' ) insert ( 701 1247 0 'double-precision floating point number, 8-byte storage' ) insert ( 705 1247 0 'pseudo-type representing an undetermined type' ) insert ( 718 1247 0 'geometric circle, format ''
''' ) insert ( 790 1247 0 'monetary amounts, $d,ddd.cc' ) insert ( 829 1247 0 'XX:XX:XX:XX:XX:XX, MAC address' ) insert ( 869 1247 0 'IP address/netmask, host address, netmask optional' ) insert ( 650 1247 0 'network IP address/netmask, network address' ) insert ( 774 1247 0 'XX:XX:XX:XX:XX:XX:XX:XX, MAC address' ) insert ( 1033 1247 0 'access control list' ) insert ( 1042 1247 0 '''char(length)'' blank-padded string, fixed storage length' ) insert ( 1043 1247 0 '''varchar(length)'' non-blank-padded string, variable storage length' ) insert ( 1082 1247 0 date ) insert ( 1083 1247 0 'time of day' ) insert ( 1114 1247 0 'date and time' ) insert ( 1184 1247 0 'date and time with time zone' ) insert ( 1186 1247 0 'time interval, format ''number units ...''' ) insert ( 1266 1247 0 'time of day with time zone' ) insert ( 1560 1247 0 'fixed-length bit string' ) insert ( 1562 1247 0 'variable-length bit string' ) insert ( 1700 1247 0 '''numeric(precision, scale)'' arbitrary precision number' ) insert ( 1790 1247 0 'reference to cursor (portal name)' ) insert ( 2202 1247 0 'registered procedure (with args)' ) insert ( 2203 1247 0 'registered operator' ) insert ( 2204 1247 0 'registered operator (with args)' ) insert ( 2205 1247 0 'registered class' ) insert ( 4191 1247 0 'registered collation' ) insert ( 2206 1247 0 'registered type' ) insert ( 4096 1247 0 'registered role' ) insert ( 4089 1247 0 'registered namespace' ) insert ( 2950 1247 0 UUID ) insert ( 3220 1247 0 'PostgreSQL LSN' ) insert ( 3614 1247 0 'text representation for text search' ) insert ( 3642 1247 0 'GiST index internal text representation for text search' ) insert ( 3615 1247 0 'query representation for text search' ) insert ( 3734 1247 0 'registered text search configuration' ) insert ( 3769 1247 0 'registered text search dictionary' ) insert ( 3802 1247 0 'Binary JSON' ) insert ( 4072 1247 0 'JSON path' ) insert ( 2970 1247 0 'transaction snapshot' ) insert ( 5038 1247 0 'transaction snapshot' ) insert ( 3904 1247 0 'range of integers' ) insert ( 3906 1247 0 'range of numerics' ) insert ( 3908 1247 0 'range of timestamps without time zone' ) insert ( 3910 1247 0 'range of timestamps with time zone' ) insert ( 3912 1247 0 'range of dates' ) insert ( 3926 1247 0 'range of bigints' ) insert ( 4451 1247 0 'multirange of integers' ) insert ( 4532 1247 0 'multirange of numerics' ) insert ( 4533 1247 0 'multirange of timestamps without time zone' ) insert ( 4534 1247 0 'multirange of timestamps with time zone' ) insert ( 4535 1247 0 'multirange of dates' ) insert ( 4536 1247 0 'multirange of bigints' ) insert ( 2249 1247 0 'pseudo-type representing any composite type' ) insert ( 2275 1247 0 'C-style string' ) insert ( 2276 1247 0 'pseudo-type representing any type' ) insert ( 2277 1247 0 'pseudo-type representing a polymorphic array type' ) insert ( 2278 1247 0 'pseudo-type for the result of a function with no real result' ) insert ( 2279 1247 0 'pseudo-type for the result of a trigger function' ) insert ( 3838 1247 0 'pseudo-type for the result of an event trigger function' ) insert ( 2280 1247 0 'pseudo-type for the result of a language handler function' ) insert ( 2281 1247 0 'pseudo-type representing an internal data structure' ) insert ( 2283 1247 0 'pseudo-type representing a polymorphic base type' ) insert ( 2776 1247 0 'pseudo-type representing a polymorphic base type that is not an array' ) insert ( 3500 1247 0 'pseudo-type representing a polymorphic base type that is an enum' ) insert ( 3115 1247 0 'pseudo-type for the result of an FDW handler function' ) insert ( 325 1247 0 'pseudo-type for the result of an index AM handler function' ) insert ( 3310 1247 0 'pseudo-type for the result of a tablesample method function' ) insert ( 269 1247 0 'pseudo-type for the result of a table AM handler function' ) insert ( 3831 1247 0 'pseudo-type representing a range over a polymorphic base type' ) insert ( 5077 1247 0 'pseudo-type representing a polymorphic common type' ) insert ( 5078 1247 0 'pseudo-type representing an array of polymorphic common type elements' ) insert ( 5079 1247 0 'pseudo-type representing a polymorphic common type that is not an array' ) insert ( 5080 1247 0 'pseudo-type representing a range over a polymorphic common type' ) insert ( 4537 1247 0 'pseudo-type representing a polymorphic base type that is a multirange' ) insert ( 4538 1247 0 'pseudo-type representing a multirange over a polymorphic common type' ) insert ( 4600 1247 0 'pseudo-type representing BRIN bloom summary' ) insert ( 4601 1247 0 'pseudo-type representing BRIN minmax-multi summary' ) insert ( 15 2617 0 equal ) insert ( 36 2617 0 'not equal' ) insert ( 37 2617 0 'less than' ) insert ( 76 2617 0 'greater than' ) insert ( 80 2617 0 'less than or equal' ) insert ( 82 2617 0 'greater than or equal' ) insert ( 58 2617 0 'less than' ) insert ( 59 2617 0 'greater than' ) insert ( 85 2617 0 'not equal' ) insert ( 91 2617 0 equal ) insert ( 1694 2617 0 'less than or equal' ) insert ( 1695 2617 0 'greater than or equal' ) insert ( 92 2617 0 equal ) insert ( 93 2617 0 equal ) insert ( 94 2617 0 equal ) insert ( 95 2617 0 'less than' ) insert ( 96 2617 0 equal ) insert ( 97 2617 0 'less than' ) insert ( 98 2617 0 equal ) insert ( 3877 2617 0 'starts with' ) insert ( 254 2617 0 equal ) insert ( 255 2617 0 'less than' ) insert ( 256 2617 0 'less than or equal' ) insert ( 257 2617 0 'greater than or equal' ) insert ( 258 2617 0 'greater than' ) insert ( 259 2617 0 'not equal' ) insert ( 260 2617 0 equal ) insert ( 261 2617 0 'less than' ) insert ( 262 2617 0 'less than or equal' ) insert ( 263 2617 0 'greater than or equal' ) insert ( 264 2617 0 'greater than' ) insert ( 265 2617 0 'not equal' ) insert ( 349 2617 0 'append element onto end of array' ) insert ( 374 2617 0 'prepend element onto front of array' ) insert ( 375 2617 0 concatenate ) insert ( 352 2617 0 equal ) insert ( 353 2617 0 equal ) insert ( 3315 2617 0 'not equal' ) insert ( 3316 2617 0 'not equal' ) insert ( 5068 2617 0 equal ) insert ( 5072 2617 0 'not equal' ) insert ( 5073 2617 0 'less than' ) insert ( 5074 2617 0 'greater than' ) insert ( 5075 2617 0 'less than or equal' ) insert ( 5076 2617 0 'greater than or equal' ) insert ( 385 2617 0 equal ) insert ( 387 2617 0 equal ) insert ( 402 2617 0 'not equal' ) insert ( 2799 2617 0 'less than' ) insert ( 2800 2617 0 'greater than' ) insert ( 2801 2617 0 'less than or equal' ) insert ( 2802 2617 0 'greater than or equal' ) insert ( 410 2617 0 equal ) insert ( 411 2617 0 'not equal' ) insert ( 412 2617 0 'less than' ) insert ( 413 2617 0 'greater than' ) insert ( 414 2617 0 'less than or equal' ) insert ( 415 2617 0 'greater than or equal' ) insert ( 416 2617 0 equal ) insert ( 417 2617 0 'not equal' ) insert ( 418 2617 0 'less than' ) insert ( 419 2617 0 'greater than' ) insert ( 420 2617 0 'less than or equal' ) insert ( 430 2617 0 'greater than or equal' ) insert ( 439 2617 0 modulus ) insert ( 473 2617 0 'absolute value' ) insert ( 484 2617 0 negate ) insert ( 485 2617 0 'is left of' ) insert ( 486 2617 0 'overlaps or is left of' ) insert ( 487 2617 0 'overlaps or is right of' ) insert ( 488 2617 0 'is right of' ) insert ( 489 2617 0 'is contained by' ) insert ( 490 2617 0 contains ) insert ( 491 2617 0 'same as' ) insert ( 492 2617 0 overlaps ) insert ( 493 2617 0 'is left of' ) insert ( 494 2617 0 'overlaps or is left of' ) insert ( 495 2617 0 'overlaps or is right of' ) insert ( 496 2617 0 'is right of' ) insert ( 497 2617 0 'is contained by' ) insert ( 498 2617 0 contains ) insert ( 499 2617 0 'same as' ) insert ( 500 2617 0 overlaps ) insert ( 501 2617 0 'greater than or equal by area' ) insert ( 502 2617 0 'greater than by area' ) insert ( 503 2617 0 'equal by area' ) insert ( 504 2617 0 'less than by area' ) insert ( 505 2617 0 'less than or equal by area' ) insert ( 506 2617 0 'deprecated, use |>> instead' ) insert ( 507 2617 0 'is left of' ) insert ( 508 2617 0 'is right of' ) insert ( 509 2617 0 'deprecated, use <<| instead' ) insert ( 510 2617 0 'same as' ) insert ( 511 2617 0 'point inside box' ) insert ( 433 2617 0 contains ) insert ( 512 2617 0 'point within closed path, or point on open path' ) insert ( 513 2617 0 'center of' ) insert ( 514 2617 0 multiply ) insert ( 517 2617 0 'distance between' ) insert ( 518 2617 0 'not equal' ) insert ( 519 2617 0 'not equal' ) insert ( 520 2617 0 'greater than' ) insert ( 521 2617 0 'greater than' ) insert ( 522 2617 0 'less than or equal' ) insert ( 523 2617 0 'less than or equal' ) insert ( 524 2617 0 'greater than or equal' ) insert ( 525 2617 0 'greater than or equal' ) insert ( 526 2617 0 multiply ) insert ( 527 2617 0 divide ) insert ( 528 2617 0 divide ) insert ( 529 2617 0 modulus ) insert ( 530 2617 0 modulus ) insert ( 531 2617 0 'not equal' ) insert ( 532 2617 0 equal ) insert ( 533 2617 0 equal ) insert ( 534 2617 0 'less than' ) insert ( 535 2617 0 'less than' ) insert ( 536 2617 0 'greater than' ) insert ( 537 2617 0 'greater than' ) insert ( 538 2617 0 'not equal' ) insert ( 539 2617 0 'not equal' ) insert ( 540 2617 0 'less than or equal' ) insert ( 541 2617 0 'less than or equal' ) insert ( 542 2617 0 'greater than or equal' ) insert ( 543 2617 0 'greater than or equal' ) insert ( 544 2617 0 multiply ) insert ( 545 2617 0 multiply ) insert ( 546 2617 0 divide ) insert ( 547 2617 0 divide ) insert ( 550 2617 0 add ) insert ( 551 2617 0 add ) insert ( 552 2617 0 add ) insert ( 553 2617 0 add ) insert ( 554 2617 0 subtract ) insert ( 555 2617 0 subtract ) insert ( 556 2617 0 subtract ) insert ( 557 2617 0 subtract ) insert ( 558 2617 0 negate ) insert ( 559 2617 0 negate ) insert ( 584 2617 0 negate ) insert ( 585 2617 0 negate ) insert ( 586 2617 0 add ) insert ( 587 2617 0 subtract ) insert ( 588 2617 0 divide ) insert ( 589 2617 0 multiply ) insert ( 590 2617 0 'absolute value' ) insert ( 591 2617 0 add ) insert ( 592 2617 0 subtract ) insert ( 593 2617 0 divide ) insert ( 594 2617 0 multiply ) insert ( 595 2617 0 'absolute value' ) insert ( 596 2617 0 'square root' ) insert ( 597 2617 0 'cube root' ) insert ( 607 2617 0 equal ) insert ( 608 2617 0 'not equal' ) insert ( 609 2617 0 'less than' ) insert ( 610 2617 0 'greater than' ) insert ( 611 2617 0 'less than or equal' ) insert ( 612 2617 0 'greater than or equal' ) insert ( 644 2617 0 'not equal' ) insert ( 645 2617 0 'less than' ) insert ( 646 2617 0 'greater than' ) insert ( 647 2617 0 'less than or equal' ) insert ( 648 2617 0 'greater than or equal' ) insert ( 649 2617 0 equal ) insert ( 613 2617 0 'distance between' ) insert ( 760 2617 0 'distance between' ) insert ( 614 2617 0 'distance between' ) insert ( 761 2617 0 'distance between' ) insert ( 615 2617 0 'distance between' ) insert ( 606 2617 0 'distance between' ) insert ( 616 2617 0 'distance between' ) insert ( 762 2617 0 'distance between' ) insert ( 617 2617 0 'distance between' ) insert ( 763 2617 0 'distance between' ) insert ( 618 2617 0 'distance between' ) insert ( 784 2617 0 'distance between' ) insert ( 620 2617 0 equal ) insert ( 621 2617 0 'not equal' ) insert ( 622 2617 0 'less than' ) insert ( 623 2617 0 'greater than' ) insert ( 624 2617 0 'less than or equal' ) insert ( 625 2617 0 'greater than or equal' ) insert ( 630 2617 0 'not equal' ) insert ( 631 2617 0 'less than' ) insert ( 632 2617 0 'less than or equal' ) insert ( 633 2617 0 'greater than' ) insert ( 634 2617 0 'greater than or equal' ) insert ( 639 2617 0 'matches regular expression, case-sensitive' ) insert ( 640 2617 0 'does not match regular expression, case-sensitive' ) insert ( 641 2617 0 'matches regular expression, case-sensitive' ) insert ( 642 2617 0 'does not match regular expression, case-sensitive' ) insert ( 643 2617 0 'not equal' ) insert ( 654 2617 0 concatenate ) insert ( 660 2617 0 'less than' ) insert ( 661 2617 0 'less than or equal' ) insert ( 662 2617 0 'greater than' ) insert ( 663 2617 0 'greater than or equal' ) insert ( 664 2617 0 'less than' ) insert ( 665 2617 0 'less than or equal' ) insert ( 666 2617 0 'greater than' ) insert ( 667 2617 0 'greater than or equal' ) insert ( 670 2617 0 equal ) insert ( 671 2617 0 'not equal' ) insert ( 672 2617 0 'less than' ) insert ( 673 2617 0 'less than or equal' ) insert ( 674 2617 0 'greater than' ) insert ( 675 2617 0 'greater than or equal' ) insert ( 682 2617 0 'absolute value' ) insert ( 684 2617 0 add ) insert ( 685 2617 0 subtract ) insert ( 686 2617 0 multiply ) insert ( 687 2617 0 divide ) insert ( 688 2617 0 add ) insert ( 689 2617 0 subtract ) insert ( 690 2617 0 multiply ) insert ( 691 2617 0 divide ) insert ( 692 2617 0 add ) insert ( 693 2617 0 subtract ) insert ( 694 2617 0 multiply ) insert ( 695 2617 0 divide ) insert ( 818 2617 0 add ) insert ( 819 2617 0 subtract ) insert ( 820 2617 0 multiply ) insert ( 821 2617 0 divide ) insert ( 822 2617 0 add ) insert ( 823 2617 0 subtract ) insert ( 824 2617 0 multiply ) insert ( 825 2617 0 divide ) insert ( 706 2617 0 'distance between' ) insert ( 707 2617 0 'distance between' ) insert ( 708 2617 0 'distance between' ) insert ( 709 2617 0 'distance between' ) insert ( 712 2617 0 'distance between' ) insert ( 713 2617 0 'not equal' ) insert ( 731 2617 0 'add points (translate)' ) insert ( 732 2617 0 'subtract points (translate)' ) insert ( 733 2617 0 'multiply points (scale/rotate)' ) insert ( 734 2617 0 'divide points (scale/rotate)' ) insert ( 735 2617 0 concatenate ) insert ( 736 2617 0 'add (translate path)' ) insert ( 737 2617 0 'subtract (translate path)' ) insert ( 738 2617 0 'multiply (rotate/scale path)' ) insert ( 739 2617 0 'divide (rotate/scale path)' ) insert ( 755 2617 0 contains ) insert ( 756 2617 0 'is contained by' ) insert ( 757 2617 0 contains ) insert ( 758 2617 0 'is contained by' ) insert ( 759 2617 0 contains ) insert ( 773 2617 0 'absolute value' ) insert ( 792 2617 0 equal ) insert ( 793 2617 0 'less than' ) insert ( 794 2617 0 'greater than' ) insert ( 795 2617 0 'less than or equal' ) insert ( 796 2617 0 'greater than or equal' ) insert ( 797 2617 0 'number of points' ) insert ( 798 2617 0 intersect ) insert ( 799 2617 0 'sum of path segment lengths' ) insert ( 800 2617 0 'is above (allows touching)' ) insert ( 801 2617 0 'is below (allows touching)' ) insert ( 802 2617 0 'deprecated, use && instead' ) insert ( 803 2617 0 'box intersection' ) insert ( 804 2617 0 'add point to box (translate)' ) insert ( 805 2617 0 'subtract point from box (translate)' ) insert ( 806 2617 0 'multiply box by point (scale)' ) insert ( 807 2617 0 'divide box by point (scale)' ) insert ( 808 2617 0 'horizontally aligned' ) insert ( 809 2617 0 'vertically aligned' ) insert ( 843 2617 0 multiply ) insert ( 844 2617 0 divide ) insert ( 845 2617 0 multiply ) insert ( 900 2617 0 equal ) insert ( 901 2617 0 'not equal' ) insert ( 902 2617 0 'less than' ) insert ( 903 2617 0 'greater than' ) insert ( 904 2617 0 'less than or equal' ) insert ( 905 2617 0 'greater than or equal' ) insert ( 906 2617 0 add ) insert ( 907 2617 0 subtract ) insert ( 908 2617 0 multiply ) insert ( 909 2617 0 divide ) insert ( 3346 2617 0 multiply ) insert ( 3347 2617 0 divide ) insert ( 912 2617 0 multiply ) insert ( 913 2617 0 divide ) insert ( 914 2617 0 multiply ) insert ( 915 2617 0 divide ) insert ( 916 2617 0 multiply ) insert ( 3349 2617 0 multiply ) insert ( 917 2617 0 multiply ) insert ( 918 2617 0 multiply ) insert ( 3825 2617 0 divide ) insert ( 965 2617 0 exponentiation ) insert ( 966 2617 0 'add/update ACL item' ) insert ( 967 2617 0 'remove ACL item' ) insert ( 968 2617 0 contains ) insert ( 974 2617 0 equal ) insert ( 969 2617 0 'center of' ) insert ( 971 2617 0 'center of' ) insert ( 1054 2617 0 equal ) insert ( 1055 2617 0 'matches regular expression, case-sensitive' ) insert ( 1056 2617 0 'does not match regular expression, case-sensitive' ) insert ( 1057 2617 0 'not equal' ) insert ( 1058 2617 0 'less than' ) insert ( 1059 2617 0 'less than or equal' ) insert ( 1060 2617 0 'greater than' ) insert ( 1061 2617 0 'greater than or equal' ) insert ( 1070 2617 0 equal ) insert ( 1071 2617 0 'not equal' ) insert ( 1072 2617 0 'less than' ) insert ( 1073 2617 0 'greater than' ) insert ( 1074 2617 0 'less than or equal' ) insert ( 1075 2617 0 'greater than or equal' ) insert ( 1076 2617 0 add ) insert ( 1077 2617 0 subtract ) insert ( 1093 2617 0 equal ) insert ( 1094 2617 0 'not equal' ) insert ( 1095 2617 0 'less than' ) insert ( 1096 2617 0 'less than or equal' ) insert ( 1097 2617 0 'greater than' ) insert ( 1098 2617 0 'greater than or equal' ) insert ( 1099 2617 0 subtract ) insert ( 1100 2617 0 add ) insert ( 1101 2617 0 subtract ) insert ( 1108 2617 0 equal ) insert ( 1109 2617 0 'not equal' ) insert ( 1110 2617 0 'less than' ) insert ( 1111 2617 0 'less than or equal' ) insert ( 1112 2617 0 'greater than' ) insert ( 1113 2617 0 'greater than or equal' ) insert ( 1550 2617 0 equal ) insert ( 1551 2617 0 'not equal' ) insert ( 1552 2617 0 'less than' ) insert ( 1553 2617 0 'less than or equal' ) insert ( 1554 2617 0 'greater than' ) insert ( 1555 2617 0 'greater than or equal' ) insert ( 1116 2617 0 add ) insert ( 1117 2617 0 subtract ) insert ( 1118 2617 0 divide ) insert ( 1119 2617 0 multiply ) insert ( 1120 2617 0 equal ) insert ( 1121 2617 0 'not equal' ) insert ( 1122 2617 0 'less than' ) insert ( 1123 2617 0 'greater than' ) insert ( 1124 2617 0 'less than or equal' ) insert ( 1125 2617 0 'greater than or equal' ) insert ( 1126 2617 0 add ) insert ( 1127 2617 0 subtract ) insert ( 1128 2617 0 divide ) insert ( 1129 2617 0 multiply ) insert ( 1130 2617 0 equal ) insert ( 1131 2617 0 'not equal' ) insert ( 1132 2617 0 'less than' ) insert ( 1133 2617 0 'greater than' ) insert ( 1134 2617 0 'less than or equal' ) insert ( 1135 2617 0 'greater than or equal' ) insert ( 1207 2617 0 'matches LIKE expression' ) insert ( 1208 2617 0 'does not match LIKE expression' ) insert ( 1209 2617 0 'matches LIKE expression' ) insert ( 1210 2617 0 'does not match LIKE expression' ) insert ( 1211 2617 0 'matches LIKE expression' ) insert ( 1212 2617 0 'does not match LIKE expression' ) insert ( 1226 2617 0 'matches regular expression, case-insensitive' ) insert ( 1227 2617 0 'does not match regular expression, case-insensitive' ) insert ( 1228 2617 0 'matches regular expression, case-insensitive' ) insert ( 1229 2617 0 'does not match regular expression, case-insensitive' ) insert ( 1234 2617 0 'matches regular expression, case-insensitive' ) insert ( 1235 2617 0 'does not match regular expression, case-insensitive' ) insert ( 1320 2617 0 equal ) insert ( 1321 2617 0 'not equal' ) insert ( 1322 2617 0 'less than' ) insert ( 1323 2617 0 'less than or equal' ) insert ( 1324 2617 0 'greater than' ) insert ( 1325 2617 0 'greater than or equal' ) insert ( 1327 2617 0 add ) insert ( 1328 2617 0 subtract ) insert ( 1329 2617 0 subtract ) insert ( 1330 2617 0 equal ) insert ( 1331 2617 0 'not equal' ) insert ( 1332 2617 0 'less than' ) insert ( 1333 2617 0 'less than or equal' ) insert ( 1334 2617 0 'greater than' ) insert ( 1335 2617 0 'greater than or equal' ) insert ( 1336 2617 0 negate ) insert ( 1337 2617 0 add ) insert ( 1338 2617 0 subtract ) insert ( 1360 2617 0 'convert date and time to timestamp' ) insert ( 1361 2617 0 'convert date and time with time zone to timestamp with time zone' ) insert ( 1363 2617 0 'convert time and date to timestamp' ) insert ( 1366 2617 0 'convert time with time zone and date to timestamp with time zone' ) insert ( 1399 2617 0 subtract ) insert ( 1420 2617 0 'center of' ) insert ( 1500 2617 0 'equal by area' ) insert ( 1501 2617 0 'not equal by area' ) insert ( 1502 2617 0 'less than by area' ) insert ( 1503 2617 0 'greater than by area' ) insert ( 1504 2617 0 'less than or equal by area' ) insert ( 1505 2617 0 'greater than or equal by area' ) insert ( 1506 2617 0 'is left of' ) insert ( 1507 2617 0 'overlaps or is left of' ) insert ( 1508 2617 0 'overlaps or is right of' ) insert ( 1509 2617 0 'is right of' ) insert ( 1510 2617 0 'is contained by' ) insert ( 1511 2617 0 contains ) insert ( 1512 2617 0 'same as' ) insert ( 1513 2617 0 overlaps ) insert ( 1514 2617 0 'is above' ) insert ( 1515 2617 0 'is below' ) insert ( 1516 2617 0 add ) insert ( 1517 2617 0 subtract ) insert ( 1518 2617 0 multiply ) insert ( 1519 2617 0 divide ) insert ( 1520 2617 0 'distance between' ) insert ( 1521 2617 0 'number of points' ) insert ( 1522 2617 0 'distance between' ) insert ( 3291 2617 0 'distance between' ) insert ( 3276 2617 0 'distance between' ) insert ( 3289 2617 0 'distance between' ) insert ( 1523 2617 0 'distance between' ) insert ( 1383 2617 0 'distance between' ) insert ( 1525 2617 0 intersect ) insert ( 1526 2617 0 parallel ) insert ( 1527 2617 0 perpendicular ) insert ( 1528 2617 0 horizontal ) insert ( 1529 2617 0 vertical ) insert ( 1535 2617 0 equal ) insert ( 1536 2617 0 'intersection point' ) insert ( 1537 2617 0 intersect ) insert ( 1538 2617 0 intersect ) insert ( 1539 2617 0 intersect ) insert ( 1546 2617 0 'point on line' ) insert ( 1547 2617 0 'is contained by' ) insert ( 1548 2617 0 'lseg on line' ) insert ( 1549 2617 0 'is contained by' ) insert ( 1557 2617 0 'closest point to A on B' ) insert ( 1558 2617 0 'closest point to A on B' ) insert ( 1559 2617 0 'closest point to A on B' ) insert ( 1567 2617 0 'closest point to A on B' ) insert ( 1577 2617 0 'closest point to A on B' ) insert ( 1578 2617 0 'closest point to A on B' ) insert ( 1583 2617 0 multiply ) insert ( 1584 2617 0 multiply ) insert ( 1585 2617 0 divide ) insert ( 1586 2617 0 'not equal' ) insert ( 1587 2617 0 'less than by length' ) insert ( 1588 2617 0 'less than or equal by length' ) insert ( 1589 2617 0 'greater than by length' ) insert ( 1590 2617 0 'greater than or equal by length' ) insert ( 1591 2617 0 'distance between endpoints' ) insert ( 1611 2617 0 intersect ) insert ( 1612 2617 0 parallel ) insert ( 1613 2617 0 perpendicular ) insert ( 1614 2617 0 horizontal ) insert ( 1615 2617 0 vertical ) insert ( 1616 2617 0 equal ) insert ( 1617 2617 0 'intersection point' ) insert ( 4161 2617 0 'is above' ) insert ( 4162 2617 0 'is below' ) insert ( 1220 2617 0 equal ) insert ( 1221 2617 0 'not equal' ) insert ( 1222 2617 0 'less than' ) insert ( 1223 2617 0 'less than or equal' ) insert ( 1224 2617 0 'greater than' ) insert ( 1225 2617 0 'greater than or equal' ) insert ( 3147 2617 0 'bitwise not' ) insert ( 3148 2617 0 'bitwise and' ) insert ( 3149 2617 0 'bitwise or' ) insert ( 3362 2617 0 equal ) insert ( 3363 2617 0 'not equal' ) insert ( 3364 2617 0 'less than' ) insert ( 3365 2617 0 'less than or equal' ) insert ( 3366 2617 0 'greater than' ) insert ( 3367 2617 0 'greater than or equal' ) insert ( 3368 2617 0 'bitwise not' ) insert ( 3369 2617 0 'bitwise and' ) insert ( 3370 2617 0 'bitwise or' ) insert ( 1201 2617 0 equal ) insert ( 1202 2617 0 'not equal' ) insert ( 1203 2617 0 'less than' ) insert ( 1204 2617 0 'less than or equal' ) insert ( 1205 2617 0 'greater than' ) insert ( 1206 2617 0 'greater than or equal' ) insert ( 931 2617 0 'is subnet' ) insert ( 932 2617 0 'is subnet or equal' ) insert ( 933 2617 0 'is supernet' ) insert ( 934 2617 0 'is supernet or equal' ) insert ( 3552 2617 0 'overlaps (is subnet or supernet)' ) insert ( 2634 2617 0 'bitwise not' ) insert ( 2635 2617 0 'bitwise and' ) insert ( 2636 2617 0 'bitwise or' ) insert ( 2637 2617 0 add ) insert ( 2638 2617 0 add ) insert ( 2639 2617 0 subtract ) insert ( 2640 2617 0 subtract ) insert ( 1625 2617 0 'matches LIKE expression, case-insensitive' ) insert ( 1626 2617 0 'does not match LIKE expression, case-insensitive' ) insert ( 1627 2617 0 'matches LIKE expression, case-insensitive' ) insert ( 1628 2617 0 'does not match LIKE expression, case-insensitive' ) insert ( 1629 2617 0 'matches LIKE expression, case-insensitive' ) insert ( 1630 2617 0 'does not match LIKE expression, case-insensitive' ) insert ( 1751 2617 0 negate ) insert ( 1752 2617 0 equal ) insert ( 1753 2617 0 'not equal' ) insert ( 1754 2617 0 'less than' ) insert ( 1755 2617 0 'less than or equal' ) insert ( 1756 2617 0 'greater than' ) insert ( 1757 2617 0 'greater than or equal' ) insert ( 1758 2617 0 add ) insert ( 1759 2617 0 subtract ) insert ( 1760 2617 0 multiply ) insert ( 1761 2617 0 divide ) insert ( 1762 2617 0 modulus ) insert ( 1038 2617 0 exponentiation ) insert ( 1763 2617 0 'absolute value' ) insert ( 1784 2617 0 equal ) insert ( 1785 2617 0 'not equal' ) insert ( 1786 2617 0 'less than' ) insert ( 1787 2617 0 'greater than' ) insert ( 1788 2617 0 'less than or equal' ) insert ( 1789 2617 0 'greater than or equal' ) insert ( 1791 2617 0 'bitwise and' ) insert ( 1792 2617 0 'bitwise or' ) insert ( 1793 2617 0 'bitwise exclusive or' ) insert ( 1794 2617 0 'bitwise not' ) insert ( 1795 2617 0 'bitwise shift left' ) insert ( 1796 2617 0 'bitwise shift right' ) insert ( 1797 2617 0 concatenate ) insert ( 1800 2617 0 add ) insert ( 1801 2617 0 subtract ) insert ( 1802 2617 0 add ) insert ( 1803 2617 0 subtract ) insert ( 1804 2617 0 equal ) insert ( 1805 2617 0 'not equal' ) insert ( 1806 2617 0 'less than' ) insert ( 1807 2617 0 'greater than' ) insert ( 1808 2617 0 'less than or equal' ) insert ( 1809 2617 0 'greater than or equal' ) insert ( 1849 2617 0 add ) insert ( 1862 2617 0 equal ) insert ( 1863 2617 0 'not equal' ) insert ( 1864 2617 0 'less than' ) insert ( 1865 2617 0 'greater than' ) insert ( 1866 2617 0 'less than or equal' ) insert ( 1867 2617 0 'greater than or equal' ) insert ( 1868 2617 0 equal ) insert ( 1869 2617 0 'not equal' ) insert ( 1870 2617 0 'less than' ) insert ( 1871 2617 0 'greater than' ) insert ( 1872 2617 0 'less than or equal' ) insert ( 1873 2617 0 'greater than or equal' ) insert ( 1874 2617 0 'bitwise and' ) insert ( 1875 2617 0 'bitwise or' ) insert ( 1876 2617 0 'bitwise exclusive or' ) insert ( 1877 2617 0 'bitwise not' ) insert ( 1878 2617 0 'bitwise shift left' ) insert ( 1879 2617 0 'bitwise shift right' ) insert ( 1880 2617 0 'bitwise and' ) insert ( 1881 2617 0 'bitwise or' ) insert ( 1882 2617 0 'bitwise exclusive or' ) insert ( 1883 2617 0 'bitwise not' ) insert ( 1884 2617 0 'bitwise shift left' ) insert ( 1885 2617 0 'bitwise shift right' ) insert ( 1886 2617 0 'bitwise and' ) insert ( 1887 2617 0 'bitwise or' ) insert ( 1888 2617 0 'bitwise exclusive or' ) insert ( 1889 2617 0 'bitwise not' ) insert ( 1890 2617 0 'bitwise shift left' ) insert ( 1891 2617 0 'bitwise shift right' ) insert ( 1916 2617 0 'unary plus' ) insert ( 1917 2617 0 'unary plus' ) insert ( 1918 2617 0 'unary plus' ) insert ( 1919 2617 0 'unary plus' ) insert ( 1920 2617 0 'unary plus' ) insert ( 1921 2617 0 'unary plus' ) insert ( 1955 2617 0 equal ) insert ( 1956 2617 0 'not equal' ) insert ( 1957 2617 0 'less than' ) insert ( 1958 2617 0 'less than or equal' ) insert ( 1959 2617 0 'greater than' ) insert ( 1960 2617 0 'greater than or equal' ) insert ( 2016 2617 0 'matches LIKE expression' ) insert ( 2017 2617 0 'does not match LIKE expression' ) insert ( 2018 2617 0 concatenate ) insert ( 2060 2617 0 equal ) insert ( 2061 2617 0 'not equal' ) insert ( 2062 2617 0 'less than' ) insert ( 2063 2617 0 'less than or equal' ) insert ( 2064 2617 0 'greater than' ) insert ( 2065 2617 0 'greater than or equal' ) insert ( 2066 2617 0 add ) insert ( 2067 2617 0 subtract ) insert ( 2068 2617 0 subtract ) insert ( 2314 2617 0 'less than' ) insert ( 2315 2617 0 'less than or equal' ) insert ( 2317 2617 0 'greater than or equal' ) insert ( 2318 2617 0 'greater than' ) insert ( 2326 2617 0 'less than' ) insert ( 2327 2617 0 'less than or equal' ) insert ( 2329 2617 0 'greater than or equal' ) insert ( 2330 2617 0 'greater than' ) insert ( 2345 2617 0 'less than' ) insert ( 2346 2617 0 'less than or equal' ) insert ( 2347 2617 0 equal ) insert ( 2348 2617 0 'greater than or equal' ) insert ( 2349 2617 0 'greater than' ) insert ( 2350 2617 0 'not equal' ) insert ( 2358 2617 0 'less than' ) insert ( 2359 2617 0 'less than or equal' ) insert ( 2360 2617 0 equal ) insert ( 2361 2617 0 'greater than or equal' ) insert ( 2362 2617 0 'greater than' ) insert ( 2363 2617 0 'not equal' ) insert ( 2371 2617 0 'less than' ) insert ( 2372 2617 0 'less than or equal' ) insert ( 2373 2617 0 equal ) insert ( 2374 2617 0 'greater than or equal' ) insert ( 2375 2617 0 'greater than' ) insert ( 2376 2617 0 'not equal' ) insert ( 2384 2617 0 'less than' ) insert ( 2385 2617 0 'less than or equal' ) insert ( 2386 2617 0 equal ) insert ( 2387 2617 0 'greater than or equal' ) insert ( 2388 2617 0 'greater than' ) insert ( 2389 2617 0 'not equal' ) insert ( 2534 2617 0 'less than' ) insert ( 2535 2617 0 'less than or equal' ) insert ( 2536 2617 0 equal ) insert ( 2537 2617 0 'greater than or equal' ) insert ( 2538 2617 0 'greater than' ) insert ( 2539 2617 0 'not equal' ) insert ( 2540 2617 0 'less than' ) insert ( 2541 2617 0 'less than or equal' ) insert ( 2542 2617 0 equal ) insert ( 2543 2617 0 'greater than or equal' ) insert ( 2544 2617 0 'greater than' ) insert ( 2545 2617 0 'not equal' ) insert ( 2551 2617 0 add ) insert ( 2552 2617 0 add ) insert ( 2553 2617 0 add ) insert ( 2554 2617 0 add ) insert ( 2555 2617 0 add ) insert ( 2570 2617 0 'is below' ) insert ( 2571 2617 0 'overlaps or is below' ) insert ( 2572 2617 0 'overlaps or is above' ) insert ( 2573 2617 0 'is above' ) insert ( 2574 2617 0 'is below' ) insert ( 2575 2617 0 'overlaps or is below' ) insert ( 2576 2617 0 'overlaps or is above' ) insert ( 2577 2617 0 'is above' ) insert ( 2589 2617 0 'overlaps or is below' ) insert ( 2590 2617 0 'overlaps or is above' ) insert ( 2750 2617 0 overlaps ) insert ( 2751 2617 0 contains ) insert ( 2752 2617 0 'is contained by' ) insert ( 2779 2617 0 concatenate ) insert ( 2780 2617 0 concatenate ) insert ( 2972 2617 0 equal ) insert ( 2973 2617 0 'not equal' ) insert ( 2974 2617 0 'less than' ) insert ( 2975 2617 0 'greater than' ) insert ( 2976 2617 0 'less than or equal' ) insert ( 2977 2617 0 'greater than or equal' ) insert ( 3222 2617 0 equal ) insert ( 3223 2617 0 'not equal' ) insert ( 3224 2617 0 'less than' ) insert ( 3225 2617 0 'greater than' ) insert ( 3226 2617 0 'less than or equal' ) insert ( 3227 2617 0 'greater than or equal' ) insert ( 3228 2617 0 minus ) insert ( 5025 2617 0 add ) insert ( 5026 2617 0 add ) insert ( 5027 2617 0 subtract ) insert ( 3516 2617 0 equal ) insert ( 3517 2617 0 'not equal' ) insert ( 3518 2617 0 'less than' ) insert ( 3519 2617 0 'greater than' ) insert ( 3520 2617 0 'less than or equal' ) insert ( 3521 2617 0 'greater than or equal' ) insert ( 3627 2617 0 'less than' ) insert ( 3628 2617 0 'less than or equal' ) insert ( 3629 2617 0 equal ) insert ( 3630 2617 0 'not equal' ) insert ( 3631 2617 0 'greater than or equal' ) insert ( 3632 2617 0 'greater than' ) insert ( 3633 2617 0 concatenate ) insert ( 3636 2617 0 'text search match' ) insert ( 3637 2617 0 'text search match' ) insert ( 3660 2617 0 'deprecated, use @@ instead' ) insert ( 3661 2617 0 'deprecated, use @@ instead' ) insert ( 3674 2617 0 'less than' ) insert ( 3675 2617 0 'less than or equal' ) insert ( 3676 2617 0 equal ) insert ( 3677 2617 0 'not equal' ) insert ( 3678 2617 0 'greater than or equal' ) insert ( 3679 2617 0 'greater than' ) insert ( 3680 2617 0 AND-concatenate ) insert ( 3681 2617 0 OR-concatenate ) insert ( 5005 2617 0 phrase-concatenate ) insert ( 3682 2617 0 'NOT tsquery' ) insert ( 3693 2617 0 contains ) insert ( 3694 2617 0 'is contained by' ) insert ( 3762 2617 0 'text search match' ) insert ( 3763 2617 0 'text search match' ) insert ( 2988 2617 0 equal ) insert ( 2989 2617 0 'not equal' ) insert ( 2990 2617 0 'less than' ) insert ( 2991 2617 0 'greater than' ) insert ( 2992 2617 0 'less than or equal' ) insert ( 2993 2617 0 'greater than or equal' ) insert ( 3188 2617 0 identical ) insert ( 3189 2617 0 'not identical' ) insert ( 3190 2617 0 'less than' ) insert ( 3191 2617 0 'greater than' ) insert ( 3192 2617 0 'less than or equal' ) insert ( 3193 2617 0 'greater than or equal' ) insert ( 3882 2617 0 equal ) insert ( 3883 2617 0 'not equal' ) insert ( 3884 2617 0 'less than' ) insert ( 3885 2617 0 'less than or equal' ) insert ( 3886 2617 0 'greater than or equal' ) insert ( 3887 2617 0 'greater than' ) insert ( 3888 2617 0 overlaps ) insert ( 3889 2617 0 contains ) insert ( 3890 2617 0 contains ) insert ( 3891 2617 0 'is contained by' ) insert ( 3892 2617 0 'is contained by' ) insert ( 3893 2617 0 'is left of' ) insert ( 3894 2617 0 'is right of' ) insert ( 3895 2617 0 'overlaps or is left of' ) insert ( 3896 2617 0 'overlaps or is right of' ) insert ( 3897 2617 0 'is adjacent to' ) insert ( 3898 2617 0 'range union' ) insert ( 3899 2617 0 'range difference' ) insert ( 3900 2617 0 'range intersection' ) insert ( 3962 2617 0 'get json object field' ) insert ( 3963 2617 0 'get json object field as text' ) insert ( 3964 2617 0 'get json array element' ) insert ( 3965 2617 0 'get json array element as text' ) insert ( 3966 2617 0 'get value from json with path elements' ) insert ( 3967 2617 0 'get value from json as text with path elements' ) insert ( 3211 2617 0 'get jsonb object field' ) insert ( 3477 2617 0 'get jsonb object field as text' ) insert ( 3212 2617 0 'get jsonb array element' ) insert ( 3481 2617 0 'get jsonb array element as text' ) insert ( 3213 2617 0 'get value from jsonb with path elements' ) insert ( 3206 2617 0 'get value from jsonb as text with path elements' ) insert ( 3240 2617 0 equal ) insert ( 3241 2617 0 'not equal' ) insert ( 3242 2617 0 'less than' ) insert ( 3243 2617 0 'greater than' ) insert ( 3244 2617 0 'less than or equal' ) insert ( 3245 2617 0 'greater than or equal' ) insert ( 3246 2617 0 contains ) insert ( 3247 2617 0 'key exists' ) insert ( 3248 2617 0 'any key exists' ) insert ( 3249 2617 0 'all keys exist' ) insert ( 3250 2617 0 'is contained by' ) insert ( 3284 2617 0 concatenate ) insert ( 3285 2617 0 'delete object field' ) insert ( 3398 2617 0 'delete object fields' ) insert ( 3286 2617 0 'delete array element' ) insert ( 3287 2617 0 'delete path' ) insert ( 4012 2617 0 'jsonpath exists' ) insert ( 4013 2617 0 'jsonpath match' ) insert ( 2860 2617 0 equal ) insert ( 2861 2617 0 'not equal' ) insert ( 2862 2617 0 'less than' ) insert ( 2863 2617 0 'less than or equal' ) insert ( 2864 2617 0 'greater than or equal' ) insert ( 2865 2617 0 'greater than' ) insert ( 2866 2617 0 overlaps ) insert ( 2867 2617 0 overlaps ) insert ( 2868 2617 0 overlaps ) insert ( 2869 2617 0 contains ) insert ( 2870 2617 0 contains ) insert ( 2871 2617 0 contains ) insert ( 2872 2617 0 'is contained by' ) insert ( 2873 2617 0 'is contained by' ) insert ( 2874 2617 0 'is contained by' ) insert ( 4539 2617 0 contains ) insert ( 4540 2617 0 'is contained by' ) insert ( 2875 2617 0 'overlaps or is left of' ) insert ( 2876 2617 0 'overlaps or is left of' ) insert ( 2877 2617 0 'overlaps or is left of' ) insert ( 3585 2617 0 'overlaps or is right of' ) insert ( 4035 2617 0 'overlaps or is right of' ) insert ( 4142 2617 0 'overlaps or is right of' ) insert ( 4179 2617 0 'is adjacent to' ) insert ( 4180 2617 0 'is adjacent to' ) insert ( 4198 2617 0 'is adjacent to' ) insert ( 4392 2617 0 'multirange union' ) insert ( 4393 2617 0 'multirange minus' ) insert ( 4394 2617 0 'multirange intersect' ) insert ( 4395 2617 0 'is left of' ) insert ( 4396 2617 0 'is left of' ) insert ( 4397 2617 0 'is left of' ) insert ( 4398 2617 0 'is right of' ) insert ( 4399 2617 0 'is right of' ) insert ( 4400 2617 0 'is right of' ) insert ( 2 2601 0 'heap table access method' ) insert ( 403 2601 0 'b-tree index access method' ) insert ( 405 2601 0 'hash index access method' ) insert ( 783 2601 0 'GiST index access method' ) insert ( 2742 2601 0 'GIN index access method' ) insert ( 4000 2601 0 'SP-GiST index access method' ) insert ( 3580 2601 0 'block range index (BRIN) access method' ) insert ( 12 2612 0 'built-in functions' ) insert ( 13 2612 0 'dynamically-loaded C functions' ) insert ( 14 2612 0 'SQL-language functions' ) insert ( 11 2615 0 'system catalog schema' ) insert ( 99 2615 0 'reserved schema for TOAST tables' ) insert ( 2200 2615 0 'standard public schema' ) insert ( 4402 2607 0 'conversion for KOI8R to MULE_INTERNAL' ) insert ( 4403 2607 0 'conversion for MULE_INTERNAL to KOI8R' ) insert ( 4404 2607 0 'conversion for ISO-8859-5 to MULE_INTERNAL' ) insert ( 4405 2607 0 'conversion for MULE_INTERNAL to ISO-8859-5' ) insert ( 4406 2607 0 'conversion for WIN1251 to MULE_INTERNAL' ) insert ( 4407 2607 0 'conversion for MULE_INTERNAL to WIN1251' ) insert ( 4408 2607 0 'conversion for WIN866 to MULE_INTERNAL' ) insert ( 4409 2607 0 'conversion for MULE_INTERNAL to WIN866' ) insert ( 4410 2607 0 'conversion for KOI8R to WIN1251' ) insert ( 4411 2607 0 'conversion for WIN1251 to KOI8R' ) insert ( 4412 2607 0 'conversion for KOI8R to WIN866' ) insert ( 4413 2607 0 'conversion for WIN866 to KOI8R' ) insert ( 4414 2607 0 'conversion for WIN866 to WIN1251' ) insert ( 4415 2607 0 'conversion for WIN1251 to WIN866' ) insert ( 4416 2607 0 'conversion for ISO-8859-5 to KOI8R' ) insert ( 4417 2607 0 'conversion for KOI8R to ISO-8859-5' ) insert ( 4418 2607 0 'conversion for ISO-8859-5 to WIN1251' ) insert ( 4419 2607 0 'conversion for WIN1251 to ISO-8859-5' ) insert ( 4420 2607 0 'conversion for ISO-8859-5 to WIN866' ) insert ( 4421 2607 0 'conversion for WIN866 to ISO-8859-5' ) insert ( 4422 2607 0 'conversion for EUC_CN to MULE_INTERNAL' ) insert ( 4423 2607 0 'conversion for MULE_INTERNAL to EUC_CN' ) insert ( 4424 2607 0 'conversion for EUC_JP to SJIS' ) insert ( 4425 2607 0 'conversion for SJIS to EUC_JP' ) insert ( 4426 2607 0 'conversion for EUC_JP to MULE_INTERNAL' ) insert ( 4427 2607 0 'conversion for SJIS to MULE_INTERNAL' ) insert ( 4428 2607 0 'conversion for MULE_INTERNAL to EUC_JP' ) insert ( 4429 2607 0 'conversion for MULE_INTERNAL to SJIS' ) insert ( 4430 2607 0 'conversion for EUC_KR to MULE_INTERNAL' ) insert ( 4431 2607 0 'conversion for MULE_INTERNAL to EUC_KR' ) insert ( 4432 2607 0 'conversion for EUC_TW to BIG5' ) insert ( 4433 2607 0 'conversion for BIG5 to EUC_TW' ) insert ( 4434 2607 0 'conversion for EUC_TW to MULE_INTERNAL' ) insert ( 4435 2607 0 'conversion for BIG5 to MULE_INTERNAL' ) insert ( 4436 2607 0 'conversion for MULE_INTERNAL to EUC_TW' ) insert ( 4437 2607 0 'conversion for MULE_INTERNAL to BIG5' ) insert ( 4438 2607 0 'conversion for LATIN2 to MULE_INTERNAL' ) insert ( 4439 2607 0 'conversion for MULE_INTERNAL to LATIN2' ) insert ( 4440 2607 0 'conversion for WIN1250 to MULE_INTERNAL' ) insert ( 4441 2607 0 'conversion for MULE_INTERNAL to WIN1250' ) insert ( 4442 2607 0 'conversion for LATIN2 to WIN1250' ) insert ( 4443 2607 0 'conversion for WIN1250 to LATIN2' ) insert ( 4444 2607 0 'conversion for LATIN1 to MULE_INTERNAL' ) insert ( 4445 2607 0 'conversion for MULE_INTERNAL to LATIN1' ) insert ( 4446 2607 0 'conversion for LATIN3 to MULE_INTERNAL' ) insert ( 4447 2607 0 'conversion for MULE_INTERNAL to LATIN3' ) insert ( 4448 2607 0 'conversion for LATIN4 to MULE_INTERNAL' ) insert ( 4449 2607 0 'conversion for MULE_INTERNAL to LATIN4' ) insert ( 4452 2607 0 'conversion for BIG5 to UTF8' ) insert ( 4453 2607 0 'conversion for UTF8 to BIG5' ) insert ( 4454 2607 0 'conversion for UTF8 to KOI8R' ) insert ( 4455 2607 0 'conversion for KOI8R to UTF8' ) insert ( 4456 2607 0 'conversion for UTF8 to KOI8U' ) insert ( 4457 2607 0 'conversion for KOI8U to UTF8' ) insert ( 4458 2607 0 'conversion for UTF8 to WIN866' ) insert ( 4459 2607 0 'conversion for WIN866 to UTF8' ) insert ( 4460 2607 0 'conversion for UTF8 to WIN874' ) insert ( 4461 2607 0 'conversion for WIN874 to UTF8' ) insert ( 4462 2607 0 'conversion for UTF8 to WIN1250' ) insert ( 4463 2607 0 'conversion for WIN1250 to UTF8' ) insert ( 4464 2607 0 'conversion for UTF8 to WIN1251' ) insert ( 4465 2607 0 'conversion for WIN1251 to UTF8' ) insert ( 4466 2607 0 'conversion for UTF8 to WIN1252' ) insert ( 4467 2607 0 'conversion for WIN1252 to UTF8' ) insert ( 4468 2607 0 'conversion for UTF8 to WIN1253' ) insert ( 4469 2607 0 'conversion for WIN1253 to UTF8' ) insert ( 4470 2607 0 'conversion for UTF8 to WIN1254' ) insert ( 4471 2607 0 'conversion for WIN1254 to UTF8' ) insert ( 4472 2607 0 'conversion for UTF8 to WIN1255' ) insert ( 4473 2607 0 'conversion for WIN1255 to UTF8' ) insert ( 4474 2607 0 'conversion for UTF8 to WIN1256' ) insert ( 4475 2607 0 'conversion for WIN1256 to UTF8' ) insert ( 4476 2607 0 'conversion for UTF8 to WIN1257' ) insert ( 4477 2607 0 'conversion for WIN1257 to UTF8' ) insert ( 4478 2607 0 'conversion for UTF8 to WIN1258' ) insert ( 4479 2607 0 'conversion for WIN1258 to UTF8' ) insert ( 4480 2607 0 'conversion for EUC_CN to UTF8' ) insert ( 4481 2607 0 'conversion for UTF8 to EUC_CN' ) insert ( 4482 2607 0 'conversion for EUC_JP to UTF8' ) insert ( 4483 2607 0 'conversion for UTF8 to EUC_JP' ) insert ( 4484 2607 0 'conversion for EUC_KR to UTF8' ) insert ( 4485 2607 0 'conversion for UTF8 to EUC_KR' ) insert ( 4486 2607 0 'conversion for EUC_TW to UTF8' ) insert ( 4487 2607 0 'conversion for UTF8 to EUC_TW' ) insert ( 4488 2607 0 'conversion for GB18030 to UTF8' ) insert ( 4489 2607 0 'conversion for UTF8 to GB18030' ) insert ( 4490 2607 0 'conversion for GBK to UTF8' ) insert ( 4491 2607 0 'conversion for UTF8 to GBK' ) insert ( 4492 2607 0 'conversion for UTF8 to LATIN2' ) insert ( 4493 2607 0 'conversion for LATIN2 to UTF8' ) insert ( 4494 2607 0 'conversion for UTF8 to LATIN3' ) insert ( 4495 2607 0 'conversion for LATIN3 to UTF8' ) insert ( 4496 2607 0 'conversion for UTF8 to LATIN4' ) insert ( 4497 2607 0 'conversion for LATIN4 to UTF8' ) insert ( 4498 2607 0 'conversion for UTF8 to LATIN5' ) insert ( 4499 2607 0 'conversion for LATIN5 to UTF8' ) insert ( 4500 2607 0 'conversion for UTF8 to LATIN6' ) insert ( 4501 2607 0 'conversion for LATIN6 to UTF8' ) insert ( 4502 2607 0 'conversion for UTF8 to LATIN7' ) insert ( 4503 2607 0 'conversion for LATIN7 to UTF8' ) insert ( 4504 2607 0 'conversion for UTF8 to LATIN8' ) insert ( 4505 2607 0 'conversion for LATIN8 to UTF8' ) insert ( 4506 2607 0 'conversion for UTF8 to LATIN9' ) insert ( 4507 2607 0 'conversion for LATIN9 to UTF8' ) insert ( 4508 2607 0 'conversion for UTF8 to LATIN10' ) insert ( 4509 2607 0 'conversion for LATIN10 to UTF8' ) insert ( 4510 2607 0 'conversion for UTF8 to ISO-8859-5' ) insert ( 4511 2607 0 'conversion for ISO-8859-5 to UTF8' ) insert ( 4512 2607 0 'conversion for UTF8 to ISO-8859-6' ) insert ( 4513 2607 0 'conversion for ISO-8859-6 to UTF8' ) insert ( 4514 2607 0 'conversion for UTF8 to ISO-8859-7' ) insert ( 4515 2607 0 'conversion for ISO-8859-7 to UTF8' ) insert ( 4516 2607 0 'conversion for UTF8 to ISO-8859-8' ) insert ( 4517 2607 0 'conversion for ISO-8859-8 to UTF8' ) insert ( 4518 2607 0 'conversion for LATIN1 to UTF8' ) insert ( 4519 2607 0 'conversion for UTF8 to LATIN1' ) insert ( 4520 2607 0 'conversion for JOHAB to UTF8' ) insert ( 4521 2607 0 'conversion for UTF8 to JOHAB' ) insert ( 4522 2607 0 'conversion for SJIS to UTF8' ) insert ( 4523 2607 0 'conversion for UTF8 to SJIS' ) insert ( 4524 2607 0 'conversion for UHC to UTF8' ) insert ( 4525 2607 0 'conversion for UTF8 to UHC' ) insert ( 4526 2607 0 'conversion for EUC_JIS_2004 to UTF8' ) insert ( 4527 2607 0 'conversion for UTF8 to EUC_JIS_2004' ) insert ( 4528 2607 0 'conversion for SHIFT_JIS_2004 to UTF8' ) insert ( 4529 2607 0 'conversion for UTF8 to SHIFT_JIS_2004' ) insert ( 4530 2607 0 'conversion for EUC_JIS_2004 to SHIFT_JIS_2004' ) insert ( 4531 2607 0 'conversion for SHIFT_JIS_2004 to EUC_JIS_2004' ) insert ( 3748 3602 0 'simple configuration' ) insert ( 3765 3600 0 'simple dictionary: just lower case and check for stopword' ) insert ( 3722 3601 0 'default word parser' ) insert ( 3727 3764 0 'simple dictionary: just lower case and check for stopword' ) insert ( 3730 3764 0 'synonym dictionary: replace word by its synonym' ) insert ( 3733 3764 0 'ispell dictionary' ) insert ( 3742 3764 0 'thesaurus dictionary: phrase by phrase substitution' ) insert ( 100 3456 0 'database''s default collation' ) insert ( 950 3456 0 'standard C collation' ) insert ( 951 3456 0 'standard POSIX collation' ) insert ( 962 3456 0 'sorts by Unicode code point, C character semantics' ) insert ( 963 3456 0 'sorts using the Unicode Collation Algorithm with default settings' ) insert ( 811 3456 0 'sorts by Unicode code point; Unicode and POSIX character semantics' ) close pg_description create pg_cast 2605 ( oid = oid , castsource = oid , casttarget = oid , castfunc = oid , castcontext = char , castmethod = char ) open pg_cast insert ( 10000 20 21 714 a f ) insert ( 10001 20 23 480 a f ) insert ( 10002 20 700 652 i f ) insert ( 10003 20 701 482 i f ) insert ( 10004 20 1700 1781 i f ) insert ( 10005 21 20 754 i f ) insert ( 10006 21 23 313 i f ) insert ( 10007 21 700 236 i f ) insert ( 10008 21 701 235 i f ) insert ( 10009 21 1700 1782 i f ) insert ( 10010 23 20 481 i f ) insert ( 10011 23 21 314 a f ) insert ( 10012 23 700 318 i f ) insert ( 10013 23 701 316 i f ) insert ( 10014 23 1700 1740 i f ) insert ( 10015 700 20 653 a f ) insert ( 10016 700 21 238 a f ) insert ( 10017 700 23 319 a f ) insert ( 10018 700 701 311 i f ) insert ( 10019 700 1700 1742 a f ) insert ( 10020 701 20 483 a f ) insert ( 10021 701 21 237 a f ) insert ( 10022 701 23 317 a f ) insert ( 10023 701 700 312 a f ) insert ( 10024 701 1700 1743 a f ) insert ( 10025 1700 20 1779 a f ) insert ( 10026 1700 21 1783 a f ) insert ( 10027 1700 23 1744 a f ) insert ( 10028 1700 700 1745 i f ) insert ( 10029 1700 701 1746 i f ) insert ( 10030 790 1700 3823 a f ) insert ( 10031 1700 790 3824 a f ) insert ( 10032 23 790 3811 a f ) insert ( 10033 20 790 3812 a f ) insert ( 10034 23 16 2557 e f ) insert ( 10035 16 23 2558 e f ) insert ( 10036 5069 28 5071 e f ) insert ( 10037 20 26 1287 i f ) insert ( 10038 21 26 313 i f ) insert ( 10039 23 26 0 i b ) insert ( 10040 26 20 1288 a f ) insert ( 10041 26 23 0 a b ) insert ( 10042 26 24 0 i b ) insert ( 10043 24 26 0 i b ) insert ( 10044 20 24 1287 i f ) insert ( 10045 21 24 313 i f ) insert ( 10046 23 24 0 i b ) insert ( 10047 24 20 1288 a f ) insert ( 10048 24 23 0 a b ) insert ( 10049 24 2202 0 i b ) insert ( 10050 2202 24 0 i b ) insert ( 10051 26 2202 0 i b ) insert ( 10052 2202 26 0 i b ) insert ( 10053 20 2202 1287 i f ) insert ( 10054 21 2202 313 i f ) insert ( 10055 23 2202 0 i b ) insert ( 10056 2202 20 1288 a f ) insert ( 10057 2202 23 0 a b ) insert ( 10058 26 2203 0 i b ) insert ( 10059 2203 26 0 i b ) insert ( 10060 20 2203 1287 i f ) insert ( 10061 21 2203 313 i f ) insert ( 10062 23 2203 0 i b ) insert ( 10063 2203 20 1288 a f ) insert ( 10064 2203 23 0 a b ) insert ( 10065 2203 2204 0 i b ) insert ( 10066 2204 2203 0 i b ) insert ( 10067 26 2204 0 i b ) insert ( 10068 2204 26 0 i b ) insert ( 10069 20 2204 1287 i f ) insert ( 10070 21 2204 313 i f ) insert ( 10071 23 2204 0 i b ) insert ( 10072 2204 20 1288 a f ) insert ( 10073 2204 23 0 a b ) insert ( 10074 26 2205 0 i b ) insert ( 10075 2205 26 0 i b ) insert ( 10076 20 2205 1287 i f ) insert ( 10077 21 2205 313 i f ) insert ( 10078 23 2205 0 i b ) insert ( 10079 2205 20 1288 a f ) insert ( 10080 2205 23 0 a b ) insert ( 10081 26 4191 0 i b ) insert ( 10082 4191 26 0 i b ) insert ( 10083 20 4191 1287 i f ) insert ( 10084 21 4191 313 i f ) insert ( 10085 23 4191 0 i b ) insert ( 10086 4191 20 1288 a f ) insert ( 10087 4191 23 0 a b ) insert ( 10088 26 2206 0 i b ) insert ( 10089 2206 26 0 i b ) insert ( 10090 20 2206 1287 i f ) insert ( 10091 21 2206 313 i f ) insert ( 10092 23 2206 0 i b ) insert ( 10093 2206 20 1288 a f ) insert ( 10094 2206 23 0 a b ) insert ( 10095 26 3734 0 i b ) insert ( 10096 3734 26 0 i b ) insert ( 10097 20 3734 1287 i f ) insert ( 10098 21 3734 313 i f ) insert ( 10099 23 3734 0 i b ) insert ( 10100 3734 20 1288 a f ) insert ( 10101 3734 23 0 a b ) insert ( 10102 26 3769 0 i b ) insert ( 10103 3769 26 0 i b ) insert ( 10104 20 3769 1287 i f ) insert ( 10105 21 3769 313 i f ) insert ( 10106 23 3769 0 i b ) insert ( 10107 3769 20 1288 a f ) insert ( 10108 3769 23 0 a b ) insert ( 10109 25 2205 1079 i f ) insert ( 10110 1043 2205 1079 i f ) insert ( 10111 26 4096 0 i b ) insert ( 10112 4096 26 0 i b ) insert ( 10113 20 4096 1287 i f ) insert ( 10114 21 4096 313 i f ) insert ( 10115 23 4096 0 i b ) insert ( 10116 4096 20 1288 a f ) insert ( 10117 4096 23 0 a b ) insert ( 10118 26 4089 0 i b ) insert ( 10119 4089 26 0 i b ) insert ( 10120 20 4089 1287 i f ) insert ( 10121 21 4089 313 i f ) insert ( 10122 23 4089 0 i b ) insert ( 10123 4089 20 1288 a f ) insert ( 10124 4089 23 0 a b ) insert ( 10125 25 1042 0 i b ) insert ( 10126 25 1043 0 i b ) insert ( 10127 1042 25 401 i f ) insert ( 10128 1042 1043 401 i f ) insert ( 10129 1043 25 0 i b ) insert ( 10130 1043 1042 0 i b ) insert ( 10131 18 25 946 i f ) insert ( 10132 18 1042 860 a f ) insert ( 10133 18 1043 946 a f ) insert ( 10134 19 25 406 i f ) insert ( 10135 19 1042 408 a f ) insert ( 10136 19 1043 1401 a f ) insert ( 10137 25 18 944 a f ) insert ( 10138 1042 18 944 a f ) insert ( 10139 1043 18 944 a f ) insert ( 10140 25 19 407 i f ) insert ( 10141 1042 19 409 i f ) insert ( 10142 1043 19 1400 i f ) insert ( 10143 18 23 77 e f ) insert ( 10144 23 18 78 e f ) insert ( 10145 194 25 0 i b ) insert ( 10146 3361 17 0 i b ) insert ( 10147 3361 25 0 i i ) insert ( 10148 3402 17 0 i b ) insert ( 10149 3402 25 0 i i ) insert ( 10150 5017 17 0 i b ) insert ( 10151 5017 25 0 i i ) insert ( 10152 1082 1114 2024 i f ) insert ( 10153 1082 1184 1174 i f ) insert ( 10154 1083 1186 1370 i f ) insert ( 10155 1083 1266 2047 i f ) insert ( 10156 1114 1082 2029 a f ) insert ( 10157 1114 1083 1316 a f ) insert ( 10158 1114 1184 2028 i f ) insert ( 10159 1184 1082 1178 a f ) insert ( 10160 1184 1083 2019 a f ) insert ( 10161 1184 1114 2027 a f ) insert ( 10162 1184 1266 1388 a f ) insert ( 10163 1186 1083 1419 a f ) insert ( 10164 1266 1083 2046 a f ) insert ( 10165 600 603 4091 a f ) insert ( 10166 601 600 1532 e f ) insert ( 10167 602 604 1449 a f ) insert ( 10168 603 600 1534 e f ) insert ( 10169 603 601 1541 e f ) insert ( 10170 603 604 1448 a f ) insert ( 10171 603 718 1479 e f ) insert ( 10172 604 600 1540 e f ) insert ( 10173 604 602 1447 a f ) insert ( 10174 604 603 1446 e f ) insert ( 10175 604 718 1474 e f ) insert ( 10176 718 600 1416 e f ) insert ( 10177 718 603 1480 e f ) insert ( 10178 718 604 1544 e f ) insert ( 10179 829 774 4123 i f ) insert ( 10180 774 829 4124 i f ) insert ( 10181 650 869 0 i b ) insert ( 10182 869 650 1715 a f ) insert ( 10183 1560 1562 0 i b ) insert ( 10184 1562 1560 0 i b ) insert ( 10185 20 1560 2075 e f ) insert ( 10186 23 1560 1683 e f ) insert ( 10187 1560 20 2076 e f ) insert ( 10188 1560 23 1684 e f ) insert ( 10189 650 25 730 a f ) insert ( 10190 869 25 730 a f ) insert ( 10191 16 25 2971 a f ) insert ( 10192 142 25 0 a b ) insert ( 10193 25 142 2896 e f ) insert ( 10194 650 1043 730 a f ) insert ( 10195 869 1043 730 a f ) insert ( 10196 16 1043 2971 a f ) insert ( 10197 142 1043 0 a b ) insert ( 10198 1043 142 2896 e f ) insert ( 10199 650 1042 730 a f ) insert ( 10200 869 1042 730 a f ) insert ( 10201 16 1042 2971 a f ) insert ( 10202 142 1042 0 a b ) insert ( 10203 1042 142 2896 e f ) insert ( 10204 1042 1042 668 i f ) insert ( 10205 1043 1043 669 i f ) insert ( 10206 1083 1083 1968 i f ) insert ( 10207 1114 1114 1961 i f ) insert ( 10208 1184 1184 1967 i f ) insert ( 10209 1186 1186 1200 i f ) insert ( 10210 1266 1266 1969 i f ) insert ( 10211 1560 1560 1685 i f ) insert ( 10212 1562 1562 1687 i f ) insert ( 10213 1700 1700 1703 i f ) insert ( 10214 114 3802 0 a i ) insert ( 10215 3802 114 0 a i ) insert ( 10216 3802 16 3556 e f ) insert ( 10217 3802 1700 3449 e f ) insert ( 10218 3802 21 3450 e f ) insert ( 10219 3802 23 3451 e f ) insert ( 10220 3802 20 3452 e f ) insert ( 10221 3802 700 3453 e f ) insert ( 10222 3802 701 2580 e f ) insert ( 10223 3904 4451 4281 e f ) insert ( 10224 3926 4536 4296 e f ) insert ( 10225 3906 4532 4284 e f ) insert ( 10226 3912 4535 4293 e f ) insert ( 10227 3908 4533 4287 e f ) insert ( 10228 3910 4534 4290 e f ) close pg_cast create pg_enum 3501 ( oid = oid , enumtypid = oid , enumsortorder = float4 , enumlabel = name ) open pg_enum close pg_enum create pg_namespace 2615 ( oid = oid , nspname = name , nspowner = oid , nspacl = _aclitem ) open pg_namespace insert ( 11 pg_catalog 10 _null_ ) insert ( 99 pg_toast 10 _null_ ) insert ( 2200 public 6171 _null_ ) close pg_namespace create pg_conversion 2607 ( oid = oid , conname = name , connamespace = oid , conowner = oid , conforencoding = int4 , contoencoding = int4 , conproc = regproc , condefault = bool ) open pg_conversion insert ( 4402 koi8_r_to_mic 11 10 22 7 4302 t ) insert ( 4403 mic_to_koi8_r 11 10 7 22 4303 t ) insert ( 4404 iso_8859_5_to_mic 11 10 25 7 4304 t ) insert ( 4405 mic_to_iso_8859_5 11 10 7 25 4305 t ) insert ( 4406 windows_1251_to_mic 11 10 23 7 4306 t ) insert ( 4407 mic_to_windows_1251 11 10 7 23 4307 t ) insert ( 4408 windows_866_to_mic 11 10 20 7 4308 t ) insert ( 4409 mic_to_windows_866 11 10 7 20 4309 t ) insert ( 4410 koi8_r_to_windows_1251 11 10 22 23 4310 t ) insert ( 4411 windows_1251_to_koi8_r 11 10 23 22 4311 t ) insert ( 4412 koi8_r_to_windows_866 11 10 22 20 4312 t ) insert ( 4413 windows_866_to_koi8_r 11 10 20 22 4313 t ) insert ( 4414 windows_866_to_windows_1251 11 10 20 23 4314 t ) insert ( 4415 windows_1251_to_windows_866 11 10 23 20 4315 t ) insert ( 4416 iso_8859_5_to_koi8_r 11 10 25 22 4316 t ) insert ( 4417 koi8_r_to_iso_8859_5 11 10 22 25 4317 t ) insert ( 4418 iso_8859_5_to_windows_1251 11 10 25 23 4318 t ) insert ( 4419 windows_1251_to_iso_8859_5 11 10 23 25 4319 t ) insert ( 4420 iso_8859_5_to_windows_866 11 10 25 20 4320 t ) insert ( 4421 windows_866_to_iso_8859_5 11 10 20 25 4321 t ) insert ( 4422 euc_cn_to_mic 11 10 2 7 4322 t ) insert ( 4423 mic_to_euc_cn 11 10 7 2 4323 t ) insert ( 4424 euc_jp_to_sjis 11 10 1 35 4324 t ) insert ( 4425 sjis_to_euc_jp 11 10 35 1 4325 t ) insert ( 4426 euc_jp_to_mic 11 10 1 7 4326 t ) insert ( 4427 sjis_to_mic 11 10 35 7 4327 t ) insert ( 4428 mic_to_euc_jp 11 10 7 1 4328 t ) insert ( 4429 mic_to_sjis 11 10 7 35 4329 t ) insert ( 4430 euc_kr_to_mic 11 10 3 7 4330 t ) insert ( 4431 mic_to_euc_kr 11 10 7 3 4331 t ) insert ( 4432 euc_tw_to_big5 11 10 4 36 4332 t ) insert ( 4433 big5_to_euc_tw 11 10 36 4 4333 t ) insert ( 4434 euc_tw_to_mic 11 10 4 7 4334 t ) insert ( 4435 big5_to_mic 11 10 36 7 4335 t ) insert ( 4436 mic_to_euc_tw 11 10 7 4 4336 t ) insert ( 4437 mic_to_big5 11 10 7 36 4337 t ) insert ( 4438 iso_8859_2_to_mic 11 10 9 7 4338 t ) insert ( 4439 mic_to_iso_8859_2 11 10 7 9 4339 t ) insert ( 4440 windows_1250_to_mic 11 10 29 7 4340 t ) insert ( 4441 mic_to_windows_1250 11 10 7 29 4341 t ) insert ( 4442 iso_8859_2_to_windows_1250 11 10 9 29 4342 t ) insert ( 4443 windows_1250_to_iso_8859_2 11 10 29 9 4343 t ) insert ( 4444 iso_8859_1_to_mic 11 10 8 7 4344 t ) insert ( 4445 mic_to_iso_8859_1 11 10 7 8 4345 t ) insert ( 4446 iso_8859_3_to_mic 11 10 10 7 4346 t ) insert ( 4447 mic_to_iso_8859_3 11 10 7 10 4347 t ) insert ( 4448 iso_8859_4_to_mic 11 10 11 7 4348 t ) insert ( 4449 mic_to_iso_8859_4 11 10 7 11 4349 t ) insert ( 4452 big5_to_utf8 11 10 36 6 4352 t ) insert ( 4453 utf8_to_big5 11 10 6 36 4353 t ) insert ( 4454 utf8_to_koi8_r 11 10 6 22 4354 t ) insert ( 4455 koi8_r_to_utf8 11 10 22 6 4355 t ) insert ( 4456 utf8_to_koi8_u 11 10 6 34 4356 t ) insert ( 4457 koi8_u_to_utf8 11 10 34 6 4357 t ) insert ( 4458 utf8_to_windows_866 11 10 6 20 4358 t ) insert ( 4459 windows_866_to_utf8 11 10 20 6 4359 t ) insert ( 4460 utf8_to_windows_874 11 10 6 21 4358 t ) insert ( 4461 windows_874_to_utf8 11 10 21 6 4359 t ) insert ( 4462 utf8_to_windows_1250 11 10 6 29 4358 t ) insert ( 4463 windows_1250_to_utf8 11 10 29 6 4359 t ) insert ( 4464 utf8_to_windows_1251 11 10 6 23 4358 t ) insert ( 4465 windows_1251_to_utf8 11 10 23 6 4359 t ) insert ( 4466 utf8_to_windows_1252 11 10 6 24 4358 t ) insert ( 4467 windows_1252_to_utf8 11 10 24 6 4359 t ) insert ( 4468 utf8_to_windows_1253 11 10 6 30 4358 t ) insert ( 4469 windows_1253_to_utf8 11 10 30 6 4359 t ) insert ( 4470 utf8_to_windows_1254 11 10 6 31 4358 t ) insert ( 4471 windows_1254_to_utf8 11 10 31 6 4359 t ) insert ( 4472 utf8_to_windows_1255 11 10 6 32 4358 t ) insert ( 4473 windows_1255_to_utf8 11 10 32 6 4359 t ) insert ( 4474 utf8_to_windows_1256 11 10 6 18 4358 t ) insert ( 4475 windows_1256_to_utf8 11 10 18 6 4359 t ) insert ( 4476 utf8_to_windows_1257 11 10 6 33 4358 t ) insert ( 4477 windows_1257_to_utf8 11 10 33 6 4359 t ) insert ( 4478 utf8_to_windows_1258 11 10 6 19 4358 t ) insert ( 4479 windows_1258_to_utf8 11 10 19 6 4359 t ) insert ( 4480 euc_cn_to_utf8 11 10 2 6 4360 t ) insert ( 4481 utf8_to_euc_cn 11 10 6 2 4361 t ) insert ( 4482 euc_jp_to_utf8 11 10 1 6 4362 t ) insert ( 4483 utf8_to_euc_jp 11 10 6 1 4363 t ) insert ( 4484 euc_kr_to_utf8 11 10 3 6 4364 t ) insert ( 4485 utf8_to_euc_kr 11 10 6 3 4365 t ) insert ( 4486 euc_tw_to_utf8 11 10 4 6 4366 t ) insert ( 4487 utf8_to_euc_tw 11 10 6 4 4367 t ) insert ( 4488 gb18030_to_utf8 11 10 39 6 4368 t ) insert ( 4489 utf8_to_gb18030 11 10 6 39 4369 t ) insert ( 4490 gbk_to_utf8 11 10 37 6 4370 t ) insert ( 4491 utf8_to_gbk 11 10 6 37 4371 t ) insert ( 4492 utf8_to_iso_8859_2 11 10 6 9 4372 t ) insert ( 4493 iso_8859_2_to_utf8 11 10 9 6 4373 t ) insert ( 4494 utf8_to_iso_8859_3 11 10 6 10 4372 t ) insert ( 4495 iso_8859_3_to_utf8 11 10 10 6 4373 t ) insert ( 4496 utf8_to_iso_8859_4 11 10 6 11 4372 t ) insert ( 4497 iso_8859_4_to_utf8 11 10 11 6 4373 t ) insert ( 4498 utf8_to_iso_8859_9 11 10 6 12 4372 t ) insert ( 4499 iso_8859_9_to_utf8 11 10 12 6 4373 t ) insert ( 4500 utf8_to_iso_8859_10 11 10 6 13 4372 t ) insert ( 4501 iso_8859_10_to_utf8 11 10 13 6 4373 t ) insert ( 4502 utf8_to_iso_8859_13 11 10 6 14 4372 t ) insert ( 4503 iso_8859_13_to_utf8 11 10 14 6 4373 t ) insert ( 4504 utf8_to_iso_8859_14 11 10 6 15 4372 t ) insert ( 4505 iso_8859_14_to_utf8 11 10 15 6 4373 t ) insert ( 4506 utf8_to_iso_8859_15 11 10 6 16 4372 t ) insert ( 4507 iso_8859_15_to_utf8 11 10 16 6 4373 t ) insert ( 4508 utf8_to_iso_8859_16 11 10 6 17 4372 t ) insert ( 4509 iso_8859_16_to_utf8 11 10 17 6 4373 t ) insert ( 4510 utf8_to_iso_8859_5 11 10 6 25 4372 t ) insert ( 4511 iso_8859_5_to_utf8 11 10 25 6 4373 t ) insert ( 4512 utf8_to_iso_8859_6 11 10 6 26 4372 t ) insert ( 4513 iso_8859_6_to_utf8 11 10 26 6 4373 t ) insert ( 4514 utf8_to_iso_8859_7 11 10 6 27 4372 t ) insert ( 4515 iso_8859_7_to_utf8 11 10 27 6 4373 t ) insert ( 4516 utf8_to_iso_8859_8 11 10 6 28 4372 t ) insert ( 4517 iso_8859_8_to_utf8 11 10 28 6 4373 t ) insert ( 4518 iso_8859_1_to_utf8 11 10 8 6 4374 t ) insert ( 4519 utf8_to_iso_8859_1 11 10 6 8 4375 t ) insert ( 4520 johab_to_utf8 11 10 40 6 4376 t ) insert ( 4521 utf8_to_johab 11 10 6 40 4377 t ) insert ( 4522 sjis_to_utf8 11 10 35 6 4378 t ) insert ( 4523 utf8_to_sjis 11 10 6 35 4379 t ) insert ( 4524 uhc_to_utf8 11 10 38 6 4380 t ) insert ( 4525 utf8_to_uhc 11 10 6 38 4381 t ) insert ( 4526 euc_jis_2004_to_utf8 11 10 5 6 4382 t ) insert ( 4527 utf8_to_euc_jis_2004 11 10 6 5 4383 t ) insert ( 4528 shift_jis_2004_to_utf8 11 10 41 6 4384 t ) insert ( 4529 utf8_to_shift_jis_2004 11 10 6 41 4385 t ) insert ( 4530 euc_jis_2004_to_shift_jis_2004 11 10 5 41 4386 t ) insert ( 4531 shift_jis_2004_to_euc_jis_2004 11 10 41 5 4387 t ) close pg_conversion create pg_depend 2608 ( classid = oid , objid = oid , objsubid = int4 , refclassid = oid , refobjid = oid , refobjsubid = int4 , deptype = char ) open pg_depend close pg_depend create pg_database 1262 shared_relation rowtype_oid 1248 ( oid = oid , datname = name , datdba = oid , encoding = int4 , datlocprovider = char , datistemplate = bool , datallowconn = bool , dathasloginevt = bool , datconnlimit = int4 , datfrozenxid = xid , datminmxid = xid , dattablespace = oid , datcollate = text FORCE NOT NULL , datctype = text FORCE NOT NULL , datlocale = text , daticurules = text , datcollversion = text , datacl = _aclitem ) open pg_database insert ( 1 template1 10 ENCODING LOCALE_PROVIDER t t f -1 0 1 1663 LC_COLLATE LC_CTYPE DATLOCALE ICU_RULES _null_ _null_ ) close pg_database create pg_db_role_setting 2964 shared_relation ( setdatabase = oid , setrole = oid , setconfig = _text ) open pg_db_role_setting close pg_db_role_setting create pg_tablespace 1213 shared_relation ( oid = oid , spcname = name , spcowner = oid , spcacl = _aclitem , spcoptions = _text ) open pg_tablespace insert ( 1663 pg_default 10 _null_ _null_ ) insert ( 1664 pg_global 10 _null_ _null_ ) close pg_tablespace create pg_authid 1260 shared_relation rowtype_oid 2842 ( oid = oid , rolname = name , rolsuper = bool , rolinherit = bool , rolcreaterole = bool , rolcreatedb = bool , rolcanlogin = bool , rolreplication = bool , rolbypassrls = bool , rolconnlimit = int4 , rolpassword = text , rolvaliduntil = timestamptz ) open pg_authid insert ( 10 POSTGRES t t t t t t t -1 _null_ _null_ ) insert ( 6171 pg_database_owner f t f f f f f -1 _null_ _null_ ) insert ( 6181 pg_read_all_data f t f f f f f -1 _null_ _null_ ) insert ( 6182 pg_write_all_data f t f f f f f -1 _null_ _null_ ) insert ( 3373 pg_monitor f t f f f f f -1 _null_ _null_ ) insert ( 3374 pg_read_all_settings f t f f f f f -1 _null_ _null_ ) insert ( 3375 pg_read_all_stats f t f f f f f -1 _null_ _null_ ) insert ( 3377 pg_stat_scan_tables f t f f f f f -1 _null_ _null_ ) insert ( 4569 pg_read_server_files f t f f f f f -1 _null_ _null_ ) insert ( 4570 pg_write_server_files f t f f f f f -1 _null_ _null_ ) insert ( 4571 pg_execute_server_program f t f f f f f -1 _null_ _null_ ) insert ( 4200 pg_signal_backend f t f f f f f -1 _null_ _null_ ) insert ( 4544 pg_checkpoint f t f f f f f -1 _null_ _null_ ) insert ( 6337 pg_maintain f t f f f f f -1 _null_ _null_ ) insert ( 4550 pg_use_reserved_connections f t f f f f f -1 _null_ _null_ ) insert ( 6304 pg_create_subscription f t f f f f f -1 _null_ _null_ ) close pg_authid create pg_auth_members 1261 shared_relation rowtype_oid 2843 ( oid = oid , roleid = oid , member = oid , grantor = oid , admin_option = bool , inherit_option = bool , set_option = bool ) open pg_auth_members close pg_auth_members create pg_shdepend 1214 shared_relation ( dbid = oid , classid = oid , objid = oid , objsubid = int4 , refclassid = oid , refobjid = oid , deptype = char ) open pg_shdepend close pg_shdepend create pg_shdescription 2396 shared_relation ( objoid = oid , classoid = oid , description = text FORCE NOT NULL ) open pg_shdescription insert ( 1 1262 'default template for new databases' ) close pg_shdescription create pg_ts_config 3602 ( oid = oid , cfgname = name , cfgnamespace = oid , cfgowner = oid , cfgparser = oid ) open pg_ts_config insert ( 3748 simple 11 10 3722 ) close pg_ts_config create pg_ts_config_map 3603 ( mapcfg = oid , maptokentype = int4 , mapseqno = int4 , mapdict = oid ) open pg_ts_config_map insert ( 3748 1 1 3765 ) insert ( 3748 2 1 3765 ) insert ( 3748 3 1 3765 ) insert ( 3748 4 1 3765 ) insert ( 3748 5 1 3765 ) insert ( 3748 6 1 3765 ) insert ( 3748 7 1 3765 ) insert ( 3748 8 1 3765 ) insert ( 3748 9 1 3765 ) insert ( 3748 10 1 3765 ) insert ( 3748 11 1 3765 ) insert ( 3748 15 1 3765 ) insert ( 3748 16 1 3765 ) insert ( 3748 17 1 3765 ) insert ( 3748 18 1 3765 ) insert ( 3748 19 1 3765 ) insert ( 3748 20 1 3765 ) insert ( 3748 21 1 3765 ) insert ( 3748 22 1 3765 ) close pg_ts_config_map create pg_ts_dict 3600 ( oid = oid , dictname = name , dictnamespace = oid , dictowner = oid , dicttemplate = oid , dictinitoption = text ) open pg_ts_dict insert ( 3765 simple 11 10 3727 _null_ ) close pg_ts_dict create pg_ts_parser 3601 ( oid = oid , prsname = name , prsnamespace = oid , prsstart = regproc , prstoken = regproc , prsend = regproc , prsheadline = regproc , prslextype = regproc ) open pg_ts_parser insert ( 3722 default 11 3717 3718 3719 3720 3721 ) close pg_ts_parser create pg_ts_template 3764 ( oid = oid , tmplname = name , tmplnamespace = oid , tmplinit = regproc , tmpllexize = regproc ) open pg_ts_template insert ( 3727 simple 11 3725 3726 ) insert ( 3730 synonym 11 3728 3729 ) insert ( 3733 ispell 11 3731 3732 ) insert ( 3742 thesaurus 11 3740 3741 ) close pg_ts_template create pg_extension 3079 ( oid = oid , extname = name , extowner = oid , extnamespace = oid , extrelocatable = bool , extversion = text FORCE NOT NULL , extconfig = _oid , extcondition = _text ) open pg_extension close pg_extension create pg_foreign_data_wrapper 2328 ( oid = oid , fdwname = name , fdwowner = oid , fdwhandler = oid , fdwvalidator = oid , fdwacl = _aclitem , fdwoptions = _text ) open pg_foreign_data_wrapper close pg_foreign_data_wrapper create pg_foreign_server 1417 ( oid = oid , srvname = name , srvowner = oid , srvfdw = oid , srvtype = text , srvversion = text , srvacl = _aclitem , srvoptions = _text ) open pg_foreign_server close pg_foreign_server create pg_user_mapping 1418 ( oid = oid , umuser = oid , umserver = oid , umoptions = _text ) open pg_user_mapping close pg_user_mapping create pg_foreign_table 3118 ( ftrelid = oid , ftserver = oid , ftoptions = _text ) open pg_foreign_table close pg_foreign_table create pg_policy 3256 ( oid = oid , polname = name , polrelid = oid , polcmd = char , polpermissive = bool , polroles = _oid FORCE NOT NULL , polqual = pg_node_tree , polwithcheck = pg_node_tree ) open pg_policy close pg_policy create pg_replication_origin 6000 shared_relation ( roident = oid , roname = text FORCE NOT NULL ) open pg_replication_origin close pg_replication_origin create pg_default_acl 826 ( oid = oid , defaclrole = oid , defaclnamespace = oid , defaclobjtype = char , defaclacl = _aclitem FORCE NOT NULL ) open pg_default_acl close pg_default_acl create pg_init_privs 3394 ( objoid = oid , classoid = oid , objsubid = int4 , privtype = char , initprivs = _aclitem FORCE NOT NULL ) open pg_init_privs close pg_init_privs create pg_seclabel 3596 ( objoid = oid , classoid = oid , objsubid = int4 , provider = text FORCE NOT NULL , label = text FORCE NOT NULL ) open pg_seclabel close pg_seclabel create pg_shseclabel 3592 shared_relation rowtype_oid 4066 ( objoid = oid , classoid = oid , provider = text FORCE NOT NULL , label = text FORCE NOT NULL ) open pg_shseclabel close pg_shseclabel create pg_collation 3456 ( oid = oid , collname = name , collnamespace = oid , collowner = oid , collprovider = char , collisdeterministic = bool , collencoding = int4 , collcollate = text , collctype = text , colllocale = text , collicurules = text , collversion = text ) open pg_collation insert ( 100 default 11 10 d t -1 _null_ _null_ _null_ _null_ _null_ ) insert ( 950 C 11 10 c t -1 C C _null_ _null_ _null_ ) insert ( 951 POSIX 11 10 c t -1 POSIX POSIX _null_ _null_ _null_ ) insert ( 962 ucs_basic 11 10 b t 6 _null_ _null_ C _null_ 1 ) insert ( 963 unicode 11 10 i t -1 _null_ _null_ und _null_ _null_ ) insert ( 811 pg_c_utf8 11 10 b t 6 _null_ _null_ 'C.UTF-8' _null_ 1 ) close pg_collation create pg_parameter_acl 6243 shared_relation ( oid = oid , parname = text FORCE NOT NULL , paracl = _aclitem ) open pg_parameter_acl close pg_parameter_acl create pg_partitioned_table 3350 ( partrelid = oid , partstrat = char , partnatts = int2 , partdefid = oid , partattrs = int2vector FORCE NOT NULL , partclass = oidvector FORCE NOT NULL , partcollation = oidvector FORCE NOT NULL , partexprs = pg_node_tree ) open pg_partitioned_table close pg_partitioned_table create pg_range 3541 ( rngtypid = oid , rngsubtype = oid , rngmultitypid = oid , rngcollation = oid , rngsubopc = oid , rngcanonical = regproc , rngsubdiff = regproc ) open pg_range insert ( 3904 23 4451 0 1978 3914 3922 ) insert ( 3906 1700 4532 0 3125 - 3924 ) insert ( 3908 1114 4533 0 3128 - 3929 ) insert ( 3910 1184 4534 0 3127 - 3930 ) insert ( 3912 1082 4535 0 3122 3915 3925 ) insert ( 3926 20 4536 0 3124 3928 3923 ) close pg_range create pg_transform 3576 ( oid = oid , trftype = oid , trflang = oid , trffromsql = regproc , trftosql = regproc ) open pg_transform close pg_transform create pg_sequence 2224 ( seqrelid = oid , seqtypid = oid , seqstart = int8 , seqincrement = int8 , seqmax = int8 , seqmin = int8 , seqcache = int8 , seqcycle = bool ) open pg_sequence close pg_sequence create pg_publication 6104 ( oid = oid , pubname = name , pubowner = oid , puballtables = bool , pubinsert = bool , pubupdate = bool , pubdelete = bool , pubtruncate = bool , pubviaroot = bool ) open pg_publication close pg_publication create pg_publication_namespace 6237 ( oid = oid , pnpubid = oid , pnnspid = oid ) open pg_publication_namespace close pg_publication_namespace create pg_publication_rel 6106 ( oid = oid , prpubid = oid , prrelid = oid , prqual = pg_node_tree , prattrs = int2vector ) open pg_publication_rel close pg_publication_rel create pg_subscription 6100 shared_relation rowtype_oid 6101 ( oid = oid , subdbid = oid , subskiplsn = pg_lsn , subname = name , subowner = oid , subenabled = bool , subbinary = bool , substream = char , subtwophasestate = char , subdisableonerr = bool , subpasswordrequired = bool , subrunasowner = bool , subfailover = bool , subconninfo = text FORCE NOT NULL , subslotname = name FORCE NULL , subsynccommit = text FORCE NOT NULL , subpublications = _text FORCE NOT NULL , suborigin = text ) open pg_subscription close pg_subscription create pg_subscription_rel 6102 ( srsubid = oid , srrelid = oid , srsubstate = char , srsublsn = pg_lsn FORCE NULL ) open pg_subscription_rel close pg_subscription_rel declare toast 2836 2837 on pg_proc declare toast 4171 4172 on pg_type declare toast 2830 2831 on pg_attrdef declare toast 2832 2833 on pg_constraint declare toast 4157 4158 on pg_language declare toast 4159 4160 on pg_aggregate declare toast 2840 2841 on pg_statistic declare toast 3439 3440 on pg_statistic_ext declare toast 3430 3431 on pg_statistic_ext_data declare toast 2838 2839 on pg_rewrite declare toast 2336 2337 on pg_trigger declare toast 4145 4146 on pg_event_trigger declare toast 2834 2835 on pg_description declare toast 4163 4164 on pg_namespace declare toast 4177 4178 on pg_database declare toast 2966 2967 on pg_db_role_setting declare toast 4185 4186 on pg_tablespace declare toast 4175 4176 on pg_authid declare toast 2846 2847 on pg_shdescription declare toast 4169 4170 on pg_ts_dict declare toast 4147 4148 on pg_extension declare toast 4149 4150 on pg_foreign_data_wrapper declare toast 4151 4152 on pg_foreign_server declare toast 4173 4174 on pg_user_mapping declare toast 4153 4154 on pg_foreign_table declare toast 4167 4168 on pg_policy declare toast 4181 4182 on pg_replication_origin declare toast 4143 4144 on pg_default_acl declare toast 4155 4156 on pg_init_privs declare toast 3598 3599 on pg_seclabel declare toast 4060 4061 on pg_shseclabel declare toast 6175 6176 on pg_collation declare toast 6244 6245 on pg_parameter_acl declare toast 4165 4166 on pg_partitioned_table declare toast 6228 6229 on pg_publication_rel declare toast 4183 4184 on pg_subscription declare unique index pg_proc_oid_index 2690 on pg_proc using btree(oid oid_ops) declare unique index pg_proc_proname_args_nsp_index 2691 on pg_proc using btree(proname name_ops, proargtypes oidvector_ops, pronamespace oid_ops) declare unique index pg_type_oid_index 2703 on pg_type using btree(oid oid_ops) declare unique index pg_type_typname_nsp_index 2704 on pg_type using btree(typname name_ops, typnamespace oid_ops) declare unique index pg_attribute_relid_attnam_index 2658 on pg_attribute using btree(attrelid oid_ops, attname name_ops) declare unique index pg_attribute_relid_attnum_index 2659 on pg_attribute using btree(attrelid oid_ops, attnum int2_ops) declare unique index pg_class_oid_index 2662 on pg_class using btree(oid oid_ops) declare unique index pg_class_relname_nsp_index 2663 on pg_class using btree(relname name_ops, relnamespace oid_ops) declare index pg_class_tblspc_relfilenode_index 3455 on pg_class using btree(reltablespace oid_ops, relfilenode oid_ops) declare unique index pg_attrdef_adrelid_adnum_index 2656 on pg_attrdef using btree(adrelid oid_ops, adnum int2_ops) declare unique index pg_attrdef_oid_index 2657 on pg_attrdef using btree(oid oid_ops) declare index pg_constraint_conname_nsp_index 2664 on pg_constraint using btree(conname name_ops, connamespace oid_ops) declare unique index pg_constraint_conrelid_contypid_conname_index 2665 on pg_constraint using btree(conrelid oid_ops, contypid oid_ops, conname name_ops) declare index pg_constraint_contypid_index 2666 on pg_constraint using btree(contypid oid_ops) declare unique index pg_constraint_oid_index 2667 on pg_constraint using btree(oid oid_ops) declare index pg_constraint_conparentid_index 2579 on pg_constraint using btree(conparentid oid_ops) declare unique index pg_inherits_relid_seqno_index 2680 on pg_inherits using btree(inhrelid oid_ops, inhseqno int4_ops) declare index pg_inherits_parent_index 2187 on pg_inherits using btree(inhparent oid_ops) declare index pg_index_indrelid_index 2678 on pg_index using btree(indrelid oid_ops) declare unique index pg_index_indexrelid_index 2679 on pg_index using btree(indexrelid oid_ops) declare unique index pg_operator_oid_index 2688 on pg_operator using btree(oid oid_ops) declare unique index pg_operator_oprname_l_r_n_index 2689 on pg_operator using btree(oprname name_ops, oprleft oid_ops, oprright oid_ops, oprnamespace oid_ops) declare unique index pg_opfamily_am_name_nsp_index 2754 on pg_opfamily using btree(opfmethod oid_ops, opfname name_ops, opfnamespace oid_ops) declare unique index pg_opfamily_oid_index 2755 on pg_opfamily using btree(oid oid_ops) declare unique index pg_opclass_am_name_nsp_index 2686 on pg_opclass using btree(opcmethod oid_ops, opcname name_ops, opcnamespace oid_ops) declare unique index pg_opclass_oid_index 2687 on pg_opclass using btree(oid oid_ops) declare unique index pg_am_name_index 2651 on pg_am using btree(amname name_ops) declare unique index pg_am_oid_index 2652 on pg_am using btree(oid oid_ops) declare unique index pg_amop_fam_strat_index 2653 on pg_amop using btree(amopfamily oid_ops, amoplefttype oid_ops, amoprighttype oid_ops, amopstrategy int2_ops) declare unique index pg_amop_opr_fam_index 2654 on pg_amop using btree(amopopr oid_ops, amoppurpose char_ops, amopfamily oid_ops) declare unique index pg_amop_oid_index 2756 on pg_amop using btree(oid oid_ops) declare unique index pg_amproc_fam_proc_index 2655 on pg_amproc using btree(amprocfamily oid_ops, amproclefttype oid_ops, amprocrighttype oid_ops, amprocnum int2_ops) declare unique index pg_amproc_oid_index 2757 on pg_amproc using btree(oid oid_ops) declare unique index pg_language_name_index 2681 on pg_language using btree(lanname name_ops) declare unique index pg_language_oid_index 2682 on pg_language using btree(oid oid_ops) declare unique index pg_largeobject_metadata_oid_index 2996 on pg_largeobject_metadata using btree(oid oid_ops) declare unique index pg_largeobject_loid_pn_index 2683 on pg_largeobject using btree(loid oid_ops, pageno int4_ops) declare unique index pg_aggregate_fnoid_index 2650 on pg_aggregate using btree(aggfnoid oid_ops) declare unique index pg_statistic_relid_att_inh_index 2696 on pg_statistic using btree(starelid oid_ops, staattnum int2_ops, stainherit bool_ops) declare unique index pg_statistic_ext_oid_index 3380 on pg_statistic_ext using btree(oid oid_ops) declare unique index pg_statistic_ext_name_index 3997 on pg_statistic_ext using btree(stxname name_ops, stxnamespace oid_ops) declare index pg_statistic_ext_relid_index 3379 on pg_statistic_ext using btree(stxrelid oid_ops) declare unique index pg_statistic_ext_data_stxoid_inh_index 3433 on pg_statistic_ext_data using btree(stxoid oid_ops, stxdinherit bool_ops) declare unique index pg_rewrite_oid_index 2692 on pg_rewrite using btree(oid oid_ops) declare unique index pg_rewrite_rel_rulename_index 2693 on pg_rewrite using btree(ev_class oid_ops, rulename name_ops) declare index pg_trigger_tgconstraint_index 2699 on pg_trigger using btree(tgconstraint oid_ops) declare unique index pg_trigger_tgrelid_tgname_index 2701 on pg_trigger using btree(tgrelid oid_ops, tgname name_ops) declare unique index pg_trigger_oid_index 2702 on pg_trigger using btree(oid oid_ops) declare unique index pg_event_trigger_evtname_index 3467 on pg_event_trigger using btree(evtname name_ops) declare unique index pg_event_trigger_oid_index 3468 on pg_event_trigger using btree(oid oid_ops) declare unique index pg_description_o_c_o_index 2675 on pg_description using btree(objoid oid_ops, classoid oid_ops, objsubid int4_ops) declare unique index pg_cast_oid_index 2660 on pg_cast using btree(oid oid_ops) declare unique index pg_cast_source_target_index 2661 on pg_cast using btree(castsource oid_ops, casttarget oid_ops) declare unique index pg_enum_oid_index 3502 on pg_enum using btree(oid oid_ops) declare unique index pg_enum_typid_label_index 3503 on pg_enum using btree(enumtypid oid_ops, enumlabel name_ops) declare unique index pg_enum_typid_sortorder_index 3534 on pg_enum using btree(enumtypid oid_ops, enumsortorder float4_ops) declare unique index pg_namespace_nspname_index 2684 on pg_namespace using btree(nspname name_ops) declare unique index pg_namespace_oid_index 2685 on pg_namespace using btree(oid oid_ops) declare unique index pg_conversion_default_index 2668 on pg_conversion using btree(connamespace oid_ops, conforencoding int4_ops, contoencoding int4_ops, oid oid_ops) declare unique index pg_conversion_name_nsp_index 2669 on pg_conversion using btree(conname name_ops, connamespace oid_ops) declare unique index pg_conversion_oid_index 2670 on pg_conversion using btree(oid oid_ops) declare index pg_depend_depender_index 2673 on pg_depend using btree(classid oid_ops, objid oid_ops, objsubid int4_ops) declare index pg_depend_reference_index 2674 on pg_depend using btree(refclassid oid_ops, refobjid oid_ops, refobjsubid int4_ops) declare unique index pg_database_datname_index 2671 on pg_database using btree(datname name_ops) declare unique index pg_database_oid_index 2672 on pg_database using btree(oid oid_ops) declare unique index pg_db_role_setting_databaseid_rol_index 2965 on pg_db_role_setting using btree(setdatabase oid_ops, setrole oid_ops) declare unique index pg_tablespace_oid_index 2697 on pg_tablespace using btree(oid oid_ops) declare unique index pg_tablespace_spcname_index 2698 on pg_tablespace using btree(spcname name_ops) declare unique index pg_authid_rolname_index 2676 on pg_authid using btree(rolname name_ops) declare unique index pg_authid_oid_index 2677 on pg_authid using btree(oid oid_ops) declare unique index pg_auth_members_oid_index 6303 on pg_auth_members using btree(oid oid_ops) declare unique index pg_auth_members_role_member_index 2694 on pg_auth_members using btree(roleid oid_ops, member oid_ops, grantor oid_ops) declare unique index pg_auth_members_member_role_index 2695 on pg_auth_members using btree(member oid_ops, roleid oid_ops, grantor oid_ops) declare index pg_auth_members_grantor_index 6302 on pg_auth_members using btree(grantor oid_ops) declare index pg_shdepend_depender_index 1232 on pg_shdepend using btree(dbid oid_ops, classid oid_ops, objid oid_ops, objsubid int4_ops) declare index pg_shdepend_reference_index 1233 on pg_shdepend using btree(refclassid oid_ops, refobjid oid_ops) declare unique index pg_shdescription_o_c_index 2397 on pg_shdescription using btree(objoid oid_ops, classoid oid_ops) declare unique index pg_ts_config_cfgname_index 3608 on pg_ts_config using btree(cfgname name_ops, cfgnamespace oid_ops) declare unique index pg_ts_config_oid_index 3712 on pg_ts_config using btree(oid oid_ops) declare unique index pg_ts_config_map_index 3609 on pg_ts_config_map using btree(mapcfg oid_ops, maptokentype int4_ops, mapseqno int4_ops) declare unique index pg_ts_dict_dictname_index 3604 on pg_ts_dict using btree(dictname name_ops, dictnamespace oid_ops) declare unique index pg_ts_dict_oid_index 3605 on pg_ts_dict using btree(oid oid_ops) declare unique index pg_ts_parser_prsname_index 3606 on pg_ts_parser using btree(prsname name_ops, prsnamespace oid_ops) declare unique index pg_ts_parser_oid_index 3607 on pg_ts_parser using btree(oid oid_ops) declare unique index pg_ts_template_tmplname_index 3766 on pg_ts_template using btree(tmplname name_ops, tmplnamespace oid_ops) declare unique index pg_ts_template_oid_index 3767 on pg_ts_template using btree(oid oid_ops) declare unique index pg_extension_oid_index 3080 on pg_extension using btree(oid oid_ops) declare unique index pg_extension_name_index 3081 on pg_extension using btree(extname name_ops) declare unique index pg_foreign_data_wrapper_oid_index 112 on pg_foreign_data_wrapper using btree(oid oid_ops) declare unique index pg_foreign_data_wrapper_name_index 548 on pg_foreign_data_wrapper using btree(fdwname name_ops) declare unique index pg_foreign_server_oid_index 113 on pg_foreign_server using btree(oid oid_ops) declare unique index pg_foreign_server_name_index 549 on pg_foreign_server using btree(srvname name_ops) declare unique index pg_user_mapping_oid_index 174 on pg_user_mapping using btree(oid oid_ops) declare unique index pg_user_mapping_user_server_index 175 on pg_user_mapping using btree(umuser oid_ops, umserver oid_ops) declare unique index pg_foreign_table_relid_index 3119 on pg_foreign_table using btree(ftrelid oid_ops) declare unique index pg_policy_oid_index 3257 on pg_policy using btree(oid oid_ops) declare unique index pg_policy_polrelid_polname_index 3258 on pg_policy using btree(polrelid oid_ops, polname name_ops) declare unique index pg_replication_origin_roiident_index 6001 on pg_replication_origin using btree(roident oid_ops) declare unique index pg_replication_origin_roname_index 6002 on pg_replication_origin using btree(roname text_ops) declare unique index pg_default_acl_role_nsp_obj_index 827 on pg_default_acl using btree(defaclrole oid_ops, defaclnamespace oid_ops, defaclobjtype char_ops) declare unique index pg_default_acl_oid_index 828 on pg_default_acl using btree(oid oid_ops) declare unique index pg_init_privs_o_c_o_index 3395 on pg_init_privs using btree(objoid oid_ops, classoid oid_ops, objsubid int4_ops) declare unique index pg_seclabel_object_index 3597 on pg_seclabel using btree(objoid oid_ops, classoid oid_ops, objsubid int4_ops, provider text_ops) declare unique index pg_shseclabel_object_index 3593 on pg_shseclabel using btree(objoid oid_ops, classoid oid_ops, provider text_ops) declare unique index pg_collation_name_enc_nsp_index 3164 on pg_collation using btree(collname name_ops, collencoding int4_ops, collnamespace oid_ops) declare unique index pg_collation_oid_index 3085 on pg_collation using btree(oid oid_ops) declare unique index pg_parameter_acl_parname_index 6246 on pg_parameter_acl using btree(parname text_ops) declare unique index pg_parameter_acl_oid_index 6247 on pg_parameter_acl using btree(oid oid_ops) declare unique index pg_partitioned_table_partrelid_index 3351 on pg_partitioned_table using btree(partrelid oid_ops) declare unique index pg_range_rngtypid_index 3542 on pg_range using btree(rngtypid oid_ops) declare unique index pg_range_rngmultitypid_index 2228 on pg_range using btree(rngmultitypid oid_ops) declare unique index pg_transform_oid_index 3574 on pg_transform using btree(oid oid_ops) declare unique index pg_transform_type_lang_index 3575 on pg_transform using btree(trftype oid_ops, trflang oid_ops) declare unique index pg_sequence_seqrelid_index 5002 on pg_sequence using btree(seqrelid oid_ops) declare unique index pg_publication_oid_index 6110 on pg_publication using btree(oid oid_ops) declare unique index pg_publication_pubname_index 6111 on pg_publication using btree(pubname name_ops) declare unique index pg_publication_namespace_oid_index 6238 on pg_publication_namespace using btree(oid oid_ops) declare unique index pg_publication_namespace_pnnspid_pnpubid_index 6239 on pg_publication_namespace using btree(pnnspid oid_ops, pnpubid oid_ops) declare unique index pg_publication_rel_oid_index 6112 on pg_publication_rel using btree(oid oid_ops) declare unique index pg_publication_rel_prrelid_prpubid_index 6113 on pg_publication_rel using btree(prrelid oid_ops, prpubid oid_ops) declare index pg_publication_rel_prpubid_index 6116 on pg_publication_rel using btree(prpubid oid_ops) declare unique index pg_subscription_oid_index 6114 on pg_subscription using btree(oid oid_ops) declare unique index pg_subscription_subname_index 6115 on pg_subscription using btree(subdbid oid_ops, subname name_ops) declare unique index pg_subscription_rel_srrelid_srsubid_index 6117 on pg_subscription_rel using btree(srrelid oid_ops, srsubid oid_ops) build indices # ----------------------------- # PostgreSQL configuration file # ----------------------------- # # This file consists of lines of the form: # # name = value # # (The "=" is optional.) Whitespace may be used. Comments are introduced with # "#" anywhere on a line. The complete list of parameter names and allowed # values can be found in the PostgreSQL documentation. # # The commented-out settings shown in this file represent the default values. # Re-commenting a setting is NOT sufficient to revert it to the default value; # you need to reload the server. # # This file is read on server startup and when the server receives a SIGHUP # signal. If you edit the file on a running system, you have to SIGHUP the # server for the changes to take effect, run "pg_ctl reload", or execute # "SELECT pg_reload_conf()". Some parameters, which are marked below, # require a server shutdown and restart to take effect. # # Any parameter can also be given as a command-line option to the server, e.g., # "postgres -c log_connections=on". Some parameters can be changed at run time # with the "SET" SQL command. # # Memory units: B = bytes Time units: us = microseconds # kB = kilobytes ms = milliseconds # MB = megabytes s = seconds # GB = gigabytes min = minutes # TB = terabytes h = hours # d = days #------------------------------------------------------------------------------ # FILE LOCATIONS #------------------------------------------------------------------------------ # The default values of these variables are driven from the -D command-line # option or PGDATA environment variable, represented here as ConfigDir. #data_directory = 'ConfigDir' # use data in another directory # (change requires restart) #hba_file = 'ConfigDir/pg_hba.conf' # host-based authentication file # (change requires restart) #ident_file = 'ConfigDir/pg_ident.conf' # ident configuration file # (change requires restart) # If external_pid_file is not explicitly set, no extra PID file is written. #external_pid_file = '' # write an extra PID file # (change requires restart) #------------------------------------------------------------------------------ # CONNECTIONS AND AUTHENTICATION #------------------------------------------------------------------------------ # - Connection Settings - #listen_addresses = 'localhost' # what IP address(es) to listen on; # comma-separated list of addresses; # defaults to 'localhost'; use '*' for all # (change requires restart) #port = 5432 # (change requires restart) #max_connections = 100 # (change requires restart) #reserved_connections = 0 # (change requires restart) #superuser_reserved_connections = 3 # (change requires restart) #unix_socket_directories = '/tmp' # comma-separated list of directories # (change requires restart) #unix_socket_group = '' # (change requires restart) #unix_socket_permissions = 0777 # begin with 0 to use octal notation # (change requires restart) #bonjour = off # advertise server via Bonjour # (change requires restart) #bonjour_name = '' # defaults to the computer name # (change requires restart) # - TCP settings - # see "man tcp" for details #tcp_keepalives_idle = 0 # TCP_KEEPIDLE, in seconds; # 0 selects the system default #tcp_keepalives_interval = 0 # TCP_KEEPINTVL, in seconds; # 0 selects the system default #tcp_keepalives_count = 0 # TCP_KEEPCNT; # 0 selects the system default #tcp_user_timeout = 0 # TCP_USER_TIMEOUT, in milliseconds; # 0 selects the system default #client_connection_check_interval = 0 # time between checks for client # disconnection while running queries; # 0 for never # - Authentication - #authentication_timeout = 1min # 1s-600s #password_encryption = scram-sha-256 # scram-sha-256 or md5 #scram_iterations = 4096 # GSSAPI using Kerberos #krb_server_keyfile = 'FILE:${sysconfdir}/krb5.keytab' #krb_caseins_users = off #gss_accept_delegation = off # - SSL - #ssl = off #ssl_ca_file = '' #ssl_cert_file = 'server.crt' #ssl_crl_file = '' #ssl_crl_dir = '' #ssl_key_file = 'server.key' #ssl_ciphers = 'HIGH:MEDIUM:+3DES:!aNULL' # allowed SSL ciphers #ssl_prefer_server_ciphers = on #ssl_ecdh_curve = 'prime256v1' #ssl_min_protocol_version = 'TLSv1.2' #ssl_max_protocol_version = '' #ssl_dh_params_file = '' #ssl_passphrase_command = '' #ssl_passphrase_command_supports_reload = off #------------------------------------------------------------------------------ # RESOURCE USAGE (except WAL) #------------------------------------------------------------------------------ # - Memory - #shared_buffers = 128MB # min 128kB # (change requires restart) #huge_pages = try # on, off, or try # (change requires restart) #huge_page_size = 0 # zero for system default # (change requires restart) #temp_buffers = 8MB # min 800kB #max_prepared_transactions = 0 # zero disables the feature # (change requires restart) # Caution: it is not advisable to set max_prepared_transactions nonzero unless # you actively intend to use prepared transactions. #work_mem = 4MB # min 64kB #hash_mem_multiplier = 2.0 # 1-1000.0 multiplier on hash table work_mem #maintenance_work_mem = 64MB # min 64kB #autovacuum_work_mem = -1 # min 64kB, or -1 to use maintenance_work_mem #logical_decoding_work_mem = 64MB # min 64kB #max_stack_depth = 2MB # min 100kB #shared_memory_type = mmap # the default is the first option # supported by the operating system: # mmap # sysv # windows # (change requires restart) #dynamic_shared_memory_type = posix # the default is usually the first option # supported by the operating system: # posix # sysv # windows # mmap # (change requires restart) #min_dynamic_shared_memory = 0MB # (change requires restart) #vacuum_buffer_usage_limit = 2MB # size of vacuum and analyze buffer access strategy ring; # 0 to disable vacuum buffer access strategy; # range 128kB to 16GB # SLRU buffers (change requires restart) #commit_timestamp_buffers = 0 # memory for pg_commit_ts (0 = auto) #multixact_offset_buffers = 16 # memory for pg_multixact/offsets #multixact_member_buffers = 32 # memory for pg_multixact/members #notify_buffers = 16 # memory for pg_notify #serializable_buffers = 32 # memory for pg_serial #subtransaction_buffers = 0 # memory for pg_subtrans (0 = auto) #transaction_buffers = 0 # memory for pg_xact (0 = auto) # - Disk - #temp_file_limit = -1 # limits per-process temp file space # in kilobytes, or -1 for no limit #max_notify_queue_pages = 1048576 # limits the number of SLRU pages allocated # for NOTIFY / LISTEN queue # - Kernel Resources - #max_files_per_process = 1000 # min 64 # (change requires restart) # - Cost-Based Vacuum Delay - #vacuum_cost_delay = 0 # 0-100 milliseconds (0 disables) #vacuum_cost_page_hit = 1 # 0-10000 credits #vacuum_cost_page_miss = 2 # 0-10000 credits #vacuum_cost_page_dirty = 20 # 0-10000 credits #vacuum_cost_limit = 200 # 1-10000 credits # - Background Writer - #bgwriter_delay = 200ms # 10-10000ms between rounds #bgwriter_lru_maxpages = 100 # max buffers written/round, 0 disables #bgwriter_lru_multiplier = 2.0 # 0-10.0 multiplier on buffers scanned/round #bgwriter_flush_after = 0 # measured in pages, 0 disables # - Asynchronous Behavior - #backend_flush_after = 0 # measured in pages, 0 disables #effective_io_concurrency = 1 # 1-1000; 0 disables prefetching #maintenance_io_concurrency = 10 # 1-1000; 0 disables prefetching #io_combine_limit = 128kB # usually 1-32 blocks (depends on OS) #max_worker_processes = 8 # (change requires restart) #max_parallel_workers_per_gather = 2 # limited by max_parallel_workers #max_parallel_maintenance_workers = 2 # limited by max_parallel_workers #max_parallel_workers = 8 # number of max_worker_processes that # can be used in parallel operations #parallel_leader_participation = on #------------------------------------------------------------------------------ # WRITE-AHEAD LOG #------------------------------------------------------------------------------ # - Settings - #wal_level = replica # minimal, replica, or logical # (change requires restart) #fsync = on # flush data to disk for crash safety # (turning this off can cause # unrecoverable data corruption) #synchronous_commit = on # synchronization level; # off, local, remote_write, remote_apply, or on #wal_sync_method = fsync # the default is the first option # supported by the operating system: # open_datasync # fdatasync (default on Linux and FreeBSD) # fsync # fsync_writethrough # open_sync #full_page_writes = on # recover from partial page writes #wal_log_hints = off # also do full page writes of non-critical updates # (change requires restart) #wal_compression = off # enables compression of full-page writes; # off, pglz, lz4, zstd, or on #wal_init_zero = on # zero-fill new WAL files #wal_recycle = on # recycle WAL files #wal_buffers = -1 # min 32kB, -1 sets based on shared_buffers # (change requires restart) #wal_writer_delay = 200ms # 1-10000 milliseconds #wal_writer_flush_after = 1MB # measured in pages, 0 disables #wal_skip_threshold = 2MB #commit_delay = 0 # range 0-100000, in microseconds #commit_siblings = 5 # range 1-1000 # - Checkpoints - #checkpoint_timeout = 5min # range 30s-1d #checkpoint_completion_target = 0.9 # checkpoint target duration, 0.0 - 1.0 #checkpoint_flush_after = 0 # measured in pages, 0 disables #checkpoint_warning = 30s # 0 disables #max_wal_size = 1GB #min_wal_size = 80MB # - Prefetching during recovery - #recovery_prefetch = try # prefetch pages referenced in the WAL? #wal_decode_buffer_size = 512kB # lookahead window used for prefetching # (change requires restart) # - Archiving - #archive_mode = off # enables archiving; off, on, or always # (change requires restart) #archive_library = '' # library to use to archive a WAL file # (empty string indicates archive_command should # be used) #archive_command = '' # command to use to archive a WAL file # placeholders: %p = path of file to archive # %f = file name only # e.g. 'test ! -f /mnt/server/archivedir/%f && cp %p /mnt/server/archivedir/%f' #archive_timeout = 0 # force a WAL file switch after this # number of seconds; 0 disables # - Archive Recovery - # These are only used in recovery mode. #restore_command = '' # command to use to restore an archived WAL file # placeholders: %p = path of file to restore # %f = file name only # e.g. 'cp /mnt/server/archivedir/%f %p' #archive_cleanup_command = '' # command to execute at every restartpoint #recovery_end_command = '' # command to execute at completion of recovery # - Recovery Target - # Set these only when performing a targeted recovery. #recovery_target = '' # 'immediate' to end recovery as soon as a # consistent state is reached # (change requires restart) #recovery_target_name = '' # the named restore point to which recovery will proceed # (change requires restart) #recovery_target_time = '' # the time stamp up to which recovery will proceed # (change requires restart) #recovery_target_xid = '' # the transaction ID up to which recovery will proceed # (change requires restart) #recovery_target_lsn = '' # the WAL LSN up to which recovery will proceed # (change requires restart) #recovery_target_inclusive = on # Specifies whether to stop: # just after the specified recovery target (on) # just before the recovery target (off) # (change requires restart) #recovery_target_timeline = 'latest' # 'current', 'latest', or timeline ID # (change requires restart) #recovery_target_action = 'pause' # 'pause', 'promote', 'shutdown' # (change requires restart) # - WAL Summarization - #summarize_wal = off # run WAL summarizer process? #wal_summary_keep_time = '10d' # when to remove old summary files, 0 = never #------------------------------------------------------------------------------ # REPLICATION #------------------------------------------------------------------------------ # - Sending Servers - # Set these on the primary and on any standby that will send replication data. #max_wal_senders = 10 # max number of walsender processes # (change requires restart) #max_replication_slots = 10 # max number of replication slots # (change requires restart) #wal_keep_size = 0 # in megabytes; 0 disables #max_slot_wal_keep_size = -1 # in megabytes; -1 disables #wal_sender_timeout = 60s # in milliseconds; 0 disables #track_commit_timestamp = off # collect timestamp of transaction commit # (change requires restart) # - Primary Server - # These settings are ignored on a standby server. #synchronous_standby_names = '' # standby servers that provide sync rep # method to choose sync standbys, number of sync standbys, # and comma-separated list of application_name # from standby(s); '*' = all #synchronized_standby_slots = '' # streaming replication standby server slot # names that logical walsender processes will wait for # - Standby Servers - # These settings are ignored on a primary server. #primary_conninfo = '' # connection string to sending server #primary_slot_name = '' # replication slot on sending server #hot_standby = on # "off" disallows queries during recovery # (change requires restart) #max_standby_archive_delay = 30s # max delay before canceling queries # when reading WAL from archive; # -1 allows indefinite delay #max_standby_streaming_delay = 30s # max delay before canceling queries # when reading streaming WAL; # -1 allows indefinite delay #wal_receiver_create_temp_slot = off # create temp slot if primary_slot_name # is not set #wal_receiver_status_interval = 10s # send replies at least this often # 0 disables #hot_standby_feedback = off # send info from standby to prevent # query conflicts #wal_receiver_timeout = 60s # time that receiver waits for # communication from primary # in milliseconds; 0 disables #wal_retrieve_retry_interval = 5s # time to wait before retrying to # retrieve WAL after a failed attempt #recovery_min_apply_delay = 0 # minimum delay for applying changes during recovery #sync_replication_slots = off # enables slot synchronization on the physical standby from the primary # - Subscribers - # These settings are ignored on a publisher. #max_logical_replication_workers = 4 # taken from max_worker_processes # (change requires restart) #max_sync_workers_per_subscription = 2 # taken from max_logical_replication_workers #max_parallel_apply_workers_per_subscription = 2 # taken from max_logical_replication_workers #------------------------------------------------------------------------------ # QUERY TUNING #------------------------------------------------------------------------------ # - Planner Method Configuration - #enable_async_append = on #enable_bitmapscan = on #enable_gathermerge = on #enable_hashagg = on #enable_hashjoin = on #enable_incremental_sort = on #enable_indexscan = on #enable_indexonlyscan = on #enable_material = on #enable_memoize = on #enable_mergejoin = on #enable_nestloop = on #enable_parallel_append = on #enable_parallel_hash = on #enable_partition_pruning = on #enable_partitionwise_join = off #enable_partitionwise_aggregate = off #enable_presorted_aggregate = on #enable_seqscan = on #enable_sort = on #enable_tidscan = on #enable_group_by_reordering = on # - Planner Cost Constants - #seq_page_cost = 1.0 # measured on an arbitrary scale #random_page_cost = 4.0 # same scale as above #cpu_tuple_cost = 0.01 # same scale as above #cpu_index_tuple_cost = 0.005 # same scale as above #cpu_operator_cost = 0.0025 # same scale as above #parallel_setup_cost = 1000.0 # same scale as above #parallel_tuple_cost = 0.1 # same scale as above #min_parallel_table_scan_size = 8MB #min_parallel_index_scan_size = 512kB #effective_cache_size = 4GB #jit_above_cost = 100000 # perform JIT compilation if available # and query more expensive than this; # -1 disables #jit_inline_above_cost = 500000 # inline small functions if query is # more expensive than this; -1 disables #jit_optimize_above_cost = 500000 # use expensive JIT optimizations if # query is more expensive than this; # -1 disables # - Genetic Query Optimizer - #geqo = on #geqo_threshold = 12 #geqo_effort = 5 # range 1-10 #geqo_pool_size = 0 # selects default based on effort #geqo_generations = 0 # selects default based on effort #geqo_selection_bias = 2.0 # range 1.5-2.0 #geqo_seed = 0.0 # range 0.0-1.0 # - Other Planner Options - #default_statistics_target = 100 # range 1-10000 #constraint_exclusion = partition # on, off, or partition #cursor_tuple_fraction = 0.1 # range 0.0-1.0 #from_collapse_limit = 8 #jit = on # allow JIT compilation #join_collapse_limit = 8 # 1 disables collapsing of explicit # JOIN clauses #plan_cache_mode = auto # auto, force_generic_plan or # force_custom_plan #recursive_worktable_factor = 10.0 # range 0.001-1000000 #------------------------------------------------------------------------------ # REPORTING AND LOGGING #------------------------------------------------------------------------------ # - Where to Log - #log_destination = 'stderr' # Valid values are combinations of # stderr, csvlog, jsonlog, syslog, and # eventlog, depending on platform. # csvlog and jsonlog require # logging_collector to be on. # This is used when logging to stderr: #logging_collector = off # Enable capturing of stderr, jsonlog, # and csvlog into log files. Required # to be on for csvlogs and jsonlogs. # (change requires restart) # These are only used if logging_collector is on: #log_directory = 'log' # directory where log files are written, # can be absolute or relative to PGDATA #log_filename = 'postgresql-%Y-%m-%d_%H%M%S.log' # log file name pattern, # can include strftime() escapes #log_file_mode = 0600 # creation mode for log files, # begin with 0 to use octal notation #log_rotation_age = 1d # Automatic rotation of logfiles will # happen after that time. 0 disables. #log_rotation_size = 10MB # Automatic rotation of logfiles will # happen after that much log output. # 0 disables. #log_truncate_on_rotation = off # If on, an existing log file with the # same name as the new log file will be # truncated rather than appended to. # But such truncation only occurs on # time-driven rotation, not on restarts # or size-driven rotation. Default is # off, meaning append to existing files # in all cases. # These are relevant when logging to syslog: #syslog_facility = 'LOCAL0' #syslog_ident = 'postgres' #syslog_sequence_numbers = on #syslog_split_messages = on # This is only relevant when logging to eventlog (Windows): # (change requires restart) #event_source = 'PostgreSQL' # - When to Log - #log_min_messages = warning # values in order of decreasing detail: # debug5 # debug4 # debug3 # debug2 # debug1 # info # notice # warning # error # log # fatal # panic #log_min_error_statement = error # values in order of decreasing detail: # debug5 # debug4 # debug3 # debug2 # debug1 # info # notice # warning # error # log # fatal # panic (effectively off) #log_min_duration_statement = -1 # -1 is disabled, 0 logs all statements # and their durations, > 0 logs only # statements running at least this number # of milliseconds #log_min_duration_sample = -1 # -1 is disabled, 0 logs a sample of statements # and their durations, > 0 logs only a sample of # statements running at least this number # of milliseconds; # sample fraction is determined by log_statement_sample_rate #log_statement_sample_rate = 1.0 # fraction of logged statements exceeding # log_min_duration_sample to be logged; # 1.0 logs all such statements, 0.0 never logs #log_transaction_sample_rate = 0.0 # fraction of transactions whose statements # are logged regardless of their duration; 1.0 logs all # statements from all transactions, 0.0 never logs #log_startup_progress_interval = 10s # Time between progress updates for # long-running startup operations. # 0 disables the feature, > 0 indicates # the interval in milliseconds. # - What to Log - #debug_print_parse = off #debug_print_rewritten = off #debug_print_plan = off #debug_pretty_print = on #log_autovacuum_min_duration = 10min # log autovacuum activity; # -1 disables, 0 logs all actions and # their durations, > 0 logs only # actions running at least this number # of milliseconds. #log_checkpoints = on #log_connections = off #log_disconnections = off #log_duration = off #log_error_verbosity = default # terse, default, or verbose messages #log_hostname = off #log_line_prefix = '%m [%p] ' # special values: # %a = application name # %u = user name # %d = database name # %r = remote host and port # %h = remote host # %b = backend type # %p = process ID # %P = process ID of parallel group leader # %t = timestamp without milliseconds # %m = timestamp with milliseconds # %n = timestamp with milliseconds (as a Unix epoch) # %Q = query ID (0 if none or not computed) # %i = command tag # %e = SQL state # %c = session ID # %l = session line number # %s = session start timestamp # %v = virtual transaction ID # %x = transaction ID (0 if none) # %q = stop here in non-session # processes # %% = '%' # e.g. '<%u%%%d> ' #log_lock_waits = off # log lock waits >= deadlock_timeout #log_recovery_conflict_waits = off # log standby recovery conflict waits # >= deadlock_timeout #log_parameter_max_length = -1 # when logging statements, limit logged # bind-parameter values to N bytes; # -1 means print in full, 0 disables #log_parameter_max_length_on_error = 0 # when logging an error, limit logged # bind-parameter values to N bytes; # -1 means print in full, 0 disables #log_statement = 'none' # none, ddl, mod, all #log_replication_commands = off #log_temp_files = -1 # log temporary files equal or larger # than the specified size in kilobytes; # -1 disables, 0 logs all temp files #log_timezone = 'GMT' # - Process Title - #cluster_name = '' # added to process titles if nonempty # (change requires restart) #update_process_title = on #------------------------------------------------------------------------------ # STATISTICS #------------------------------------------------------------------------------ # - Cumulative Query and Index Statistics - #track_activities = on #track_activity_query_size = 1024 # (change requires restart) #track_counts = on #track_io_timing = off #track_wal_io_timing = off #track_functions = none # none, pl, all #stats_fetch_consistency = cache # cache, none, snapshot # - Monitoring - #compute_query_id = auto #log_statement_stats = off #log_parser_stats = off #log_planner_stats = off #log_executor_stats = off #------------------------------------------------------------------------------ # AUTOVACUUM #------------------------------------------------------------------------------ #autovacuum = on # Enable autovacuum subprocess? 'on' # requires track_counts to also be on. #autovacuum_max_workers = 3 # max number of autovacuum subprocesses # (change requires restart) #autovacuum_naptime = 1min # time between autovacuum runs #autovacuum_vacuum_threshold = 50 # min number of row updates before # vacuum #autovacuum_vacuum_insert_threshold = 1000 # min number of row inserts # before vacuum; -1 disables insert # vacuums #autovacuum_analyze_threshold = 50 # min number of row updates before # analyze #autovacuum_vacuum_scale_factor = 0.2 # fraction of table size before vacuum #autovacuum_vacuum_insert_scale_factor = 0.2 # fraction of inserts over table # size before insert vacuum #autovacuum_analyze_scale_factor = 0.1 # fraction of table size before analyze #autovacuum_freeze_max_age = 200000000 # maximum XID age before forced vacuum # (change requires restart) #autovacuum_multixact_freeze_max_age = 400000000 # maximum multixact age # before forced vacuum # (change requires restart) #autovacuum_vacuum_cost_delay = 2ms # default vacuum cost delay for # autovacuum, in milliseconds; # -1 means use vacuum_cost_delay #autovacuum_vacuum_cost_limit = -1 # default vacuum cost limit for # autovacuum, -1 means use # vacuum_cost_limit #------------------------------------------------------------------------------ # CLIENT CONNECTION DEFAULTS #------------------------------------------------------------------------------ # - Statement Behavior - #client_min_messages = notice # values in order of decreasing detail: # debug5 # debug4 # debug3 # debug2 # debug1 # log # notice # warning # error #search_path = '"$user", public' # schema names #row_security = on #default_table_access_method = 'heap' #default_tablespace = '' # a tablespace name, '' uses the default #default_toast_compression = 'pglz' # 'pglz' or 'lz4' #temp_tablespaces = '' # a list of tablespace names, '' uses # only default tablespace #check_function_bodies = on #default_transaction_isolation = 'read committed' #default_transaction_read_only = off #default_transaction_deferrable = off #session_replication_role = 'origin' #statement_timeout = 0 # in milliseconds, 0 is disabled #transaction_timeout = 0 # in milliseconds, 0 is disabled #lock_timeout = 0 # in milliseconds, 0 is disabled #idle_in_transaction_session_timeout = 0 # in milliseconds, 0 is disabled #idle_session_timeout = 0 # in milliseconds, 0 is disabled #vacuum_freeze_table_age = 150000000 #vacuum_freeze_min_age = 50000000 #vacuum_failsafe_age = 1600000000 #vacuum_multixact_freeze_table_age = 150000000 #vacuum_multixact_freeze_min_age = 5000000 #vacuum_multixact_failsafe_age = 1600000000 #bytea_output = 'hex' # hex, escape #xmlbinary = 'base64' #xmloption = 'content' #gin_pending_list_limit = 4MB #createrole_self_grant = '' # set and/or inherit #event_triggers = on # - Locale and Formatting - #datestyle = 'iso, mdy' #intervalstyle = 'postgres' #timezone = 'GMT' #timezone_abbreviations = 'Default' # Select the set of available time zone # abbreviations. Currently, there are # Default # Australia (historical usage) # India # You can create your own file in # share/timezonesets/. #extra_float_digits = 1 # min -15, max 3; any value >0 actually # selects precise output mode #client_encoding = sql_ascii # actually, defaults to database # encoding # These settings are initialized by initdb, but they can be changed. #lc_messages = '' # locale for system error message # strings #lc_monetary = 'C' # locale for monetary formatting #lc_numeric = 'C' # locale for number formatting #lc_time = 'C' # locale for time formatting #icu_validation_level = warning # report ICU locale validation # errors at the given level # default configuration for text search #default_text_search_config = 'pg_catalog.simple' # - Shared Library Preloading - #local_preload_libraries = '' #session_preload_libraries = '' #shared_preload_libraries = '' # (change requires restart) #jit_provider = 'llvmjit' # JIT library to use # - Other Defaults - #dynamic_library_path = '$libdir' #gin_fuzzy_search_limit = 0 #------------------------------------------------------------------------------ # LOCK MANAGEMENT #------------------------------------------------------------------------------ #deadlock_timeout = 1s #max_locks_per_transaction = 64 # min 10 # (change requires restart) #max_pred_locks_per_transaction = 64 # min 10 # (change requires restart) #max_pred_locks_per_relation = -2 # negative values mean # (max_pred_locks_per_transaction # / -max_pred_locks_per_relation) - 1 #max_pred_locks_per_page = 2 # min 0 #------------------------------------------------------------------------------ # VERSION AND PLATFORM COMPATIBILITY #------------------------------------------------------------------------------ # - Previous PostgreSQL Versions - #array_nulls = on #backslash_quote = safe_encoding # on, off, or safe_encoding #escape_string_warning = on #lo_compat_privileges = off #quote_all_identifiers = off #standard_conforming_strings = on #synchronize_seqscans = on # - Other Platforms and Clients - #transform_null_equals = off #allow_alter_system = on #------------------------------------------------------------------------------ # ERROR HANDLING #------------------------------------------------------------------------------ #exit_on_error = off # terminate session on any error? #restart_after_crash = on # reinitialize after backend crash? #data_sync_retry = off # retry or panic on failure to fsync # data? # (change requires restart) #recovery_init_sync_method = fsync # fsync, syncfs (Linux 5.8+) #------------------------------------------------------------------------------ # CONFIG FILE INCLUDES #------------------------------------------------------------------------------ # These options allow settings to be loaded from files other than the # default postgresql.conf. Note that these are directives, not variable # assignments, so they can usefully be given more than once. #include_dir = '...' # include files ending in '.conf' from # a directory, e.g., 'conf.d' #include_if_exists = '...' # include file only if it exists #include = '...' # include file #------------------------------------------------------------------------------ # CUSTOMIZED OPTIONS #------------------------------------------------------------------------------ # Add settings for extensions here -- -- system-wide psql configuration file -- -- This file is read before the .psqlrc file in the user's home directory. -- -- Copy this to your installation's sysconf directory and rename it psqlrc. -- The sysconf directory can be identified via "pg_config --sysconfdir". -- -- Language-specific snowball dictionaries /* * Create underlying C functions for Snowball stemmers * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball_func.sql.in * * This file is combined with multiple instances of snowball.sql.in to * build snowball_create.sql, which is executed during initdb. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ SET search_path = pg_catalog; CREATE FUNCTION dsnowball_init(INTERNAL) RETURNS INTERNAL AS '$libdir/dict_snowball', 'dsnowball_init' LANGUAGE C STRICT; CREATE FUNCTION dsnowball_lexize(INTERNAL, INTERNAL, INTERNAL, INTERNAL) RETURNS INTERNAL AS '$libdir/dict_snowball', 'dsnowball_lexize' LANGUAGE C STRICT; CREATE TEXT SEARCH TEMPLATE snowball (INIT = dsnowball_init, LEXIZE = dsnowball_lexize); COMMENT ON TEXT SEARCH TEMPLATE snowball IS 'snowball stemmer'; /* * text search configuration for arabic language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * arabic and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY arabic_stem (TEMPLATE = snowball, Language = arabic ); COMMENT ON TEXT SEARCH DICTIONARY arabic_stem IS 'snowball stemmer for arabic language'; CREATE TEXT SEARCH CONFIGURATION arabic (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION arabic IS 'configuration for arabic language'; ALTER TEXT SEARCH CONFIGURATION arabic ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION arabic ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH arabic_stem; ALTER TEXT SEARCH CONFIGURATION arabic ADD MAPPING FOR word, hword_part, hword WITH arabic_stem; /* * text search configuration for armenian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * armenian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY armenian_stem (TEMPLATE = snowball, Language = armenian ); COMMENT ON TEXT SEARCH DICTIONARY armenian_stem IS 'snowball stemmer for armenian language'; CREATE TEXT SEARCH CONFIGURATION armenian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION armenian IS 'configuration for armenian language'; ALTER TEXT SEARCH CONFIGURATION armenian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION armenian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH armenian_stem; ALTER TEXT SEARCH CONFIGURATION armenian ADD MAPPING FOR word, hword_part, hword WITH armenian_stem; /* * text search configuration for basque language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * basque and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY basque_stem (TEMPLATE = snowball, Language = basque ); COMMENT ON TEXT SEARCH DICTIONARY basque_stem IS 'snowball stemmer for basque language'; CREATE TEXT SEARCH CONFIGURATION basque (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION basque IS 'configuration for basque language'; ALTER TEXT SEARCH CONFIGURATION basque ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION basque ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH basque_stem; ALTER TEXT SEARCH CONFIGURATION basque ADD MAPPING FOR word, hword_part, hword WITH basque_stem; /* * text search configuration for catalan language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * catalan and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY catalan_stem (TEMPLATE = snowball, Language = catalan ); COMMENT ON TEXT SEARCH DICTIONARY catalan_stem IS 'snowball stemmer for catalan language'; CREATE TEXT SEARCH CONFIGURATION catalan (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION catalan IS 'configuration for catalan language'; ALTER TEXT SEARCH CONFIGURATION catalan ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION catalan ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH catalan_stem; ALTER TEXT SEARCH CONFIGURATION catalan ADD MAPPING FOR word, hword_part, hword WITH catalan_stem; /* * text search configuration for danish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * danish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY danish_stem (TEMPLATE = snowball, Language = danish , StopWords=danish); COMMENT ON TEXT SEARCH DICTIONARY danish_stem IS 'snowball stemmer for danish language'; CREATE TEXT SEARCH CONFIGURATION danish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION danish IS 'configuration for danish language'; ALTER TEXT SEARCH CONFIGURATION danish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION danish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH danish_stem; ALTER TEXT SEARCH CONFIGURATION danish ADD MAPPING FOR word, hword_part, hword WITH danish_stem; /* * text search configuration for dutch language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * dutch and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY dutch_stem (TEMPLATE = snowball, Language = dutch , StopWords=dutch); COMMENT ON TEXT SEARCH DICTIONARY dutch_stem IS 'snowball stemmer for dutch language'; CREATE TEXT SEARCH CONFIGURATION dutch (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION dutch IS 'configuration for dutch language'; ALTER TEXT SEARCH CONFIGURATION dutch ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION dutch ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH dutch_stem; ALTER TEXT SEARCH CONFIGURATION dutch ADD MAPPING FOR word, hword_part, hword WITH dutch_stem; /* * text search configuration for english language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * english and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY english_stem (TEMPLATE = snowball, Language = english , StopWords=english); COMMENT ON TEXT SEARCH DICTIONARY english_stem IS 'snowball stemmer for english language'; CREATE TEXT SEARCH CONFIGURATION english (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION english IS 'configuration for english language'; ALTER TEXT SEARCH CONFIGURATION english ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION english ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH english_stem; ALTER TEXT SEARCH CONFIGURATION english ADD MAPPING FOR word, hword_part, hword WITH english_stem; /* * text search configuration for finnish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * finnish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY finnish_stem (TEMPLATE = snowball, Language = finnish , StopWords=finnish); COMMENT ON TEXT SEARCH DICTIONARY finnish_stem IS 'snowball stemmer for finnish language'; CREATE TEXT SEARCH CONFIGURATION finnish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION finnish IS 'configuration for finnish language'; ALTER TEXT SEARCH CONFIGURATION finnish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION finnish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH finnish_stem; ALTER TEXT SEARCH CONFIGURATION finnish ADD MAPPING FOR word, hword_part, hword WITH finnish_stem; /* * text search configuration for french language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * french and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY french_stem (TEMPLATE = snowball, Language = french , StopWords=french); COMMENT ON TEXT SEARCH DICTIONARY french_stem IS 'snowball stemmer for french language'; CREATE TEXT SEARCH CONFIGURATION french (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION french IS 'configuration for french language'; ALTER TEXT SEARCH CONFIGURATION french ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION french ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH french_stem; ALTER TEXT SEARCH CONFIGURATION french ADD MAPPING FOR word, hword_part, hword WITH french_stem; /* * text search configuration for german language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * german and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY german_stem (TEMPLATE = snowball, Language = german , StopWords=german); COMMENT ON TEXT SEARCH DICTIONARY german_stem IS 'snowball stemmer for german language'; CREATE TEXT SEARCH CONFIGURATION german (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION german IS 'configuration for german language'; ALTER TEXT SEARCH CONFIGURATION german ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION german ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH german_stem; ALTER TEXT SEARCH CONFIGURATION german ADD MAPPING FOR word, hword_part, hword WITH german_stem; /* * text search configuration for greek language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * greek and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY greek_stem (TEMPLATE = snowball, Language = greek ); COMMENT ON TEXT SEARCH DICTIONARY greek_stem IS 'snowball stemmer for greek language'; CREATE TEXT SEARCH CONFIGURATION greek (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION greek IS 'configuration for greek language'; ALTER TEXT SEARCH CONFIGURATION greek ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION greek ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH greek_stem; ALTER TEXT SEARCH CONFIGURATION greek ADD MAPPING FOR word, hword_part, hword WITH greek_stem; /* * text search configuration for hindi language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * hindi and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY hindi_stem (TEMPLATE = snowball, Language = hindi ); COMMENT ON TEXT SEARCH DICTIONARY hindi_stem IS 'snowball stemmer for hindi language'; CREATE TEXT SEARCH CONFIGURATION hindi (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION hindi IS 'configuration for hindi language'; ALTER TEXT SEARCH CONFIGURATION hindi ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION hindi ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH english_stem; ALTER TEXT SEARCH CONFIGURATION hindi ADD MAPPING FOR word, hword_part, hword WITH hindi_stem; /* * text search configuration for hungarian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * hungarian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY hungarian_stem (TEMPLATE = snowball, Language = hungarian , StopWords=hungarian); COMMENT ON TEXT SEARCH DICTIONARY hungarian_stem IS 'snowball stemmer for hungarian language'; CREATE TEXT SEARCH CONFIGURATION hungarian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION hungarian IS 'configuration for hungarian language'; ALTER TEXT SEARCH CONFIGURATION hungarian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION hungarian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH hungarian_stem; ALTER TEXT SEARCH CONFIGURATION hungarian ADD MAPPING FOR word, hword_part, hword WITH hungarian_stem; /* * text search configuration for indonesian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * indonesian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY indonesian_stem (TEMPLATE = snowball, Language = indonesian ); COMMENT ON TEXT SEARCH DICTIONARY indonesian_stem IS 'snowball stemmer for indonesian language'; CREATE TEXT SEARCH CONFIGURATION indonesian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION indonesian IS 'configuration for indonesian language'; ALTER TEXT SEARCH CONFIGURATION indonesian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION indonesian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH indonesian_stem; ALTER TEXT SEARCH CONFIGURATION indonesian ADD MAPPING FOR word, hword_part, hword WITH indonesian_stem; /* * text search configuration for irish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * irish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY irish_stem (TEMPLATE = snowball, Language = irish ); COMMENT ON TEXT SEARCH DICTIONARY irish_stem IS 'snowball stemmer for irish language'; CREATE TEXT SEARCH CONFIGURATION irish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION irish IS 'configuration for irish language'; ALTER TEXT SEARCH CONFIGURATION irish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION irish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH irish_stem; ALTER TEXT SEARCH CONFIGURATION irish ADD MAPPING FOR word, hword_part, hword WITH irish_stem; /* * text search configuration for italian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * italian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY italian_stem (TEMPLATE = snowball, Language = italian , StopWords=italian); COMMENT ON TEXT SEARCH DICTIONARY italian_stem IS 'snowball stemmer for italian language'; CREATE TEXT SEARCH CONFIGURATION italian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION italian IS 'configuration for italian language'; ALTER TEXT SEARCH CONFIGURATION italian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION italian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH italian_stem; ALTER TEXT SEARCH CONFIGURATION italian ADD MAPPING FOR word, hword_part, hword WITH italian_stem; /* * text search configuration for lithuanian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * lithuanian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY lithuanian_stem (TEMPLATE = snowball, Language = lithuanian ); COMMENT ON TEXT SEARCH DICTIONARY lithuanian_stem IS 'snowball stemmer for lithuanian language'; CREATE TEXT SEARCH CONFIGURATION lithuanian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION lithuanian IS 'configuration for lithuanian language'; ALTER TEXT SEARCH CONFIGURATION lithuanian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION lithuanian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH lithuanian_stem; ALTER TEXT SEARCH CONFIGURATION lithuanian ADD MAPPING FOR word, hword_part, hword WITH lithuanian_stem; /* * text search configuration for nepali language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * nepali and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY nepali_stem (TEMPLATE = snowball, Language = nepali , StopWords=nepali); COMMENT ON TEXT SEARCH DICTIONARY nepali_stem IS 'snowball stemmer for nepali language'; CREATE TEXT SEARCH CONFIGURATION nepali (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION nepali IS 'configuration for nepali language'; ALTER TEXT SEARCH CONFIGURATION nepali ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION nepali ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH nepali_stem; ALTER TEXT SEARCH CONFIGURATION nepali ADD MAPPING FOR word, hword_part, hword WITH nepali_stem; /* * text search configuration for norwegian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * norwegian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY norwegian_stem (TEMPLATE = snowball, Language = norwegian , StopWords=norwegian); COMMENT ON TEXT SEARCH DICTIONARY norwegian_stem IS 'snowball stemmer for norwegian language'; CREATE TEXT SEARCH CONFIGURATION norwegian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION norwegian IS 'configuration for norwegian language'; ALTER TEXT SEARCH CONFIGURATION norwegian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION norwegian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH norwegian_stem; ALTER TEXT SEARCH CONFIGURATION norwegian ADD MAPPING FOR word, hword_part, hword WITH norwegian_stem; /* * text search configuration for portuguese language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * portuguese and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY portuguese_stem (TEMPLATE = snowball, Language = portuguese , StopWords=portuguese); COMMENT ON TEXT SEARCH DICTIONARY portuguese_stem IS 'snowball stemmer for portuguese language'; CREATE TEXT SEARCH CONFIGURATION portuguese (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION portuguese IS 'configuration for portuguese language'; ALTER TEXT SEARCH CONFIGURATION portuguese ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION portuguese ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH portuguese_stem; ALTER TEXT SEARCH CONFIGURATION portuguese ADD MAPPING FOR word, hword_part, hword WITH portuguese_stem; /* * text search configuration for romanian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * romanian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY romanian_stem (TEMPLATE = snowball, Language = romanian ); COMMENT ON TEXT SEARCH DICTIONARY romanian_stem IS 'snowball stemmer for romanian language'; CREATE TEXT SEARCH CONFIGURATION romanian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION romanian IS 'configuration for romanian language'; ALTER TEXT SEARCH CONFIGURATION romanian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION romanian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH romanian_stem; ALTER TEXT SEARCH CONFIGURATION romanian ADD MAPPING FOR word, hword_part, hword WITH romanian_stem; /* * text search configuration for russian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * russian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY russian_stem (TEMPLATE = snowball, Language = russian , StopWords=russian); COMMENT ON TEXT SEARCH DICTIONARY russian_stem IS 'snowball stemmer for russian language'; CREATE TEXT SEARCH CONFIGURATION russian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION russian IS 'configuration for russian language'; ALTER TEXT SEARCH CONFIGURATION russian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION russian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH english_stem; ALTER TEXT SEARCH CONFIGURATION russian ADD MAPPING FOR word, hword_part, hword WITH russian_stem; /* * text search configuration for serbian language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * serbian and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY serbian_stem (TEMPLATE = snowball, Language = serbian ); COMMENT ON TEXT SEARCH DICTIONARY serbian_stem IS 'snowball stemmer for serbian language'; CREATE TEXT SEARCH CONFIGURATION serbian (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION serbian IS 'configuration for serbian language'; ALTER TEXT SEARCH CONFIGURATION serbian ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION serbian ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH serbian_stem; ALTER TEXT SEARCH CONFIGURATION serbian ADD MAPPING FOR word, hword_part, hword WITH serbian_stem; /* * text search configuration for spanish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * spanish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY spanish_stem (TEMPLATE = snowball, Language = spanish , StopWords=spanish); COMMENT ON TEXT SEARCH DICTIONARY spanish_stem IS 'snowball stemmer for spanish language'; CREATE TEXT SEARCH CONFIGURATION spanish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION spanish IS 'configuration for spanish language'; ALTER TEXT SEARCH CONFIGURATION spanish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION spanish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH spanish_stem; ALTER TEXT SEARCH CONFIGURATION spanish ADD MAPPING FOR word, hword_part, hword WITH spanish_stem; /* * text search configuration for swedish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * swedish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY swedish_stem (TEMPLATE = snowball, Language = swedish , StopWords=swedish); COMMENT ON TEXT SEARCH DICTIONARY swedish_stem IS 'snowball stemmer for swedish language'; CREATE TEXT SEARCH CONFIGURATION swedish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION swedish IS 'configuration for swedish language'; ALTER TEXT SEARCH CONFIGURATION swedish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION swedish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH swedish_stem; ALTER TEXT SEARCH CONFIGURATION swedish ADD MAPPING FOR word, hword_part, hword WITH swedish_stem; /* * text search configuration for tamil language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * tamil and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY tamil_stem (TEMPLATE = snowball, Language = tamil ); COMMENT ON TEXT SEARCH DICTIONARY tamil_stem IS 'snowball stemmer for tamil language'; CREATE TEXT SEARCH CONFIGURATION tamil (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION tamil IS 'configuration for tamil language'; ALTER TEXT SEARCH CONFIGURATION tamil ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION tamil ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH tamil_stem; ALTER TEXT SEARCH CONFIGURATION tamil ADD MAPPING FOR word, hword_part, hword WITH tamil_stem; /* * text search configuration for turkish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * turkish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY turkish_stem (TEMPLATE = snowball, Language = turkish , StopWords=turkish); COMMENT ON TEXT SEARCH DICTIONARY turkish_stem IS 'snowball stemmer for turkish language'; CREATE TEXT SEARCH CONFIGURATION turkish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION turkish IS 'configuration for turkish language'; ALTER TEXT SEARCH CONFIGURATION turkish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION turkish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH turkish_stem; ALTER TEXT SEARCH CONFIGURATION turkish ADD MAPPING FOR word, hword_part, hword WITH turkish_stem; /* * text search configuration for yiddish language * * Copyright (c) 2007-2024, PostgreSQL Global Development Group * * src/backend/snowball/snowball.sql.in * * yiddish and certain other macros are replaced for each language; * see the Makefile for details. * * Note: this file is read in single-user -j mode, which means that the * command terminator is semicolon-newline-newline; whenever the backend * sees that, it stops and executes what it's got. If you write a lot of * statements without empty lines between, they'll all get quoted to you * in any error message about one of them, so don't do that. Also, you * cannot write a semicolon immediately followed by an empty line in a * string literal (including a function body!) or a multiline comment. */ CREATE TEXT SEARCH DICTIONARY yiddish_stem (TEMPLATE = snowball, Language = yiddish ); COMMENT ON TEXT SEARCH DICTIONARY yiddish_stem IS 'snowball stemmer for yiddish language'; CREATE TEXT SEARCH CONFIGURATION yiddish (PARSER = default); COMMENT ON TEXT SEARCH CONFIGURATION yiddish IS 'configuration for yiddish language'; ALTER TEXT SEARCH CONFIGURATION yiddish ADD MAPPING FOR email, url, url_path, host, file, version, sfloat, float, int, uint, numword, hword_numpart, numhword WITH simple; ALTER TEXT SEARCH CONFIGURATION yiddish ADD MAPPING FOR asciiword, hword_asciipart, asciihword WITH yiddish_stem; ALTER TEXT SEARCH CONFIGURATION yiddish ADD MAPPING FOR word, hword_part, hword WITH yiddish_stem; B011 Embedded Ada NO B012 Embedded C YES B013 Embedded COBOL NO B014 Embedded Fortran NO B015 Embedded MUMPS NO B016 Embedded Pascal NO B017 Embedded PL/I NO B021 Direct SQL YES B030 Enhanced dynamic SQL NO B031 Basic dynamic SQL NO B032 Extended dynamic SQL NO B033 Untyped SQL-invoked function arguments NO B034 Dynamic specification of cursor attributes NO B035 Non-extended descriptor names NO B036 Describe input statement NO B041 Extensions to embedded SQL exception declarations NO B051 Enhanced execution rights NO B111 Module language Ada NO B112 Module language C NO B113 Module language COBOL NO B114 Module language Fortran NO B115 Module language MUMPS NO B116 Module language Pascal NO B117 Module language PL/I NO B121 Routine language Ada NO B122 Routine language C NO B123 Routine language COBOL NO B124 Routine language Fortran NO B125 Routine language MUMPS NO B126 Routine language Pascal NO B127 Routine language PL/I NO B128 Routine language SQL YES B200 Polymorphic table functions NO B201 More than one PTF generic table parameter NO B202 PTF copartitioning NO B203 More than one copartition specification NO B204 PRUNE WHEN EMPTY NO B205 Pass-through columns NO B206 PTF descriptor parameters NO B207 Cross products of partitionings NO B208 PTF component procedure interface NO B209 PTF extended names NO B211 Module language Ada: VARCHAR and NUMERIC support NO B221 Routine language Ada: VARCHAR and NUMERIC support NO E011 Numeric data types YES E011 Numeric data types 01 INTEGER and SMALLINT data types YES E011 Numeric data types 02 REAL, DOUBLE PRECISION, and FLOAT data types YES E011 Numeric data types 03 DECIMAL and NUMERIC data types YES E011 Numeric data types 04 Arithmetic operators YES E011 Numeric data types 05 Numeric comparison YES E011 Numeric data types 06 Implicit casting among the numeric data types YES E021 Character data types YES E021 Character string types 01 CHARACTER data type YES E021 Character string types 02 CHARACTER VARYING data type YES E021 Character string types 03 Character literals YES E021 Character string types 04 CHARACTER_LENGTH function YES trims trailing spaces from CHARACTER values before counting E021 Character string types 05 OCTET_LENGTH function YES E021 Character string types 06 SUBSTRING function YES E021 Character string types 07 Character concatenation YES E021 Character string types 08 UPPER and LOWER functions YES E021 Character string types 09 TRIM function YES E021 Character string types 10 Implicit casting among the character string types YES E021 Character string types 11 POSITION function YES E021 Character string types 12 Character comparison YES E031 Identifiers YES E031 Identifiers 01 Delimited identifiers YES E031 Identifiers 02 Lower case identifiers YES E031 Identifiers 03 Trailing underscore YES E051 Basic query specification YES E051 Basic query specification 01 SELECT DISTINCT YES E051 Basic query specification 02 GROUP BY clause YES E051 Basic query specification 04 GROUP BY can contain columns not in